Lecture 2, Introduction to Python. Python Programming Language
|
|
|
- Solomon Hoover
- 10 years ago
- Views:
Transcription
1 BINF 3360, Introduction to Computational Biology Lecture 2, Introduction to Python Young-Rae Cho Associate Professor Department of Computer Science Baylor University Python Programming Language Script Language General-purpose script language Broad applications (web, bioinformatics, network programming, graphics, software engineering) Features Object-oriented Extension with modules Database integration Embeddable Web frameworks / Web modules 1
2 Getting Started Download & Installation (the most recent version: Python 3.3) Edit & Run Create a file named test.py Edit the code # This is a test. dna = ATCGATGA print dna, \n Run the code > python test.py Primitives Primitive Data Types Numbers or Strings num = 1234 st = 1234 num_1 = num + int(st) st_1 = str(num) + st Substring dna1 = ACGTGAACT dna2 = dna1[0:4] length = len(dna2) Reversing dna1 = ACGTGAACT dna2 = dna1[::-1] 2
3 Lists List Variables A list of comma-separated values lst1 = [ A, C, G ] lst2 = [ T ] lst1 = lst1 + lst2 Variable-length list Insert, Delete, Append, Reverse, and Sort lst = [ A, T, G ] lst.insert(1, C ) del lst[2] lst.append( T ) lst.extend([ A, C ]) lst.reverse() lst.sort() lst = [ A, T, G ] lst [1:2] = C lst [1:1] = T lst [2:3] = lst [len(lst) : len(lst)] = T lst [len(lst) : len(lst)] = [ A, C ] lst [::-1] Sets Set Variables DNAbases = { A, C, G, T } RNAbases = { A, C, G, U } DNAbases RNAbases DNAbases & RNAbases DNAbases - RNAbases Add and Remove bases = { A, D, G } bases.add( T ) bases.remove( D ) 3
4 Dictionaries Initialization d = { key1 : value1, key2 : value2, key3 : value3 } d = dict() d[ key1 ] = value1 k2, v2 = key2, value2 d[k2] = v2 Mapping d[ key1 ] d.get( key1 ) d.keys() d.values() Delete del d[ key1 ] Input / Output Standard Input import sys data = sys.stdin.readline().replace( \n, ) Reading Files name = myfilename.txt with open(name) as file: data = file.read() name = sys.stdin.readline() with open(name) as file: data = file.read() name = sys.argv[1] with open(name) as file: data = file.read() Writing Files name = output.txt with open(name, w ) as file: file.write( ATCGATG ) 4
5 Functions Types Built-in system functions User-defined functions Defining Function def function_name (parameter_list): statement statement return value Function Call Iteration Iterative Process def find_max(lst): max_so_far = lst[0] for item in lst[1:]: if item > max_so_far: max_so_far = item return max_so_far lst1 = [3,5,10,4,6] maximum = find_max(lst1) 5
6 Recursion Recursive Call def print_tree(tree, level): print * 4 * level, tree[0] for subtree in tree[1:]: print_tree(subtree, level+1) t1 = [ A, [ T, [ A ], [ T ]], [ G, [ G ], [ C ]]] print_tree(t1, 0) Modules Module A collection of functions Module python (.py) files in a library directory Module Call import random seq = 'ATCGATAGCTA' random_base = seq[random.randint(0,len(seq)-1)] from random import * seq = 'ATCGATAGCTA' random_base = seq[randint(0,len(seq)-1)] 6
7 Regular Expressions Special Languages Metacharacters Quantifiers Alternatives Character Set Same to the regular expressions in Perl Usage import re if re.match( TATA.* AA, seq): print It matched! import re matches = re.findall( TATA.* AA, seq) print matches Biological Applications Parsing Sequences Base Frequency Counting Motif (Substring) Search Sequence Transformation DNA Replication Transcription from DNA to RNA Translating RNA into Protein DNA Sequence Mutation 7
8 Parsing Sequences (1) Single Sequence in FASTA Format >gi gb AAD cytochrome b LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIP YIGTNLVEWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDK IPFHPYYTIKDFLGLLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRS VPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYP YTIIGQMASILYFSIILAFLPIAGXIENY Parsing Make a function to return the sequence from the FASTA format def read_fasta_seq(filename): with open(filename) as f: return f.read().partition( \n )[2].replace( \n, ) Parsing Sequences (2) Multiple Sequences in FASTA Format >SEQUENCE_1 MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHKIP QFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTLMGQFY VMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL >SEQUENCE_2 SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQIATIGE NLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH Parsing? 8
