Introduction to Bioinformatics 2. DNA Sequence Retrieval and comparison
|
|
|
- Archibald Lawson
- 10 years ago
- Views:
Transcription
1 Introduction to Bioinformatics 2. DNA Sequence Retrieval and comparison Benjamin F. Matthews United States Department of Agriculture Soybean Genomics and Improvement Laboratory Beltsville, MD What we will cover today Retrieving a known DNA sequence Similarity searching with a DNA sequence BLAST
2 Retrieving a DNA sequence You read a paper and.. Is full-length clone of gene available? Is at least some of the DNA sequence available? (EST sequence)?
3 Finding Sequences in Databases The public DNA and protein sequence databases are huge. In order for these databases to be useful, the data must be readily accessible to researchers. What Are You Looking For? A gene? DNA or protein sequence? DNA sequences are essentially all in GenBank Genomic, mrna, cdna, EST? Proteins are harder to pin down GenPept (GenBank Peptides) is huge and poorly annotated - lots of junk SwissProt is carefully annotated, but not fully comprehensive PIR is somewhere in between
4 Large Databases Once upon a time, GenBank sent out sequence updates on CD-ROM disks a few times per year. Now GenBank is over 95 Gigabytes (28 billion bases) Most biocomputing sites update their copy of GenBank every day over the internet. Scientists access GenBank directly over the Web You can search DNA sequence database Retrieve known sequences by Keyword search Accession numbers If you know some DNA sequence Compare your DNA sequence with those in database Basic Local Alignment Search Tool (BLAST) searches
5 Retrieve a DNA sequence ENTREZ Click Nucleotide GenBank OR otide Accession number Keyword search Entrez is a Tool for Finding Sequences GenBank is managed by the NCBI (National Center for Biotechnology Information) which is a part of the US National Library of Medicine. NCBI has created a Web-based tool called Entrez for finding sequences in GenBank. Each sequence in GenBank has a unique accession number. Entrez can also search for keywords such as gene names, protein names, and the names of orgainisms or biological functions
6 Entrez is a Database The Entrez database contains all of the nucleotide and protein sequences in GenBank (updated daily) along with all of the literature in MEDLINE and the 3-D protein structures in PDB (Protein Data Base). Entrez is much more than a database, it is a both a powerful search engine and a pre-computed list of relationships amnog all of its data elements Entrez is Internally Cross-linked DNA and protein sequences are linked to other similar sequences Medline citations are linked to other citations that contain similar keywords 3-D structures are linked to similar structures
7 Databases contain more than just DNA & protein sequences
8 GenBank National Institute of Health, National Library of Medicine, National Center for Biotechnology Information banksearch.html Retrieve a sequence from GenBank Analyze raw sequence data Base calling Editing Obtaining a consensus sequence Translating Restriction mapping Similarity comparisons Motif searches
9 Accession Numbers!! Databases are designed to be searched by accession numbers (and locus IDs) These are guaranteed to be non-redundant, accurate, and not to change. Searching by gene names and keywords is inexact and retrieves more than one record usually
10 Type in a Query term Enter your search words in the query box and hit the Go button
11
12
13
14 GenBank Records Databases are composed of records Flat File Format Provides information Standard, consistent organization of data
15 Flat file format Organized in a structured manner One big file Large body of information assembled and distributed in consistent format Lack support for procession transactions (inserts and updates)
16 Some Fields of GenBank Record Locus Name Sequence length Molecule type Definition GenBank accession number Version Keywords Source Organism Reference Reference Authors Title Journal Medline Other references features Amino acid translation Nucleotide sequence
17 Locus Name Unique Up to 10 characters 6 character Genus species 8 characters Just accession number Better to search for accession number than Locus Name
