RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison
|
|
|
- Randolph Barton
- 10 years ago
- Views:
Transcription
1 RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison
2 Biological sequence databases Originally just a storage place for sequences. Currently the databases are bioinformatics work bench which provide many tools for retrieving, comparing and analyzing sequences. There are many different types of sequence databases. Global nucleotide sequence storage databases: GenBank of NCBI (National Center for Biotechnology Information) The European Molecular Biology Laboratory (EMBL) database The DNA Data Bank of Japan (DDBJ) Genome-centered databases NCBI genomes Ensembl Genome Browser UCSC Genome Bioinformatics Site Protein Databases SwissProt
3 Web browsers for accessing genome data Entrez Life Sciences Search Engine (US National Institutes of Health) Ensembl Genome Browser (European Bioinformatics Institute) UCSC Genome Bioinformatics Site (University of California at Santa Cruz)
4 Entrez A service of the US National Center for Biotechnology Information (NCBI) 29 core search pages interconnecting different types of information
5 Entrez Among the most valuable tools are nucleotide, EST and protein sequence databases, the Human Genome Resources, Microbial Genome Resources, Complete Genomes tools, etc.
6 GenBank and PubMed The NIH also maintains GenBank and PubMed databases (both linked to Entrez) GenBank is a genetic sequence database that provides an annotated collection of all genomic and cdna sequences that are in the public domain. In august 2009, there were 106,533,156,756 bases in 108,431,692 sequence records in the traditional GenBank divisions. PubMed is a literature search engine providing access to all published medically related articles, abstracts and journals.
7 Ensemble Ensembl is a joined project between European Bioinformatics Institute (EMBO) and the Sanger Institute in Cambridge. Its major focus is the genomes of animals and other eukaryotes. The annotation of most of the genomes in Ensembl database have been processed automatically though annotation pipelines. Genomes of five species (human, mouse, zebrafish, pig and dog) have been carefully annotated by manual curation.
8 Ensemble A nice feature is customizable home page that keeps track of your searches even if done from different computers. Ensemble has many tools for extracting and downloading userspecific aspects of the data in various formats suitable for high-end bioinformatics analysis chromosome location sequence contig exons
9 UCSC Genome Bioinformatics Site A highly sophisticated genome browser allowing for visualization of many genome features: mapping and sequencing, phenotype and disease association, genes and gene predictions, transcript evidence, gene expression data, comparative genomics, sequence variations genome.ucsc.edu
10 Any of the genome databases can be used to extract simple sequence information Depending of the question asked by a researcher, one or another database may be more suitable to specific needs
11 What to keep in mind when working with sequence databases NCBI (The National Center for Biotechnology Information) accepts all submitted sequences and does not check whether the sequence is accurate or not. Annotations of most genes and genomes are done by researchers and except for specific Reference Sequences (RefSeqs) are not curated by Genbank experts. As a result, the structure of the same gene reported by different labs can be different! Furthermore: All genomes are full of SNPs and other polymorphisms. Gene finding algorithms are not perfect, especially when it comes to predicting splice sites. Alternative splicing can lead to different transcripts (different versions) of the same gene. The implication is: there is often no single correct sequence for a given gene
12 GenBank Extracting a segment of a sequence which contains the gene of interest. Task: find the sequence of the Yersinia pestis gene lacz. Point your browser to the NCBI main site: search criteria select database ( nucleotides for GenBank) click the Go button
13 GenBank In the results page, find the link to the entry of interest. The list may have many pages. The link you are looking for, might not be the first entry. A complete genome of a Yersinia pestis strain. Should have the gene you are looking for. the genomic database a standard Genbank entry essentially the same info but slightly different format
14 GenBank A complete genome page contains lots of info and thousands of genes. Use the find function of your browser to find lacz.
15 GenBank read info about your gene click either gene or CDS link to go to the gene sequence
16 GenBank Scroll to the bottom of the file to see the nucleotide and amino acid sequence of the gene amino acid sequence of the encoded protein nucleotide sequence of the gene. Note, that this gene is encoded in a complementary strand relative to the one shown in the database. Therefore, the sequence shows the template strand.