9 Frequency Counting DNA Sequence Validation def validate_dna (base_sequence): seq = base_sequence.upper() return len(seq) == (seq.count( T ) + seq.count( C ) + seq.count( A ) + seq.count( G ) ) def validate_dna (base_sequence): seq = base_sequence.upper() for base in seq: if base not in ACGT : return False return True Counting Base Frquency Make a function to calculate the percent of C and G in a DNA sequence def percent_of_gc (base_sequence): seq = base_sequence.upper() return (seq.count( G ) + seq.count( C )) / len(seq) Motif Search Searching Substring Make a function to take a sequence and a motif and return the position(s) of matching in the sequence def motif_search (seq, motif): return seq.find(motif) def all_motif_search (seq, motif): pos = [] idx = seq.find(motif) pos.append(idx) seq = seq.partition(motif)[2] while seq.find(motif) >= 0: idx += seq.find(motif) + len(motif) pos.append(idx) seq = seq.partition(motif)[2] return pos 9
10 Transcription Simulating Transcription Make a function to transcribe a DNA into an RNA def transcription (dna): return dna.replace( T, U ) Translation (1) Making Genetic Code Make a function to translate a codon to an amino acid def codon2aa(codon): genetic_code = { UUU : F, UUC : F, UUA : L, } if codon in genetic_code.keys(): return genetic_code[codon] else: return Error 10
11 Translation (2) Simulating Translation Make a function to translate an RNA into a protein sequence def translation(rna): protein = for n in range(0, len(rna), 3): protein += codon2aa(rna[n:n+3]) return protein Translation (3) Simulating Translation cont Make a generator - an object that returns values from a series it computes def aa_generator(rna): return (codon2aa(rna[n:n+3]) for n in range(0, len(rna), 3) ) def translation(rna): gen = aa_generator(rna) protein = aa = next(gen) while aa: protein += aa aa = next(gen) return protein 11
12 Mutation Simulating Mutation Make a function to simulate single point mutations in a DNA sequence import random def mutation(dna): position = random.randint(0,len(dna)-1) bases = ACGT new_base = bases[random.randint(0,3)] dna[position:position+1] = new_base return dna bases.replace(dna[position], ) new_base = bases[random.randint(0,2)] Questions? Lecture Slides are found on the Course Website, web.ecs.baylor.edu/faculty/cho/
Bioinformatics Resources at a Glance
Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences
The sequence of bases on the mrna is a code that determines the sequence of amino acids in the polypeptide being synthesized:
Module 3F Protein Synthesis So far in this unit, we have examined: How genes are transmitted from one generation to the next Where genes are located What genes are made of How genes are replicated How
Biological Sequence Data Formats
Biological Sequence Data Formats Here we present three standard formats in which biological sequence data (DNA, RNA and protein) can be stored and presented. Raw Sequence: Data without description. FASTA
(http://genomes.urv.es/caical) TUTORIAL. (July 2006)
(http://genomes.urv.es/caical) TUTORIAL (July 2006) CAIcal manual 2 Table of contents Introduction... 3 Required inputs... 5 SECTION A Calculation of parameters... 8 SECTION B CAI calculation for FASTA
Name Class Date. Figure 13 1. 2. Which nucleotide in Figure 13 1 indicates the nucleic acid above is RNA? a. uracil c. cytosine b. guanine d.
13 Multiple Choice RNA and Protein Synthesis Chapter Test A Write the letter that best answers the question or completes the statement on the line provided. 1. Which of the following are found in both
From DNA to Protein. Proteins. Chapter 13. Prokaryotes and Eukaryotes. The Path From Genes to Proteins. All proteins consist of polypeptide chains
Proteins From DNA to Protein Chapter 13 All proteins consist of polypeptide chains A linear sequence of amino acids Each chain corresponds to the nucleotide base sequence of a gene The Path From Genes
GenBank, Entrez, & FASTA
GenBank, Entrez, & FASTA Nucleotide Sequence Databases First generation GenBank is a representative example started as sort of a museum to preserve knowledge of a sequence from first discovery great repositories,
Bioinformatics Grid - Enabled Tools For Biologists.