18 GenBank Accession Number Unique identifier for sequence record Usually a combination of letter(s) and numbers Do not change even if information changes Newer accession numbers to new submission using some of this data
19 Refine the Query Often a search finds too many (or too few) sequences, so you can go back and try again with more (or fewer) keywords in your query The History feature allows you to combine any of your past queries. The Limits feature allows you to limit a query to specific organisms, sequences submitted during a specific period of time, etc. [Many other features are designed to search for literature in MEDLINE]
20
21
22 DNA similarity search Find related seqeunces Find ESTs If not full-length, may allow assembly from ESTs Find other family members Organization and function Find similar genes from other cultivars SNP discovery Find similar genes from other organisms Phylogenetic relationships
23 ESTs (Expressed Sequence Tags) partial cdna sequences dbest at NCBI a comprehensive set of all public EST data UniGene at NCBI clusters of ESTs and know genes from key species does NOT have consensus sequences has far too many clusters to be representative of real genes (129 K human clusters) Find related DNA sequences Similarity Search (BLAST) NCBI GenBank database
24 BLAST Searches Compare your sequence with database Nucleotide Protein Targeted to a genome BLAST Basic Local Alignment Search Tool Local alignment Tutorial at: Tinfo/information3.html
25 BLAST Discontiguous Mega BLAST Comparison of diverged sequences especially from different organisms Alignments with low degree of identity Looks for hits in non-consecutive positions Mega BLAST Slight differences in similarity Not effective at low degree of identity Faster; handles longer sequences BLAST Local alignment tool ormation3.html
26
27 You have a sequence. Does it have similarity to other known genes??? Copy DNA sequence from file GGTTGTGCCAAGTCCATTTTCTATTGACTTCTTCCTCATTTGATCCAAGATGAACAGCAC ACATGCACTTGACATGTTACCATACTCGCTAAGCACGTGTCTAGTAGCTTCCATTTTTTC ATGCTTCAATCCTAACTTAGCCTCAACTTGGTCCAAAATTGCTGGTCCACCAGGGTGTGC AATCCAAAAGATAGAGTTGTAATCATCAATTTCTAAGGGTTTGAAGGCTTCAACCAAGGC CTTTTCGATGTTCTTGGAGATGAGTCCAGGAACATCCTTGAGGAGATGGAAAGTGAGTCC TACTTGGCGAAGGTGGCCATCAATAGCGCCTTCGCTGTCTGGAAGGATTGTTTGTGCAGT CCACACAAGCTCAAACAAAGGCTTTTCAGCTGGCAGAGGATCTGATCCAACAATGACAGC GCTGCACCATCTCCAAACAAGGCTTGCCCCACAAGGCTGTCAAGATGTGTGTCACTCGG GCCACGAAATGTGACTGCTGTGATCTCCGA
28
29
30 Nucleotide Protein Translations Retrieve results for an RID Your request has been successfully submitted and put into the Blast Queue. Query = (1509 letters) Your search was limited by an Entrez query: Glycine max The request ID is BLASTQ4 or The results are estimated to be ready in 37 seconds but may be done sooner. Please press "FORMAT!" when you wish to check your results. You may change the formatting options for your result via the form below and press "FORMAT!" again. You may also request results of a different search by entering any other valid request ID to see other recent jobs.
31
32
33
34 FASTA/BLAST Statistics E() value is equivalent to standard P value Significant if E() < 0.05 (smaller numbers are more significant) The E-value represents the likelihood that the observed alignment is due to chance alone. A value of 1 indicates that an alignment this good would happen by chance with any random sequence searched against this database. The histogram should follow expectations (asterisks) except for hits Interpretation of output very low E() values (e-100) are homologs or identical genes moderate E() values are related genes long list of gradually declining of E() values indicates a large gene family long regions of moderate similarity are more significant than short regions of high identity
35 What this does for you You identified what gene is encoded by your clone s sequence Perhaps you may have found the function of your gene You have more cdna sequences to add together to build a consensus and perhaps a full-length cdna Biological Relevance It is up to you, the biologist to scrutinize these alignments and determine if they are significant. Were you looking for a short region of nearly identical sequence or a larger region of general similarity? Are the mismatches conservative ones? Are the matching regions important structural components of the genes or just introns and flanking regions?