17 GenBank Choose the FASTA format at the top of the entry page to get a pure sequence that you can cut and paste into another application
18 select nucleotides for GenBank access Extracting sequence of a human gene How to extract sequence of a human gene: 1. Go to the Entrez site: In the search window, type the name of the gene, identifier, or GenBank accession number
19 Extracting sequence of a gene Among several pages of matching entries find the one you want to examine and click on the accession number
20 Extracting sequence of a gene LOCUS: length, genomic/mrna, date of submission DEFINITION: species, common gene name ACCESSION: GenBank accession number REFERENCE: authors, publication (if any), history Coding sequence (CDS) coordinates The encoded predicted protein Miscellaneous features (exon boundaries, identified protein domains, mutations, etc.). Features can be associated with links to other databases: protein domain database (PFAM), Mendelian inheritance database (OMIM), etc. FEATURE TABLE
21 The sequence of the gene is shown at the bottom. The default format is blocks of 10 nucleotides, 60 bases per row. At the top of the page, one can choose the format in which sequence is displayed. Sequence can be simply copied form the web page and imported into any of the bioinformatics applications or directly exported into some of them. Extracting sequence of a gene
22 Homologous sequences If sequences of two proteins are similar, they most likely are derived from the same ancestor and therefore, have similar structures and similar biological functions. Science by analogy: If something is true for one such sequence it is probably true also for the other. Studying a protein (a gene) in the lab takes years, searching a database takes seconds. Proteins (genes) that have the same ancestor are called homologous. Homologous proteins (genes) usually have similar sequences, structures and functions. A general rule: two proteins are likely homologous if their sequences are at least 25% identical. DNA sequences are likely homologous if they are at least 70% identical. Do not confuse homology and similarity. Homology is a binary parameter (homologus vs. non-homologous) and reflects evolutionary relationship between the sequences. Similarity is a quantitative measure two sequences can be more similar or less similar. Similarity does not necessarily reflect evolutionary relationship between sequences.
23 Sequence comparison A pair-wise comparison of sequences is a very common task in bioinformatics and in genomics. By aligning two sequences we are testing the hypothesis that the sequences are homologous, meaning that each pair of aligned residues are descendants of a common ancestral residue. AGGRTYYFWNEDKKRGHYPLIVAGRHKSAGRYPLAVFDEKRHFFVAPPKRTYDH! AGGKTYFFWNEEKRRGHYPIIVLGRHA-AGRYPVVVFDAKRHFAVAPPKKTYDH! If two sequences have some similarity simply by chance this does not have any biological significance. But if two sequences are homologous, by comparing them we can gain information about their structure, function and evolution. The most common purpose of sequence comparison in bioinformatics is identifying homologous sequences.
24 Sequence comparison Sequence comparison is not trivial. Consider two alignments of two sequences: Alignment 1 Alignment 2! Sequence 1 ACGCTGA ACGCTGA! Sequence 2 A--CTGT ACTGT--! Which alignment is better? The frequency of common evolutionary events determines the alignment parameters ATCG! ATCG! ATCG! ATCG! ATCG ATCG! ACCG ATCG! ATCG ACG! ATTCG ATCG! ATCG! ATCG! ACCG! ATCG! ATCG! A-CG! ATTCG! AT-CG! identity substitution! deletion insertion The frequency of substitutions is higher than the frequency of indels (insertions or deletions)
25 Sequence comparison Computational alignment of two sequences is based on assigning a score to each possible alignment. The score is composed of bonuses (for a match) and penalties for a mismatch or indel. Let us assign bonus of +3 points for a match, a penalty of -1 for a mismatch and a penalty of -5 for an indel. Align two sequences: ACGCTTGA and ACCCGTTA ACGCTTGA!! ACCCGTTA! Score: = + 12 ACGC-TTGA!! ACCCGTT-A! Score: = + 7 AC--GCTTGA!! ACCCGTTA--! Score: = - 10 The choice of parameters depends on the biological model. The choice of parameters defines the score of the alignment.
26 BLAST Once you have determined the sequence of your protein (gene), the next most important thing to do is to find in the database sequences similar to the one you are studying and to retrieve as much information about those sequences as possible. Then you decide which of the known information applies to your protein (gene). Searching sequence databases for the entries with the sequence similar to the sequence of your protein or gene is the most frequently used bioinformatics procedure in genomic sciences. The most frequently used tool for that is BLAST Basic Local Alignment and Search Tool. (Altschul et al., J.Mol.Biol. 1990) BLAST is the most popular bioinformatics data-mining tool.
27 BLAST BLAST is a tool that searches large sequence databases returning sequences that have regions of similarity to a query sequence provided by the user. BLAST finds isolated regions in sequence pairs that have high levels of similarity. BLAST concatenates all the sequences in the database into one continuous VEEEEEEEEEEEERY long sequence and then looks in this sequence for the matches to segments of the query sequence.