Bioinformatics Grid - Enabled Tools For Biologists. What is Grid-Enabled Tools (GET)? As number of data from the genomics and proteomics experiment increases. Problems arise for the current sequence analysis
a. Ribosomal RNA rrna a type ofrna that combines with proteins to form Ribosomes on which polypeptide chains of proteins are assembled
Biology 101 Chapter 14 Name: Fill-in-the-Blanks Which base follows the next in a strand of DNA is referred to. as the base (1) Sequence. The region of DNA that calls for the assembly of specific amino
Module 10: Bioinformatics
Module 10: Bioinformatics 1.) Goal: To understand the general approaches for basic in silico (computer) analysis of DNA- and protein sequences. We are going to discuss sequence formatting required prior
Sorting. Lists have a sort method Strings are sorted alphabetically, except... Uppercase is sorted before lowercase (yes, strange)
Sorting and Modules Sorting Lists have a sort method Strings are sorted alphabetically, except... L1 = ["this", "is", "a", "list", "of", "words"] print L1 ['this', 'is', 'a', 'list', 'of', 'words'] L1.sort()
Hidden Markov Models in Bioinformatics. By Máthé Zoltán Kőrösi Zoltán 2006
Hidden Markov Models in Bioinformatics By Máthé Zoltán Kőrösi Zoltán 2006 Outline Markov Chain HMM (Hidden Markov Model) Hidden Markov Models in Bioinformatics Gene Finding Gene Finding Model Viterbi algorithm
Introduction to Programming with Python. A Useful Reference. http://www.pasteur.fr/formation/infobio/python/
Introduction to Programming with Python A Useful Reference http://www.pasteur.fr/formation/infobio/python/ 1 What is Computer Programming? An algorithm is a series of steps for solving a problem A programming
Programming Exercises
s CMPS 5P (Professor Theresa Migler-VonDollen ): Assignment #8 Problem 6 Problem 1 Programming Exercises Modify the recursive Fibonacci program given in the chapter so that it prints tracing information.
Translation Study Guide
Translation Study Guide This study guide is a written version of the material you have seen presented in the replication unit. In translation, the cell uses the genetic information contained in mrna to
Bob Jesberg. Boston, MA April 3, 2014
DNA, Replication and Transcription Bob Jesberg NSTA Conference Boston, MA April 3, 2014 1 Workshop Agenda Looking at DNA and Forensics The DNA, Replication i and Transcription i Set DNA Ladder The Double
Gene Finding CMSC 423
Gene Finding CMSC 423 Finding Signals in DNA We just have a long string of A, C, G, Ts. How can we find the signals encoded in it? Suppose you encountered a language you didn t know. How would you decipher
Protein Synthesis How Genes Become Constituent Molecules
Protein Synthesis Protein Synthesis How Genes Become Constituent Molecules Mendel and The Idea of Gene What is a Chromosome? A chromosome is a molecule of DNA 50% 50% 1. True 2. False True False Protein
DNA Sequence Analysis Software
DNA Sequence Analysis Software Group: Xin Xiong, Yuan Zhang, HongboLiu Supervisor: Henrik Bulskov Table of contents Introduction...2 1 Backgrounds and Motivation...2 1.1 Molecular Biology...2 1.2 Computer
Pairwise Sequence Alignment
Pairwise Sequence Alignment [email protected] SS 2013 Outline Pairwise sequence alignment global - Needleman Wunsch Gotoh algorithm local - Smith Waterman algorithm BLAST - heuristics What
Lecture 4: Exact string searching algorithms. Exact string search algorithms. Definitions. Exact string searching or matching
COSC 348: Computing for Bioinformatics Definitions A pattern (keyword) is an ordered sequence of symbols. Lecture 4: Exact string searching algorithms Lubica Benuskova http://www.cs.otago.ac.nz/cosc348/
Apply PERL to BioInformatics (II)
Apply PERL to BioInformatics (II) Lecture Note for Computational Biology 1 (LSM 5191) Jiren Wang http://www.bii.a-star.edu.sg/~jiren BioInformatics Institute Singapore Outline Some examples for manipulating
Gene and Chromosome Mutation Worksheet (reference pgs. 239-240 in Modern Biology textbook)