36 Borderline similarity What to do with matches with E() values in the range? this is the Twilight Zone retest these sequences and look for related hits (not just your original query sequence) similarity is transitive: if A~B and B~C, then A~C Advanced Similarity Techniques Automated ways of using the results of one search to initiate multiple searches INCA (Iterative Neighborhood Cluster Analysis) Takes results of one BLAST search, does new searches with each one, then combines all results into a single list JAVA applet, compatibility problems on some computers PSI BLAST Creates a position specific scoring matrix from the results of one BLAST search Uses this matrix to do another search builds a family of related sequences can t trust the resulting e-values
37
38 FASTA format One of three formats used for sequences Begins with single-line description followed by sequence data Description line starts with > Example: >gi pir TVFV2E TVFV2E envelope protein ELRLRYCAPAGFALLKCNDADYDGFKTNCSNVSVVHCTNLMNTTVTTGLLLNGSYSENRT QIWQKHRTSNDSALILLNKHYNLTVTCKRPGNKTVLPVTIMAGLVFHSQKYNLRLRQAWC HFPSNWKGAWKEVKEEIVNLPKERYRGTNDPKRIFFQRQWGDPETANLWFNCHGEFFYCK MDWFLNYLNNLTVDADHNECKNTSGTKSGNKRAPGPCVQRTYVACHIRSVIIWLETISKK TYAPPREGHLECTSTVTGMTVELNYIPKNRTNVTLSPQIESIWAAELDRYKLVEITPIGF APTEVRRYTGGHERQKRVPFVXXXXXXXXXXXXXXXXXXXXXXVQSQHLLAGILQQQKNL LAAVEAQQQMLKLTIWGVK The nucleic acid codes supported are: A --> adenosine C --> cytidine G --> guanine T --> thymidine U --> uridine R --> G A (purine) Y --> T C (pyrimidine) K --> G T (keto) M --> A C (amino) S --> G C (strong) W --> A T (weak) B --> G T C D --> G A T H --> A C T V --> G C A N --> A G C T (any) - gap of indeterminate length
39 accepted amino acid codes are: A alanine B aspartate or asparagine C cystine D aspartate E glutamate F phenylalanine G glycine H histidine I isoleucine K lysine L leucine M methionine N asparagine P proline Q glutamine R arginine S serine T threonine U selenocysteine V valine W tryptophan Y tyrosine Z glutamate or glutamine X any * translation stop - gap of indeterminate length
40 Other Sequence Search Tools SRS (Sequence Retrival Service) was created by Dr. Thure Etzold: [CABIOS 9(1); (1993)] It is a meta search engine for all types of biological data in hundreds of databases as well as about 20 sequence analysis programs SRS can be accessed over the WWW from many servers (mostly in Europe):
41 Why So Many Databases? If GenBank has all sequence data and Entrez is such a good query tool, then why are there so many other sequence databases? Specialized data (single species, immunoglobulins, etc.) Better annotation (i.e. SwissProt) Sequences linked to other data (ACEDB) Subbornness and local pride - EMBL, DDBJ Well designed databases are interlinked with others for supplemental data It is very hard to get all relevant information across all databases for any gene
42 Other Genetic Databases Genome Sequence - where does a gene fall on the genome integrate multiple layers of information > Sequence contigs, mrnas, predicted exons, etc. Single species? ESTs: NCBI SNPs: NCBI, (SNP Consortium) Metabolism/Pathways Gene Function (Genome Ontology) Protein motifs/domains and protein families
43 Genome Databases New area - in desperate need of development Chromosomes::Sequence::Contigs::Clones:: STS Markers::Genetic Markers::Genes:: Features::Expression data::phenotype No single database can hold it all UCSC is probably the best right now genome.ucsc.edu Need a data exchange and linkage infrastructure European Bioinformatics Institute Products and services Databases Literature Microarray nucleotide Toolbox with software Similarity searches Protein function Sequence analysis Structure
44 IDENTIFIERS dbest Id: EST name: yb01a01.s1 GenBank Acc: T48601 GenBank gi: GDB Id: CLONE INFO Clone Id: IMAGE:69864 (3') Other ESTs on clone:yb01a01.r1 DNA type: cdna PRIMERS Sequencing: -21m13 PolyA Tail: Unknown SEQUENCE GGCGGCTCAGTAGCAGGTGCCGTCCACCTCCGCCATGACAACAGACACATTGACATGGGT GGGTTTACCACCAAGCGTCCGATGGTCTTCTGTGTGAAGGCCAGCCAGGCGCCTCCATGG CACCATGCAGGAGAAGGNCTCCCCCTTCTTCCAGTCCTCGGCTGCCACGCGCAGTATGCT GGTCACACGAAGGTCGTGGTGCCCTGGCTGGNTCCTNCANGGATGCCCAAGTCAGGTACT TNTCGCGGGGCAGCTCCTGTGACCCCTGCAGCCAGCGAACCAGCACGTCCTTGGGGCTTN AAGCNGCGCTACCAGGCACTTCAACCGTTCNCCAGCTTCGTTCAGGGCCANCTTC Quality: High quality sequence stops at base: 277 Entry Created: Feb Last Updated: Feb COMMENTS High qality sequence stops: 277 Source: IMAGE Consortium, LLNL This clone is available royalty-free through LLNL ; contact the IMAGE Consortium ([email protected]) for further information. PUTATIVE ID Assigned by submitter similar to gb:s71043_rna1 IG ALPHA-2 CHAIN C REGION (HUMAN) LIBRARY Lib Name: Stratagene placenta (#937225) Organism: Homo sapiens Sex: male Organ: placenta Lab host: SOLR cells (kanamycin resistant) Vector: pbluescript SK- R. Site 1: EcoRI R. Site 2: XhoI Description: Cloned unidirectionally. Primer: Oligo dt. Caucasian. Average insert size: 1.2 kb; Uni-ZAP XR Vector; ~5' adaptor sequence: 5' GAATTCGGCACGAG 3' ~3' adaptor sequence: 5' CTCGAGTTTTTTTTTTTTTTTTTT 3'