28 BLAST BLAST comes in many different flavors. The choice of the BLAST protocol depends on your sequence and the question you ask. For protein searches: blastp compares a protein sequence with a protein database ( p for protein) tblastn compares a protein sequence with a translated nucleotide database ( t for translated) Choice of BLAST : I want to find out something about my protein: use blastp. Find proteins similar to yours and what is known about them. I want to discover genes in other organisms that code for a protein similar to mine: use tblastn to compare your protein to the nucleotide sequences translated in 6 reading frames.
29 BLAST There are several servers which make BLAST accessible world-wide to the researchers. Server at NCBI (hosted in the US): Highly pre-configured for the most common (basic) searches. A great place to start if you do not ask any very specific question about your sequence. Server at EMBnet-ExPASy (hosted in Europe) Gives many choices to configure your search. Very useful if you ask specific bioinformatics questions. Both servers are freely accessible to the academic researchers!
30 blastp Running a balstp search Q: Are there any protein similar to the hamster nucleolin? Approach: find a protein similar to hamster nucleolin protein in the database Swiss-Prot which contains a wealth of information about all the studied proteins. Point the browser to choose the type of blast you want to run (protein blast, in this case)
31 blastp Put either your protein accession number or cut and paste its sequence. Your sequence (retrieved via its accession number or written in the window) is called the query sequence choose the database in which you want to search if needed, limit the search to a specific organism Click the BLAST button
32 blastp An intermediate screen will appear for few seconds to few minutes while the search is in progress. Then the results page opens. The results page may have lots of information and many pages. Always examine it before you choose to print! The results page has three important areas: a graphic display, a hit list, and the alignments.
33 The query sequence bar blastp A graphic display shows which segment of your query is similar to the sequences in the database. The similarity bars are colorcoded to reflect the degree of similarity: red the most similar magenta still very good green intermediate blue twilight zone black match, but a really bad one A graphic display Some matches do not extend across the entire sequence: they may represent conserved domains in different, even unrelated proteins. Thus, nucleolins, like many other proteins, contain an RNA binding domain.
34 blastp The hit list The sequence accession number and the name Description The bit score ( goodness of the match). Ignore anything below 50. The E-value (the expectation value). Statistical significance of the match to the hit: how often a match like this would be found if there is no real match in the database. Matches with the E-value below (e-3) is worth exploring. Genomic link
35 The sequence accession number and the name (clickable!) blastp The alignments The percentage of identity (anything more than 25% is worth exploring) The Positives : identity plus similar residues The Gaps the nonaligned residues The coordinates in the query sequence and in the hit (subject) sequence top line the query middle line consensus bottom line the hit
36 blastp One you choose which hit sequence from the found list you want to work with, you can click on the name of that sequence. The browser will bring you to the database entry of that sequence. From there you can retrieve some primary info (origin, name, length). You can find the relevant publications or take the accession number and look for the info about the protein in other databases.
37 Blasting DNA sequence Two major modes of searching nucleotide sequence databases are blastn searches nucleotide sequence databases using nucleotide sequence queries blastx searches protein databases using a translated nucleotide query Choice of BLAST: I want to find gene regulatory regions similar to mine: use blastn. Find nucleotide sequences similar to yours in other genomes. I want to find out whether my sequence corresponds to a protein gene: use blastx. Find known proteins similar to the one encoded in your sequence.
Bioinformatics Resources at a Glance
Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences
Pairwise Sequence Alignment
Pairwise Sequence Alignment [email protected] SS 2013 Outline Pairwise sequence alignment global - Needleman Wunsch Gotoh algorithm local - Smith Waterman algorithm BLAST - heuristics What
Just the Facts: A Basic Introduction to the Science Underlying NCBI Resources
1 of 8 11/7/2004 11:00 AM National Center for Biotechnology Information About NCBI NCBI at a Glance A Science Primer Human Genome Resources Model Organisms Guide Outreach and Education Databases and Tools
Similarity Searches on Sequence Databases: BLAST, FASTA. Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Basel, October 2003
Similarity Searches on Sequence Databases: BLAST, FASTA Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Basel, October 2003 Outline Importance of Similarity Heuristic Sequence Alignment:
Module 1. Sequence Formats and Retrieval. Charles Steward
The Open Door Workshop Module 1 Sequence Formats and Retrieval Charles Steward 1 Aims Acquaint you with different file formats and associated annotations. Introduce different nucleotide and protein databases.