Name Date Per Look at the diagrams, then answer the questions. Gene Mutations affect a single gene by changing its base sequence, resulting in an incorrect, or nonfunctional, protein being made. (a) A
Algorithms in Computational Biology (236522) spring 2007 Lecture #1
Algorithms in Computational Biology (236522) spring 2007 Lecture #1 Lecturer: Shlomo Moran, Taub 639, tel 4363 Office hours: Tuesday 11:00-12:00/by appointment TA: Ilan Gronau, Taub 700, tel 4894 Office
Protein & DNA Sequence Analysis. Bobbie-Jo Webb-Robertson May 3, 2004
Protein & DNA Sequence Analysis Bobbie-Jo Webb-Robertson May 3, 2004 Sequence Analysis Anything connected to identifying higher biological meaning out of raw sequence data. 2 Genomic & Proteomic Data Sequence
Thomas Jefferson High School for Science and Technology Program of Studies Foundations of Computer Science. Unit of Study / Textbook Correlation
Thomas Jefferson High School for Science and Technology Program of Studies Foundations of Computer Science updated 03/08/2012 Unit 1: JKarel 8 weeks http://www.fcps.edu/is/pos/documents/hs/compsci.htm
CD-HIT User s Guide. Last updated: April 5, 2010. http://cd-hit.org http://bioinformatics.org/cd-hit/
CD-HIT User s Guide Last updated: April 5, 2010 http://cd-hit.org http://bioinformatics.org/cd-hit/ Program developed by Weizhong Li s lab at UCSD http://weizhong-lab.ucsd.edu [email protected] 1. Introduction
The Steps. 1. Transcription. 2. Transferal. 3. Translation
Protein Synthesis Protein synthesis is simply the "making of proteins." Although the term itself is easy to understand, the multiple steps that a cell in a plant or animal must go through are not. In order
ML for the Working Programmer
ML for the Working Programmer 2nd edition Lawrence C. Paulson University of Cambridge CAMBRIDGE UNIVERSITY PRESS CONTENTS Preface to the Second Edition Preface xiii xv 1 Standard ML 1 Functional Programming
Genetic programming with regular expressions
Genetic programming with regular expressions Børge Svingen Chief Technology Officer, Open AdExchange [email protected] 2009-03-23 Pattern discovery Pattern discovery: Recognizing patterns that characterize
Hands on Simulation of Mutation
Hands on Simulation of Mutation Charlotte K. Omoto P.O. Box 644236 Washington State University Pullman, WA 99164-4236 [email protected] ABSTRACT This exercise is a hands-on simulation of mutations and their
AP BIOLOGY 2009 SCORING GUIDELINES
AP BIOLOGY 2009 SCORING GUIDELINES Question 4 The flow of genetic information from DNA to protein in eukaryotic cells is called the central dogma of biology. (a) Explain the role of each of the following
RNA & Protein Synthesis
RNA & Protein Synthesis Genes send messages to cellular machinery RNA Plays a major role in process Process has three phases (Genetic) Transcription (Genetic) Translation Protein Synthesis RNA Synthesis
Exercise 1: Python Language Basics
Exercise 1: Python Language Basics In this exercise we will cover the basic principles of the Python language. All languages have a standard set of functionality including the ability to comment code,
Some programming experience in a high-level structured programming language is recommended.
Python Programming Course Description This course is an introduction to the Python programming language. Programming techniques covered by this course include modularity, abstraction, top-down design,
Certified PHP Developer VS-1054
Certified PHP Developer VS-1054 Certification Code VS-1054 Certified PHP Developer Vskills certification for PHP Developers assesses the candidate for developing PHP based applications. The certification
Chapter 3 Writing Simple Programs. What Is Programming? Internet. Witin the web server we set lots and lots of requests which we need to respond to
Chapter 3 Writing Simple Programs Charles Severance Unless otherwise noted, the content of this course material is licensed under a Creative Commons Attribution 3.0 License. http://creativecommons.org/licenses/by/3.0/.