45 Database Search Strategies General search principles - not limited to sequence (or to biology) Use accession numbers whenever possible Start with broad keywords and narrow the search using more specific terms Try variants of spelling, numbers, etc. Search all relevant databases Be persistent!! What we covered today Retrieving a known DNA sequence Similarity searching with a DNA sequence BLAST
Just the Facts: A Basic Introduction to the Science Underlying NCBI Resources
1 of 8 11/7/2004 11:00 AM National Center for Biotechnology Information About NCBI NCBI at a Glance A Science Primer Human Genome Resources Model Organisms Guide Outreach and Education Databases and Tools
RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison
RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the
Introduction to Bioinformatics 3. DNA editing and contig assembly
Introduction to Bioinformatics 3. DNA editing and contig assembly Benjamin F. Matthews United States Department of Agriculture Soybean Genomics and Improvement Laboratory Beltsville, MD 20708 [email protected]
Concluding lesson. Student manual. What kind of protein are you? (Basic)
Concluding lesson Student manual What kind of protein are you? (Basic) Part 1 The hereditary material of an organism is stored in a coded way on the DNA. This code consists of four different nucleotides:
Searching Nucleotide Databases
Searching Nucleotide Databases 1 When we search a nucleic acid databases, Mascot always performs a 6 frame translation on the fly. That is, 3 reading frames from the forward strand and 3 reading frames
Module 1. Sequence Formats and Retrieval. Charles Steward
The Open Door Workshop Module 1 Sequence Formats and Retrieval Charles Steward 1 Aims Acquaint you with different file formats and associated annotations. Introduce different nucleotide and protein databases.
Bioinformatics Resources at a Glance
Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences
When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want
1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very
Bioinformatics, Sequences and Genomes
Bioinformatics, Sequences and Genomes BL4273 Bioinformatics for Biologists Week 1 Daniel Barker, School of Biology, University of St Andrews Email [email protected] BL4273 and 4273π 4273π is a custom
GenBank, Entrez, & FASTA
GenBank, Entrez, & FASTA Nucleotide Sequence Databases First generation GenBank is a representative example started as sort of a museum to preserve knowledge of a sequence from first discovery great repositories,
Teaching Bioinformatics to Undergraduates
Teaching Bioinformatics to Undergraduates http://www.med.nyu.edu/rcr/asm Stuart M. Brown Research Computing, NYU School of Medicine I. What is Bioinformatics? II. Challenges of teaching bioinformatics
Biological Sequence Data Formats
Biological Sequence Data Formats Here we present three standard formats in which biological sequence data (DNA, RNA and protein) can be stored and presented. Raw Sequence: Data without description. FASTA
DNA Sequence formats
DNA Sequence formats [Plain] [EMBL] [FASTA] [GCG] [GenBank] [IG] [IUPAC] [How Genomatix represents sequence annotation] Plain sequence format A sequence in plain format may contain only IUPAC characters
Biological Databases and Protein Sequence Analysis
Biological Databases and Protein Sequence Analysis Introduction M. Madan Babu, Center for Biotechnology, Anna University, Chennai 25, India Bioinformatics is the application of Information technology to
Pipe Cleaner Proteins. Essential question: How does the structure of proteins relate to their function in the cell?
Pipe Cleaner Proteins GPS: SB1 Students will analyze the nature of the relationships between structures and functions in living cells. Essential question: How does the structure of proteins relate to their
Library page. SRS first view. Different types of database in SRS. Standard query form
SRS & Entrez SRS Sequence Retrieval System Bengt Persson Whatis SRS? Sequence Retrieval System User-friendly interface to databases http://srs.ebi.ac.uk Developed by Thure Etzold and co-workers EMBL/EBI
Bioinformatics Grid - Enabled Tools For Biologists.