GenBank, Entrez, & FASTA
GenBank, Entrez, & FASTA Nucleotide Sequence Databases First generation GenBank is a representative example started as sort of a museum to preserve knowledge of a sequence from first discovery great repositories,
When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want
1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very
BLAST. Anders Gorm Pedersen & Rasmus Wernersson
BLAST Anders Gorm Pedersen & Rasmus Wernersson Database searching Using pairwise alignments to search databases for similar sequences Query sequence Database Database searching Most common use of pairwise
Biological Databases and Protein Sequence Analysis
Biological Databases and Protein Sequence Analysis Introduction M. Madan Babu, Center for Biotechnology, Anna University, Chennai 25, India Bioinformatics is the application of Information technology to
Searching Nucleotide Databases
Searching Nucleotide Databases 1 When we search a nucleic acid databases, Mascot always performs a 6 frame translation on the fly. That is, 3 reading frames from the forward strand and 3 reading frames
BIOINFORMATICS TUTORIAL
Bio 242 BIOINFORMATICS TUTORIAL Bio 242 α Amylase Lab Sequence Sequence Searches: BLAST Sequence Alignment: Clustal Omega 3d Structure & 3d Alignments DO NOT REMOVE FROM LAB. DO NOT WRITE IN THIS DOCUMENT.
Teaching Bioinformatics to Undergraduates
Teaching Bioinformatics to Undergraduates http://www.med.nyu.edu/rcr/asm Stuart M. Brown Research Computing, NYU School of Medicine I. What is Bioinformatics? II. Challenges of teaching bioinformatics
BIO 3350: ELEMENTS OF BIOINFORMATICS PARTIALLY ONLINE SYLLABUS
BIO 3350: ELEMENTS OF BIOINFORMATICS PARTIALLY ONLINE SYLLABUS NEW YORK CITY COLLEGE OF TECHNOLOGY The City University Of New York School of Arts and Sciences Biological Sciences Department Course title:
Genomes and SNPs in Malaria and Sickle Cell Anemia
Genomes and SNPs in Malaria and Sickle Cell Anemia Introduction to Genome Browsing with Ensembl Ensembl The vast amount of information in biological databases today demands a way of organising and accessing
SeqScape Software Version 2.5 Comprehensive Analysis Solution for Resequencing Applications
Product Bulletin Sequencing Software SeqScape Software Version 2.5 Comprehensive Analysis Solution for Resequencing Applications Comprehensive reference sequence handling Helps interpret the role of each
Introduction to Bioinformatics 3. DNA editing and contig assembly
Introduction to Bioinformatics 3. DNA editing and contig assembly Benjamin F. Matthews United States Department of Agriculture Soybean Genomics and Improvement Laboratory Beltsville, MD 20708 [email protected]
Linear Sequence Analysis. 3-D Structure Analysis
Linear Sequence Analysis What can you learn from a (single) protein sequence? Calculate it s physical properties Molecular weight (MW), isoelectric point (pi), amino acid content, hydropathy (hydrophilic
Analyzing A DNA Sequence Chromatogram
LESSON 9 HANDOUT Analyzing A DNA Sequence Chromatogram Student Researcher Background: DNA Analysis and FinchTV DNA sequence data can be used to answer many types of questions. Because DNA sequences differ
Guide for Bioinformatics Project Module 3
Structure- Based Evidence and Multiple Sequence Alignment In this module we will revisit some topics we started to look at while performing our BLAST search and looking at the CDD database in the first
SGI. High Throughput Computing (HTC) Wrapper Program for Bioinformatics on SGI ICE and SGI UV Systems. January, 2012. Abstract. Haruna Cofer*, PhD
White Paper SGI High Throughput Computing (HTC) Wrapper Program for Bioinformatics on SGI ICE and SGI UV Systems Haruna Cofer*, PhD January, 2012 Abstract The SGI High Throughput Computing (HTC) Wrapper
Note: This document wh_informatics_practical.doc and supporting materials can be downloaded at
Woods Hole Zebrafish Genetics and Development Bioinformatics/Genomics Lab Ian Woods Note: This document wh_informatics_practical.doc and supporting materials can be downloaded at http://faculty.ithaca.edu/iwoods/docs/wh/
Molecular Databases and Tools
NWeHealth, The University of Manchester Molecular Databases and Tools Afternoon Session: NCBI/EBI resources, pairwise alignment, BLAST, multiple sequence alignment and primer finding. Dr. Georgina Moulton
Bioinformatics Grid - Enabled Tools For Biologists.