A Web Based Software for Synonymous Codon Usage Indices
International Journal of Information and Computation Technology. ISSN 0974-2239 Volume 3, Number 3 (2013), pp. 147-152 International Research Publications House http://www. irphouse.com /ijict.htm A Web
LabGenius. Technical design notes. The world s most advanced synthetic DNA libraries. [email protected] V1.5 NOV 15
LabGenius The world s most advanced synthetic DNA libraries Technical design notes [email protected] V1.5 NOV 15 Introduction OUR APPROACH LabGenius is a gene synthesis company focussed on the design and manufacture
AP BIOLOGY 2010 SCORING GUIDELINES (Form B)
AP BIOLOGY 2010 SCORING GUIDELINES (Form B) Question 2 Certain human genetic conditions, such as sickle cell anemia, result from single base-pair mutations in DNA. (a) Explain how a single base-pair mutation
CS 1133, LAB 2: FUNCTIONS AND TESTING http://www.cs.cornell.edu/courses/cs1133/2015fa/labs/lab02.pdf
CS 1133, LAB 2: FUNCTIONS AND TESTING http://www.cs.cornell.edu/courses/cs1133/2015fa/labs/lab02.pdf First Name: Last Name: NetID: The purpose of this lab is to help you to better understand functions:
SMock A Test Platform for the Evaluation of Monitoring Tools
SMock A Test Platform for the Evaluation of Monitoring Tools User Manual Ruth Mizzi Faculty of ICT University of Malta June 20, 2013 Contents 1 Introduction 3 1.1 The Architecture and Design of SMock................
A Multiple DNA Sequence Translation Tool Incorporating Web Robot and Intelligent Recommendation Techniques
Proceedings of the 2007 WSEAS International Conference on Computer Engineering and Applications, Gold Coast, Australia, January 17-19, 2007 402 A Multiple DNA Sequence Translation Tool Incorporating Web
Bio-Informatics Lectures. A Short Introduction
Bio-Informatics Lectures A Short Introduction The History of Bioinformatics Sanger Sequencing PCR in presence of fluorescent, chain-terminating dideoxynucleotides Massively Parallel Sequencing Massively
Semester Review. CSC 301, Fall 2015
Semester Review CSC 301, Fall 2015 Programming Language Classes There are many different programming language classes, but four classes or paradigms stand out:! Imperative Languages! assignment and iteration!
shodan-python Documentation
shodan-python Documentation Release 1.0 achillean June 24, 2016 Contents 1 Introduction 3 1.1 Getting Started.............................................. 3 2 Examples 5 2.1 Basic Shodan Search...........................................
Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism )
Biology 1406 Exam 3 Notes Structure of DNA Ch. 10 Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism ) Proteins
PRACTICE TEST QUESTIONS
PART A: MULTIPLE CHOICE QUESTIONS PRACTICE TEST QUESTIONS DNA & PROTEIN SYNTHESIS B 1. One of the functions of DNA is to A. secrete vacuoles. B. make copies of itself. C. join amino acids to each other.
Vector NTI Advance 11 Quick Start Guide
Vector NTI Advance 11 Quick Start Guide Catalog no. 12605050, 12605099, 12605103 Version 11.0 December 15, 2008 12605022 Published by: Invitrogen Corporation 5791 Van Allen Way Carlsbad, CA 92008 U.S.A.
Protein Protein Interaction Networks
Functional Pattern Mining from Genome Scale Protein Protein Interaction Networks Young-Rae Cho, Ph.D. Assistant Professor Department of Computer Science Baylor University it My Definition of Bioinformatics
Introduction to Bioinformatics 3. DNA editing and contig assembly
Introduction to Bioinformatics 3. DNA editing and contig assembly Benjamin F. Matthews United States Department of Agriculture Soybean Genomics and Improvement Laboratory Beltsville, MD 20708 [email protected]
Appendix 2 Molecular Biology Core Curriculum. Websites and Other Resources
Appendix 2 Molecular Biology Core Curriculum Websites and Other Resources Chapter 1 - The Molecular Basis of Cancer 1. Inside Cancer http://www.insidecancer.org/ From the Dolan DNA Learning Center Cold
Financial Accounting Tutorial
Financial Accounting Tutorial About the Tutorial Python is a general-purpose interpreted, interactive, object-oriented, and high-level programming language. It was created by Guido van Rossum during 1985-1990.
Gene Models & Bed format: What they represent.