Bioinformatics Grid - Enabled Tools For Biologists. What is Grid-Enabled Tools (GET)? As number of data from the genomics and proteomics experiment increases. Problems arise for the current sequence analysis
Integration of data management and analysis for genome research
Integration of data management and analysis for genome research Volker Brendel Deparment of Zoology & Genetics and Department of Statistics Iowa State University 2112 Molecular Biology Building Ames, Iowa
BIO 3350: ELEMENTS OF BIOINFORMATICS PARTIALLY ONLINE SYLLABUS
BIO 3350: ELEMENTS OF BIOINFORMATICS PARTIALLY ONLINE SYLLABUS NEW YORK CITY COLLEGE OF TECHNOLOGY The City University Of New York School of Arts and Sciences Biological Sciences Department Course title:
BOC334 (Proteomics) Practical 1. Calculating the charge of proteins
BC334 (Proteomics) Practical 1 Calculating the charge of proteins Aliphatic amino acids (VAGLIP) N H 2 H Glycine, Gly, G no charge Hydrophobicity = 0.67 MW 57Da pk a CH = 2.35 pk a NH 2 = 9.6 pi=5.97 CH
BIOINFORMATICS TUTORIAL
Bio 242 BIOINFORMATICS TUTORIAL Bio 242 α Amylase Lab Sequence Sequence Searches: BLAST Sequence Alignment: Clustal Omega 3d Structure & 3d Alignments DO NOT REMOVE FROM LAB. DO NOT WRITE IN THIS DOCUMENT.
SICKLE CELL ANEMIA & THE HEMOGLOBIN GENE TEACHER S GUIDE
AP Biology Date SICKLE CELL ANEMIA & THE HEMOGLOBIN GENE TEACHER S GUIDE LEARNING OBJECTIVES Students will gain an appreciation of the physical effects of sickle cell anemia, its prevalence in the population,
Similarity Searches on Sequence Databases: BLAST, FASTA. Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Basel, October 2003
Similarity Searches on Sequence Databases: BLAST, FASTA Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Basel, October 2003 Outline Importance of Similarity Heuristic Sequence Alignment:
Lecture Outline. Introduction to Databases. Introduction. Data Formats Sample databases How to text search databases. Shifra Ben-Dor Irit Orr
Introduction to Databases Shifra Ben-Dor Irit Orr Lecture Outline Introduction Data and Database types Database components Data Formats Sample databases How to text search databases What units of information
A Multiple DNA Sequence Translation Tool Incorporating Web Robot and Intelligent Recommendation Techniques
Proceedings of the 2007 WSEAS International Conference on Computer Engineering and Applications, Gold Coast, Australia, January 17-19, 2007 402 A Multiple DNA Sequence Translation Tool Incorporating Web
GenBank: A Database of Genetic Sequence Data
GenBank: A Database of Genetic Sequence Data Computer Science 105 Boston University David G. Sullivan, Ph.D. An Explosion of Scientific Data Scientists are generating ever increasing amounts of data. Relevant
Genomes and SNPs in Malaria and Sickle Cell Anemia
Genomes and SNPs in Malaria and Sickle Cell Anemia Introduction to Genome Browsing with Ensembl Ensembl The vast amount of information in biological databases today demands a way of organising and accessing
SUBMITTING DNA SEQUENCES TO THE DATABASES
Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Second Edition Andreas D. Baxevanis, B.F. Francis Ouellette Copyright 2001 John Wiley & Sons, Inc. ISBNs: 0-471-38390-2 (Hardback);
Molecular Databases and Tools
NWeHealth, The University of Manchester Molecular Databases and Tools Afternoon Session: NCBI/EBI resources, pairwise alignment, BLAST, multiple sequence alignment and primer finding. Dr. Georgina Moulton
SeqScape Software Version 2.5 Comprehensive Analysis Solution for Resequencing Applications
Product Bulletin Sequencing Software SeqScape Software Version 2.5 Comprehensive Analysis Solution for Resequencing Applications Comprehensive reference sequence handling Helps interpret the role of each
PRACTICE TEST QUESTIONS
PART A: MULTIPLE CHOICE QUESTIONS PRACTICE TEST QUESTIONS DNA & PROTEIN SYNTHESIS B 1. One of the functions of DNA is to A. secrete vacuoles. B. make copies of itself. C. join amino acids to each other.