Bioinformatics Grid - Enabled Tools For Biologists. What is Grid-Enabled Tools (GET)? As number of data from the genomics and proteomics experiment increases. Problems arise for the current sequence analysis
Tutorial. Reference Genome Tracks. Sample to Insight. November 27, 2015
Reference Genome Tracks November 27, 2015 Sample to Insight CLC bio, a QIAGEN Company Silkeborgvej 2 Prismet 8000 Aarhus C Denmark Telephone: +45 70 22 32 44 www.clcbio.com [email protected] Reference
A Tutorial in Genetic Sequence Classification Tools and Techniques
A Tutorial in Genetic Sequence Classification Tools and Techniques Jake Drew Data Mining CSE 8331 Southern Methodist University [email protected] www.jakemdrew.com Sequence Characters IUPAC nucleotide
Biological Sequence Data Formats
Biological Sequence Data Formats Here we present three standard formats in which biological sequence data (DNA, RNA and protein) can be stored and presented. Raw Sequence: Data without description. FASTA
SICKLE CELL ANEMIA & THE HEMOGLOBIN GENE TEACHER S GUIDE
AP Biology Date SICKLE CELL ANEMIA & THE HEMOGLOBIN GENE TEACHER S GUIDE LEARNING OBJECTIVES Students will gain an appreciation of the physical effects of sickle cell anemia, its prevalence in the population,
Bio-Informatics Lectures. A Short Introduction
Bio-Informatics Lectures A Short Introduction The History of Bioinformatics Sanger Sequencing PCR in presence of fluorescent, chain-terminating dideoxynucleotides Massively Parallel Sequencing Massively
A Multiple DNA Sequence Translation Tool Incorporating Web Robot and Intelligent Recommendation Techniques
Proceedings of the 2007 WSEAS International Conference on Computer Engineering and Applications, Gold Coast, Australia, January 17-19, 2007 402 A Multiple DNA Sequence Translation Tool Incorporating Web
A Primer of Genome Science THIRD
A Primer of Genome Science THIRD EDITION GREG GIBSON-SPENCER V. MUSE North Carolina State University Sinauer Associates, Inc. Publishers Sunderland, Massachusetts USA Contents Preface xi 1 Genome Projects:
Gene Models & Bed format: What they represent.
GeneModels&Bedformat:Whattheyrepresent. Gene models are hypotheses about the structure of transcripts produced by a gene. Like all models, they may be correct, partly correct, or entirely wrong. Typically,
Focusing on results not data comprehensive data analysis for targeted next generation sequencing
Focusing on results not data comprehensive data analysis for targeted next generation sequencing Daniel Swan, Jolyon Holdstock, Angela Matchan, Richard Stark, John Shovelton, Duarte Mohla and Simon Hughes
Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011
Sequence Formats and Sequence Database Searches Gloria Rendon SC11 Education June, 2011 Sequence A is the primary structure of a biological molecule. It is a chain of residues that form a precise linear
Module 10: Bioinformatics
Module 10: Bioinformatics 1.) Goal: To understand the general approaches for basic in silico (computer) analysis of DNA- and protein sequences. We are going to discuss sequence formatting required prior
Clone Manager. Getting Started
Clone Manager for Windows Professional Edition Volume 2 Alignment, Primer Operations Version 9.5 Getting Started Copyright 1994-2015 Scientific & Educational Software. All rights reserved. The software
GenBank: A Database of Genetic Sequence Data
GenBank: A Database of Genetic Sequence Data Computer Science 105 Boston University David G. Sullivan, Ph.D. An Explosion of Scientific Data Scientists are generating ever increasing amounts of data. Relevant
Version 5.0 Release Notes
Version 5.0 Release Notes 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) +1.734.769.7249 (elsewhere) +1.734.769.7074 (fax) www.genecodes.com
Next Generation Sequencing: Technology, Mapping, and Analysis
Next Generation Sequencing: Technology, Mapping, and Analysis Gary Benson Computer Science, Biology, Bioinformatics Boston University [email protected] http://tandem.bu.edu/ The Human Genome Project took
Protein & DNA Sequence Analysis. Bobbie-Jo Webb-Robertson May 3, 2004
Protein & DNA Sequence Analysis Bobbie-Jo Webb-Robertson May 3, 2004 Sequence Analysis Anything connected to identifying higher biological meaning out of raw sequence data. 2 Genomic & Proteomic Data Sequence
DNA Sequencing Overview
DNA Sequencing Overview DNA sequencing involves the determination of the sequence of nucleotides in a sample of DNA. It is presently conducted using a modified PCR reaction where both normal and labeled
Introduction to Bioinformatics AS 250.265 Laboratory Assignment 6
Introduction to Bioinformatics AS 250.265 Laboratory Assignment 6 In the last lab, you learned how to perform basic multiple sequence alignments. While useful in themselves for determining conserved residues
Introduction to Genome Annotation
Introduction to Genome Annotation AGCGTGGTAGCGCGAGTTTGCGAGCTAGCTAGGCTCCGGATGCGA CCAGCTTTGATAGATGAATATAGTGTGCGCGACTAGCTGTGTGTT GAATATATAGTGTGTCTCTCGATATGTAGTCTGGATCTAGTGTTG GTGTAGATGGAGATCGCGTAGCGTGGTAGCGCGAGTTTGCGAGCT
Exercises for the UCSC Genome Browser Introduction
Exercises for the UCSC Genome Browser Introduction 1) Find out if the mouse Brca1 gene has non-synonymous SNPs, color them blue, and get external data about a codon-changing SNP. Skills: basic text search;
Module 3. Genome Browsing. Using Web Browsers to View Genome Annota4on. Kers4n Howe Wellcome Trust Sanger Ins4tute zfish- [email protected].