GeneModels&Bedformat:Whattheyrepresent. Gene models are hypotheses about the structure of transcripts produced by a gene. Like all models, they may be correct, partly correct, or entirely wrong. Typically,
TECHNICAL UNIVERSITY OF CRETE DATA STRUCTURES FILE STRUCTURES
TECHNICAL UNIVERSITY OF CRETE DEPT OF ELECTRONIC AND COMPUTER ENGINEERING DATA STRUCTURES AND FILE STRUCTURES Euripides G.M. Petrakis http://www.intelligence.tuc.gr/~petrakis Chania, 2007 E.G.M. Petrakis
Introduction to Shell Scripting
Introduction to Shell Scripting Lecture 1. Shell scripts are small programs. They let you automate multi-step processes, and give you the capability to use decision-making logic and repetitive loops. 2.
Activity 7.21 Transcription factors
Purpose To consolidate understanding of protein synthesis. To explain the role of transcription factors and hormones in switching genes on and off. Play the transcription initiation complex game Regulation
DNA Replication & Protein Synthesis. This isn t a baaaaaaaddd chapter!!!
DNA Replication & Protein Synthesis This isn t a baaaaaaaddd chapter!!! The Discovery of DNA s Structure Watson and Crick s discovery of DNA s structure was based on almost fifty years of research by other
PROC. CAIRO INTERNATIONAL BIOMEDICAL ENGINEERING CONFERENCE 2006 1. E-mail: [email protected]
BIOINFTool: Bioinformatics and sequence data analysis in molecular biology using Matlab Mai S. Mabrouk 1, Marwa Hamdy 2, Marwa Mamdouh 2, Marwa Aboelfotoh 2,Yasser M. Kadah 2 1 Biomedical Engineering Department,
RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison
RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the
Concluding lesson. Student manual. What kind of protein are you? (Basic)
Concluding lesson Student manual What kind of protein are you? (Basic) Part 1 The hereditary material of an organism is stored in a coded way on the DNA. This code consists of four different nucleotides:
Hadoop Streaming. Table of contents
Table of contents 1 Hadoop Streaming...3 2 How Streaming Works... 3 3 Streaming Command Options...4 3.1 Specifying a Java Class as the Mapper/Reducer... 5 3.2 Packaging Files With Job Submissions... 5
Scottish Qualifications Authority
National Unit specification: general information Unit code: FH2G 12 Superclass: RH Publication date: March 2011 Source: Scottish Qualifications Authority Version: 01 Summary This Unit is a mandatory Unit
MORPHEUS. http://biodev.cea.fr/morpheus/ Prediction of Transcription Factors Binding Sites based on Position Weight Matrix.
MORPHEUS http://biodev.cea.fr/morpheus/ Prediction of Transcription Factors Binding Sites based on Position Weight Matrix. Reference: MORPHEUS, a Webtool for Transcripton Factor Binding Analysis Using
TheIMSCorpusWorkbench CorpusAdministrator'sManual InstitutfurmaschinelleSprachverarbeitung UniversitatStuttgart OliverChrist [email protected] {Computerlinguistik{ D70174Stuttgart1 Azenbergstr.12
CellLine, a stochastic cell lineage simulator: Manual
CellLine, a stochastic cell lineage simulator: Manual Andre S. Ribeiro, Daniel A. Charlebois, Jason Lloyd-Price July 23, 2007 1 Introduction This document explains how to work with the CellLine modules
COMPARING DNA SEQUENCES TO DETERMINE EVOLUTIONARY RELATIONSHIPS AMONG MOLLUSKS
COMPARING DNA SEQUENCES TO DETERMINE EVOLUTIONARY RELATIONSHIPS AMONG MOLLUSKS OVERVIEW In the online activity Biodiversity and Evolutionary Trees: An Activity on Biological Classification, you generated
13.4 Gene Regulation and Expression
13.4 Gene Regulation and Expression Lesson Objectives Describe gene regulation in prokaryotes. Explain how most eukaryotic genes are regulated. Relate gene regulation to development in multicellular organisms.