A Tutorial in Genetic Sequence Classification Tools and Techniques
A Tutorial in Genetic Sequence Classification Tools and Techniques Jake Drew Data Mining CSE 8331 Southern Methodist University [email protected] www.jakemdrew.com Sequence Characters IUPAC nucleotide
Version 5.0 Release Notes
Version 5.0 Release Notes 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) +1.734.769.7249 (elsewhere) +1.734.769.7074 (fax) www.genecodes.com
Clone Manager. Getting Started
Clone Manager for Windows Professional Edition Volume 2 Alignment, Primer Operations Version 9.5 Getting Started Copyright 1994-2015 Scientific & Educational Software. All rights reserved. The software
Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011
Sequence Formats and Sequence Database Searches Gloria Rendon SC11 Education June, 2011 Sequence A is the primary structure of a biological molecule. It is a chain of residues that form a precise linear
A Primer of Genome Science THIRD
A Primer of Genome Science THIRD EDITION GREG GIBSON-SPENCER V. MUSE North Carolina State University Sinauer Associates, Inc. Publishers Sunderland, Massachusetts USA Contents Preface xi 1 Genome Projects:
RNA and Protein Synthesis
Name lass Date RN and Protein Synthesis Information and Heredity Q: How does information fl ow from DN to RN to direct the synthesis of proteins? 13.1 What is RN? WHT I KNOW SMPLE NSWER: RN is a nucleic
Tutorial. Reference Genome Tracks. Sample to Insight. November 27, 2015
Reference Genome Tracks November 27, 2015 Sample to Insight CLC bio, a QIAGEN Company Silkeborgvej 2 Prismet 8000 Aarhus C Denmark Telephone: +45 70 22 32 44 www.clcbio.com [email protected] Reference
Human Tubal Fluid (HTF) Media & Modifi ed Human Tubal Fluid (mhtf) Medium with Gentamicin
Human Tubal Fluid (HTF) Media & Modifi ed Human Tubal Fluid (mhtf) Medium with Gentamicin HTF Media are intended for use in assisted reproductive procedures which include gamete and embryo manipulation
Bioinformatics Tools Tutorial Project Gene ID: KRas
Bioinformatics Tools Tutorial Project Gene ID: KRas Bednarski 2011 Original project funded by HHMI Bioinformatics Projects Introduction and Tutorial Purpose of this tutorial Illustrate the link between
Linear Sequence Analysis. 3-D Structure Analysis
Linear Sequence Analysis What can you learn from a (single) protein sequence? Calculate it s physical properties Molecular weight (MW), isoelectric point (pi), amino acid content, hydropathy (hydrophilic
Focusing on results not data comprehensive data analysis for targeted next generation sequencing
Focusing on results not data comprehensive data analysis for targeted next generation sequencing Daniel Swan, Jolyon Holdstock, Angela Matchan, Richard Stark, John Shovelton, Duarte Mohla and Simon Hughes
Integrating Bioinformatics, Medical Sciences and Drug Discovery
Integrating Bioinformatics, Medical Sciences and Drug Discovery M. Madan Babu Centre for Biotechnology, Anna University, Chennai - 600025 phone: 44-4332179 :: email: [email protected] Bioinformatics
Introduction to Genome Annotation
Introduction to Genome Annotation AGCGTGGTAGCGCGAGTTTGCGAGCTAGCTAGGCTCCGGATGCGA CCAGCTTTGATAGATGAATATAGTGTGCGCGACTAGCTGTGTGTT GAATATATAGTGTGTCTCTCGATATGTAGTCTGGATCTAGTGTTG GTGTAGATGGAGATCGCGTAGCGTGGTAGCGCGAGTTTGCGAGCT
Shu-Ping Lin, Ph.D. E-mail: [email protected]
Amino Acids & Proteins Shu-Ping Lin, Ph.D. Institute te of Biomedical Engineering ing E-mail: [email protected] Website: http://web.nchu.edu.tw/pweb/users/splin/ edu tw/pweb/users/splin/ Date: 10.13.2010
org.rn.eg.db December 16, 2015 org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank accession numbers.
org.rn.eg.db December 16, 2015 org.rn.egaccnum Map Entrez Gene identifiers to GenBank Accession Numbers org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank
DNA Sequencing Overview
DNA Sequencing Overview DNA sequencing involves the determination of the sequence of nucleotides in a sample of DNA. It is presently conducted using a modified PCR reaction where both normal and labeled
Advanced Medicinal & Pharmaceutical Chemistry CHEM 5412 Dept. of Chemistry, TAMUK
Advanced Medicinal & Pharmaceutical Chemistry CHEM 5412 Dept. of Chemistry, TAMUK Dai Lu, Ph.D. [email protected] Tel: 361-221-0745 Office: RCOP, Room 307 Drug Discovery and Development Drug Molecules Medicinal
Protein & DNA Sequence Analysis. Bobbie-Jo Webb-Robertson May 3, 2004
Protein & DNA Sequence Analysis Bobbie-Jo Webb-Robertson May 3, 2004 Sequence Analysis Anything connected to identifying higher biological meaning out of raw sequence data. 2 Genomic & Proteomic Data Sequence