Module 3 Genome Browsing Using Web Browsers to View Genome Annota4on Kers4n Howe Wellcome Trust Sanger Ins4tute zfish- [email protected] Introduc.on Genome browsing The Ensembl gene set Guided examples
MUTATION, DNA REPAIR AND CANCER
MUTATION, DNA REPAIR AND CANCER 1 Mutation A heritable change in the genetic material Essential to the continuity of life Source of variation for natural selection New mutations are more likely to be harmful
Human Genome Organization: An Update. Genome Organization: An Update
Human Genome Organization: An Update Genome Organization: An Update Highlights of Human Genome Project Timetable Proposed in 1990 as 3 billion dollar joint venture between DOE and NIH with 15 year completion
UGENE Quick Start Guide
Quick Start Guide This document contains a quick introduction to UGENE. For more detailed information, you can find the UGENE User Manual and other special manuals in project website: http://ugene.unipro.ru.
Sequencing the Human Genome
Revised and Updated Edvo-Kit #339 Sequencing the Human Genome 339 Experiment Objective: In this experiment, students will read DNA sequences obtained from automated DNA sequencing techniques. The data
How To Use The Assembly Database In A Microarray (Perl) With A Microarcode) (Perperl 2) (For Macrogenome) (Genome 2)
The Ensembl Core databases and API Useful links Installation instructions: http://www.ensembl.org/info/docs/api/api_installation.html Schema description: http://www.ensembl.org/info/docs/api/core/core_schema.html
SUBMITTING DNA SEQUENCES TO THE DATABASES
Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Second Edition Andreas D. Baxevanis, B.F. Francis Ouellette Copyright 2001 John Wiley & Sons, Inc. ISBNs: 0-471-38390-2 (Hardback);
org.rn.eg.db December 16, 2015 org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank accession numbers.
org.rn.eg.db December 16, 2015 org.rn.egaccnum Map Entrez Gene identifiers to GenBank Accession Numbers org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank
Tutorial for Windows and Macintosh. Preparing Your Data for NGS Alignment
Tutorial for Windows and Macintosh Preparing Your Data for NGS Alignment 2015 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) 1.734.769.7249
Introduction to Bioinformatics 2. DNA Sequence Retrieval and comparison
Introduction to Bioinformatics 2. DNA Sequence Retrieval and comparison Benjamin F. Matthews United States Department of Agriculture Soybean Genomics and Improvement Laboratory Beltsville, MD 20708 [email protected]
Biological Sciences Initiative. Human Genome
Biological Sciences Initiative HHMI Human Genome Introduction In 2000, researchers from around the world published a draft sequence of the entire genome. 20 labs from 6 countries worked on the sequence.
SOP 3 v2: web-based selection of oligonucleotide primer trios for genotyping of human and mouse polymorphisms
W548 W552 Nucleic Acids Research, 2005, Vol. 33, Web Server issue doi:10.1093/nar/gki483 SOP 3 v2: web-based selection of oligonucleotide primer trios for genotyping of human and mouse polymorphisms Steven
Human-Mouse Synteny in Functional Genomics Experiment
Human-Mouse Synteny in Functional Genomics Experiment Ksenia Krasheninnikova University of the Russian Academy of Sciences, JetBrains [email protected] September 18, 2012 Ksenia Krasheninnikova
The world of non-coding RNA. Espen Enerly
The world of non-coding RNA Espen Enerly ncrna in general Different groups Small RNAs Outline mirnas and sirnas Speculations Common for all ncrna Per def.: never translated Not spurious transcripts Always/often
BIO 3352: BIOINFORMATICS II HYBRID COURSE SYLLABUS
BIO 3352: BIOINFORMATICS II HYBRID COURSE SYLLABUS NEW YORK CITY COLLEGE OF TECHNOLOGY The City University Of New York School of Arts and Sciences Biological Sciences Department Course title: Bioinformatics
PROC. CAIRO INTERNATIONAL BIOMEDICAL ENGINEERING CONFERENCE 2006 1. E-mail: [email protected]
BIOINFTool: Bioinformatics and sequence data analysis in molecular biology using Matlab Mai S. Mabrouk 1, Marwa Hamdy 2, Marwa Mamdouh 2, Marwa Aboelfotoh 2,Yasser M. Kadah 2 1 Biomedical Engineering Department,
Integration of data management and analysis for genome research
Integration of data management and analysis for genome research Volker Brendel Deparment of Zoology & Genetics and Department of Statistics Iowa State University 2112 Molecular Biology Building Ames, Iowa
DNA Replication & Protein Synthesis. This isn t a baaaaaaaddd chapter!!!
DNA Replication & Protein Synthesis This isn t a baaaaaaaddd chapter!!! The Discovery of DNA s Structure Watson and Crick s discovery of DNA s structure was based on almost fifty years of research by other
Bioinformatics: course introduction
Bioinformatics: course introduction Filip Železný Czech Technical University in Prague Faculty of Electrical Engineering Department of Cybernetics Intelligent Data Analysis lab http://ida.felk.cvut.cz
Custom TaqMan Assays For New SNP Genotyping and Gene Expression Assays. Design and Ordering Guide
Custom TaqMan Assays For New SNP Genotyping and Gene Expression Assays Design and Ordering Guide For Research Use Only. Not intended for any animal or human therapeutic or diagnostic use. Information in
Structure and Function of DNA
Structure and Function of DNA DNA and RNA Structure DNA and RNA are nucleic acids. They consist of chemical units called nucleotides. The nucleotides are joined by a sugar-phosphate backbone. The four
INTERNATIONAL CONFERENCE ON HARMONISATION OF TECHNICAL REQUIREMENTS FOR REGISTRATION OF PHARMACEUTICALS FOR HUMAN USE Q5B
INTERNATIONAL CONFERENCE ON HARMONISATION OF TECHNICAL REQUIREMENTS FOR REGISTRATION OF PHARMACEUTICALS FOR HUMAN USE ICH HARMONISED TRIPARTITE GUIDELINE QUALITY OF BIOTECHNOLOGICAL PRODUCTS: ANALYSIS
LESSON 9. Analyzing DNA Sequences and DNA Barcoding. Introduction. Learning Objectives
9 Analyzing DNA Sequences and DNA Barcoding Introduction DNA sequencing is performed by scientists in many different fields of biology. Many bioinformatics programs are used during the process of analyzing
Integrating Bioinformatics, Medical Sciences and Drug Discovery
Integrating Bioinformatics, Medical Sciences and Drug Discovery M. Madan Babu Centre for Biotechnology, Anna University, Chennai - 600025 phone: 44-4332179 :: email: [email protected] Bioinformatics
Welcome to the Plant Breeding and Genomics Webinar Series
Welcome to the Plant Breeding and Genomics Webinar Series Today s Presenter: Dr. Candice Hansey Presentation: http://www.extension.org/pages/ 60428 Host: Heather Merk Technical Production: John McQueen
Genome Viewing. Module 2. Using Genome Browsers to View Annotation of the Human Genome
Module 2 Genome Viewing Using Genome Browsers to View Annotation of the Human Genome Bert Overduin, Ph.D. PANDA Coordination & Outreach EMBL - European Bioinformatics Institute Wellcome Trust Genome Campus
Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism )
Biology 1406 Exam 3 Notes Structure of DNA Ch. 10 Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism ) Proteins
Worksheet - COMPARATIVE MAPPING 1
Worksheet - COMPARATIVE MAPPING 1 The arrangement of genes and other DNA markers is compared between species in Comparative genome mapping. As early as 1915, the geneticist J.B.S Haldane reported that
BIOINF 525 Winter 2016 Foundations of Bioinformatics and Systems Biology http://tinyurl.com/bioinf525-w16
Course Director: Dr. Barry Grant (DCM&B, [email protected]) Description: This is a three module course covering (1) Foundations of Bioinformatics, (2) Statistics in Bioinformatics, and (3) Systems
Simplifying Data Interpretation with Nexus Copy Number
Simplifying Data Interpretation with Nexus Copy Number A WHITE PAPER FROM BIODISCOVERY, INC. Rapid technological advancements, such as high-density acgh and SNP arrays as well as next-generation sequencing
Processing Genome Data using Scalable Database Technology. My Background
Johann Christoph Freytag, Ph.D. [email protected] http://www.dbis.informatik.hu-berlin.de Stanford University, February 2004 PhD @ Harvard Univ. Visiting Scientist, Microsoft Res. (2002)
Appendix 2 Molecular Biology Core Curriculum. Websites and Other Resources
Appendix 2 Molecular Biology Core Curriculum Websites and Other Resources Chapter 1 - The Molecular Basis of Cancer 1. Inside Cancer http://www.insidecancer.org/ From the Dolan DNA Learning Center Cold
Algorithms in Computational Biology (236522) spring 2007 Lecture #1
Algorithms in Computational Biology (236522) spring 2007 Lecture #1 Lecturer: Shlomo Moran, Taub 639, tel 4363 Office hours: Tuesday 11:00-12:00/by appointment TA: Ilan Gronau, Taub 700, tel 4894 Office
Name Class Date. Figure 13 1. 2. Which nucleotide in Figure 13 1 indicates the nucleic acid above is RNA? a. uracil c. cytosine b. guanine d.