Note: This document wh_informatics_practical.doc and supporting materials can be downloaded at
Woods Hole Zebrafish Genetics and Development Bioinformatics/Genomics Lab Ian Woods Note: This document wh_informatics_practical.doc and supporting materials can be downloaded at http://faculty.ithaca.edu/iwoods/docs/wh/
Molecular Facts and Figures
Nucleic Acids Molecular Facts and Figures DNA/RNA bases: DNA and RNA are composed of four bases each. In DNA the four are Adenine (A), Thymidine (T), Cytosine (C), and Guanine (G). In RNA the four are
IV. -Amino Acids: carboxyl and amino groups bonded to -Carbon. V. Polypeptides and Proteins
IV. -Amino Acids: carboxyl and amino groups bonded to -Carbon A. Acid/Base properties 1. carboxyl group is proton donor! weak acid 2. amino group is proton acceptor! weak base 3. At physiological ph: H
AS4.1 190509 Replaces 260806 Page 1 of 50 ATF. Software for. DNA Sequencing. Operators Manual. Assign-ATF is intended for Research Use Only (RUO):
Replaces 260806 Page 1 of 50 ATF Software for DNA Sequencing Operators Manual Replaces 260806 Page 2 of 50 1 About ATF...5 1.1 Compatibility...5 1.1.1 Computer Operator Systems...5 1.1.2 DNA Sequencing
SAP HANA Enabling Genome Analysis
SAP HANA Enabling Genome Analysis Joanna L. Kelley, PhD Postdoctoral Scholar, Stanford University Enakshi Singh, MSc HANA Product Management, SAP Labs LLC Outline Use cases Genomics review Challenges in
Guidelines for Writing a Scientific Paper
Guidelines for Writing a Scientific Paper Writing an effective scientific paper is not easy. A good rule of thumb is to write as if your paper will be read by a person who knows about the field in general
H H N - C - C 2 R. Three possible forms (not counting R group) depending on ph
Amino acids - 0 common amino acids there are others found naturally but much less frequently - Common structure for amino acid - C, -N, and functional groups all attached to the alpha carbon N - C - C
T cell Epitope Prediction
Institute for Immunology and Informatics T cell Epitope Prediction EpiMatrix Eric Gustafson January 6, 2011 Overview Gathering raw data Popular sources Data Management Conservation Analysis Multiple Alignments
Core Bioinformatics. Degree Type Year Semester. 4313473 Bioinformàtica/Bioinformatics OB 0 1
Core Bioinformatics 2014/2015 Code: 42397 ECTS Credits: 12 Degree Type Year Semester 4313473 Bioinformàtica/Bioinformatics OB 0 1 Contact Name: Sònia Casillas Viladerrams Email: [email protected]
Custom TaqMan Assays For New SNP Genotyping and Gene Expression Assays. Design and Ordering Guide
Custom TaqMan Assays For New SNP Genotyping and Gene Expression Assays Design and Ordering Guide For Research Use Only. Not intended for any animal or human therapeutic or diagnostic use. Information in
Amino Acids and Proteins
Amino Acids and Proteins Proteins are composed of amino acids. There are 20 amino acids commonly found in proteins. All have: N2 C α R COO Amino acids at neutral p are dipolar ions (zwitterions) because
Sequencing the Human Genome
Revised and Updated Edvo-Kit #339 Sequencing the Human Genome 339 Experiment Objective: In this experiment, students will read DNA sequences obtained from automated DNA sequencing techniques. The data
Becker Muscular Dystrophy
Muscular Dystrophy A Case Study of Positional Cloning Described by Benjamin Duchenne (1868) X-linked recessive disease causing severe muscular degeneration. 100 % penetrance X d Y affected male Frequency
From DNA to Protein. Proteins. Chapter 13. Prokaryotes and Eukaryotes. The Path From Genes to Proteins. All proteins consist of polypeptide chains
Proteins From DNA to Protein Chapter 13 All proteins consist of polypeptide chains A linear sequence of amino acids Each chain corresponds to the nucleotide base sequence of a gene The Path From Genes
Multiple Choice Write the letter that best answers the question or completes the statement on the line provided.
Name lass Date hapter 12 DN and RN hapter Test Multiple hoice Write the letter that best answers the question or completes the statement on the line provided. Pearson Education, Inc. ll rights reserved.
INTERNATIONAL CONFERENCE ON HARMONISATION OF TECHNICAL REQUIREMENTS FOR REGISTRATION OF PHARMACEUTICALS FOR HUMAN USE Q5B
INTERNATIONAL CONFERENCE ON HARMONISATION OF TECHNICAL REQUIREMENTS FOR REGISTRATION OF PHARMACEUTICALS FOR HUMAN USE ICH HARMONISED TRIPARTITE GUIDELINE QUALITY OF BIOTECHNOLOGICAL PRODUCTS: ANALYSIS
13.2 Ribosomes & Protein Synthesis
13.2 Ribosomes & Protein Synthesis Introduction: *A specific sequence of bases in DNA carries the directions for forming a polypeptide, a chain of amino acids (there are 20 different types of amino acid).
Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance?
Optimization 1 Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance? Where to begin? 2 Sequence Databases Swiss-prot MSDB, NCBI nr dbest Species specific ORFS
Bioinformatics: course introduction
Bioinformatics: course introduction Filip Železný Czech Technical University in Prague Faculty of Electrical Engineering Department of Cybernetics Intelligent Data Analysis lab http://ida.felk.cvut.cz
SOP 3 v2: web-based selection of oligonucleotide primer trios for genotyping of human and mouse polymorphisms
W548 W552 Nucleic Acids Research, 2005, Vol. 33, Web Server issue doi:10.1093/nar/gki483 SOP 3 v2: web-based selection of oligonucleotide primer trios for genotyping of human and mouse polymorphisms Steven
Gene Models & Bed format: What they represent.
GeneModels&Bedformat:Whattheyrepresent. Gene models are hypotheses about the structure of transcripts produced by a gene. Like all models, they may be correct, partly correct, or entirely wrong. Typically,
Replacing TaqMan SNP Genotyping Assays that Fail Applied Biosystems Manufacturing Quality Control. Begin
User Bulletin TaqMan SNP Genotyping Assays May 2008 SUBJECT: Replacing TaqMan SNP Genotyping Assays that Fail Applied Biosystems Manufacturing Quality Control In This Bulletin Overview This user bulletin
Ms. Campbell Protein Synthesis Practice Questions Regents L.E.
Name Student # Ms. Campbell Protein Synthesis Practice Questions Regents L.E. 1. A sequence of three nitrogenous bases in a messenger-rna molecule is known as a 1) codon 2) gene 3) polypeptide 4) nucleotide
Biochemistry - I. Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology, Kharagpur Lecture-11 Enzyme Mechanisms II
Biochemistry - I Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology, Kharagpur Lecture-11 Enzyme Mechanisms II In the last class we studied the enzyme mechanisms of ribonuclease A
Guide for Bioinformatics Project Module 3
Structure- Based Evidence and Multiple Sequence Alignment In this module we will revisit some topics we started to look at while performing our BLAST search and looking at the CDD database in the first
Pairwise Sequence Alignment
Pairwise Sequence Alignment [email protected] SS 2013 Outline Pairwise sequence alignment global - Needleman Wunsch Gotoh algorithm local - Smith Waterman algorithm BLAST - heuristics What
Sharing Data from Large-scale Biological Research Projects: A System of Tripartite Responsibility
Sharing Data from Large-scale Biological Research Projects: A System of Tripartite Responsibility Report of a meeting organized by the Wellcome Trust and held on 14 15 January 2003 at Fort Lauderdale,
Global and Discovery Proteomics Lecture Agenda
Global and Discovery Proteomics Christine A. Jelinek, Ph.D. Johns Hopkins University School of Medicine Department of Pharmacology and Molecular Sciences Middle Atlantic Mass Spectrometry Laboratory Global
PROC. CAIRO INTERNATIONAL BIOMEDICAL ENGINEERING CONFERENCE 2006 1. E-mail: [email protected]
BIOINFTool: Bioinformatics and sequence data analysis in molecular biology using Matlab Mai S. Mabrouk 1, Marwa Hamdy 2, Marwa Mamdouh 2, Marwa Aboelfotoh 2,Yasser M. Kadah 2 1 Biomedical Engineering Department,
CD-HIT User s Guide. Last updated: April 5, 2010. http://cd-hit.org http://bioinformatics.org/cd-hit/
CD-HIT User s Guide Last updated: April 5, 2010 http://cd-hit.org http://bioinformatics.org/cd-hit/ Program developed by Weizhong Li s lab at UCSD http://weizhong-lab.ucsd.edu [email protected] 1. Introduction
Bio-Informatics Lectures. A Short Introduction
Bio-Informatics Lectures A Short Introduction The History of Bioinformatics Sanger Sequencing PCR in presence of fluorescent, chain-terminating dideoxynucleotides Massively Parallel Sequencing Massively
The Human Genome Project
The Human Genome Project Brief History of the Human Genome Project Physical Chromosome Maps Genetic (or Linkage) Maps DNA Markers Sequencing and Annotating Genomic DNA What Have We learned from the HGP?
Translation Study Guide
Translation Study Guide This study guide is a written version of the material you have seen presented in the replication unit. In translation, the cell uses the genetic information contained in mrna to
THE GENBANK SEQUENCE DATABASE
Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Second Edition Andreas D. Baxevanis, B.F. Francis Ouellette Copyright 2001 John Wiley & Sons, Inc. ISBNs: 0-471-38390-2 (Hardback);