13 Multiple Choice RNA and Protein Synthesis Chapter Test A Write the letter that best answers the question or completes the statement on the line provided. 1. Which of the following are found in both
1 Mutation and Genetic Change
CHAPTER 14 1 Mutation and Genetic Change SECTION Genes in Action KEY IDEAS As you read this section, keep these questions in mind: What is the origin of genetic differences among organisms? What kinds
Comparing Methods for Identifying Transcription Factor Target Genes
Comparing Methods for Identifying Transcription Factor Target Genes Alena van Bömmel (R 3.3.73) Matthew Huska (R 3.3.18) Max Planck Institute for Molecular Genetics Folie 1 Transcriptional Regulation TF
Bioinformatics Tools Tutorial Project Gene ID: KRas
Bioinformatics Tools Tutorial Project Gene ID: KRas Bednarski 2011 Original project funded by HHMI Bioinformatics Projects Introduction and Tutorial Purpose of this tutorial Illustrate the link between
Core Bioinformatics. Degree Type Year Semester. 4313473 Bioinformàtica/Bioinformatics OB 0 1
Core Bioinformatics 2014/2015 Code: 42397 ECTS Credits: 12 Degree Type Year Semester 4313473 Bioinformàtica/Bioinformatics OB 0 1 Contact Name: Sònia Casillas Viladerrams Email: [email protected]
Genome Explorer For Comparative Genome Analysis
Genome Explorer For Comparative Genome Analysis Jenn Conn 1, Jo L. Dicks 1 and Ian N. Roberts 2 Abstract Genome Explorer brings together the tools required to build and compare phylogenies from both sequence
Final Project Report
CPSC545 by Introduction to Data Mining Prof. Martin Schultz & Prof. Mark Gerstein Student Name: Yu Kor Hugo Lam Student ID : 904907866 Due Date : May 7, 2007 Introduction Final Project Report Pseudogenes
CD-HIT User s Guide. Last updated: April 5, 2010. http://cd-hit.org http://bioinformatics.org/cd-hit/
CD-HIT User s Guide Last updated: April 5, 2010 http://cd-hit.org http://bioinformatics.org/cd-hit/ Program developed by Weizhong Li s lab at UCSD http://weizhong-lab.ucsd.edu [email protected] 1. Introduction
Database schema documentation for SNPdbe
Database schema documentation for SNPdbe Changes 02/27/12: seqs_containingsnps.taxid removed dbsnp_snp.tax_id renamed to dbsnp_snp.taxid General information: Data in SNPdbe is organized on several levels.
AS4.1 190509 Replaces 260806 Page 1 of 50 ATF. Software for. DNA Sequencing. Operators Manual. Assign-ATF is intended for Research Use Only (RUO):
Replaces 260806 Page 1 of 50 ATF Software for DNA Sequencing Operators Manual Replaces 260806 Page 2 of 50 1 About ATF...5 1.1 Compatibility...5 1.1.1 Computer Operator Systems...5 1.1.2 DNA Sequencing
Lab 2/Phylogenetics/September 16, 2002 1 PHYLOGENETICS
Lab 2/Phylogenetics/September 16, 2002 1 Read: Tudge Chapter 2 PHYLOGENETICS Objective of the Lab: To understand how DNA and protein sequence information can be used to make comparisons and assess evolutionary
Genetics Module B, Anchor 3
Genetics Module B, Anchor 3 Key Concepts: - An individual s characteristics are determines by factors that are passed from one parental generation to the next. - During gamete formation, the alleles for
Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance?
Optimization 1 Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance? Where to begin? 2 Sequence Databases Swiss-prot MSDB, NCBI nr dbest Species specific ORFS