Name Date Period. 2. When a molecule of double-stranded DNA undergoes replication, it results in
DNA, RNA, Protein Synthesis Keystone 1. During the process shown above, the two strands of one DNA molecule are unwound. Then, DNA polymerases add complementary nucleotides to each strand which results
PYTHON Basics http://hetland.org/writing/instant-hacking.html
CWCS Workshop May 2009 PYTHON Basics http://hetland.org/writing/instant-hacking.html Python is an easy to learn, modern, interpreted, object-oriented programming language. It was designed to be as simple
ISTEP+: Biology I End-of-Course Assessment Released Items and Scoring Notes
ISTEP+: Biology I End-of-Course Assessment Released Items and Scoring Notes Page 1 of 22 Introduction Indiana students enrolled in Biology I participated in the ISTEP+: Biology I Graduation Examination
Structure and Function of DNA
Structure and Function of DNA DNA and RNA Structure DNA and RNA are nucleic acids. They consist of chemical units called nucleotides. The nucleotides are joined by a sugar-phosphate backbone. The four
Introduction to: Computers & Programming: Input and Output (IO)
Introduction to: Computers & Programming: Input and Output (IO) Adam Meyers New York University Summary What is Input and Ouput? What kinds of Input and Output have we covered so far? print (to the console)
Visualizing molecular simulations
Visualizing molecular simulations ChE210D Overview Visualization plays a very important role in molecular simulations: it enables us to develop physical intuition about the behavior of a system that is
Library page. SRS first view. Different types of database in SRS. Standard query form
SRS & Entrez SRS Sequence Retrieval System Bengt Persson Whatis SRS? Sequence Retrieval System User-friendly interface to databases http://srs.ebi.ac.uk Developed by Thure Etzold and co-workers EMBL/EBI
Introduction to Python
Introduction to Python Sophia Bethany Coban Problem Solving By Computer March 26, 2014 Introduction to Python Python is a general-purpose, high-level programming language. It offers readable codes, and
Lecture 1 MODULE 3 GENE EXPRESSION AND REGULATION OF GENE EXPRESSION. Professor Bharat Patel Office: Science 2, 2.36 Email: [email protected].
Lecture 1 MODULE 3 GENE EXPRESSION AND REGULATION OF GENE EXPRESSION Professor Bharat Patel Office: Science 2, 2.36 Email: [email protected] What is Gene Expression & Gene Regulation? 1. Gene Expression
CS177 MIDTERM 2 PRACTICE EXAM SOLUTION. Name: Student ID:
CS177 MIDTERM 2 PRACTICE EXAM SOLUTION Name: Student ID: This practice exam is due the day of the midterm 2 exam. The solutions will be posted the day before the exam but we encourage you to look at the
Oracle Database 11g SQL
AO3 - Version: 2 19 June 2016 Oracle Database 11g SQL Oracle Database 11g SQL AO3 - Version: 2 3 days Course Description: This course provides the essential SQL skills that allow developers to write queries
Transcription and Translation of DNA
Transcription and Translation of DNA Genotype our genetic constitution ( makeup) is determined (controlled) by the sequence of bases in its genes Phenotype determined by the proteins synthesised when genes
SeqScape Software Version 2.5 Comprehensive Analysis Solution for Resequencing Applications
Product Bulletin Sequencing Software SeqScape Software Version 2.5 Comprehensive Analysis Solution for Resequencing Applications Comprehensive reference sequence handling Helps interpret the role of each
Focusing on results not data comprehensive data analysis for targeted next generation sequencing
Focusing on results not data comprehensive data analysis for targeted next generation sequencing Daniel Swan, Jolyon Holdstock, Angela Matchan, Richard Stark, John Shovelton, Duarte Mohla and Simon Hughes
Basic Concepts of DNA, Proteins, Genes and Genomes
Basic Concepts of DNA, Proteins, Genes and Genomes Kun-Mao Chao 1,2,3 1 Graduate Institute of Biomedical Electronics and Bioinformatics 2 Department of Computer Science and Information Engineering 3 Graduate
Python for Economists
Python for Economists Alex Bell Alexander [email protected] Originally prepared for staff of the Federal Trade Commission s Bureau of Economics, July 2012. http://xkcd.com/353 Contents 1 Introduction to Python
Curriculum Map. Discipline: Computer Science Course: C++
Curriculum Map Discipline: Computer Science Course: C++ August/September: How can computer programs make problem solving easier and more efficient? In what order does a computer execute the lines of code
Moving from CS 61A Scheme to CS 61B Java
Moving from CS 61A Scheme to CS 61B Java Introduction Java is an object-oriented language. This document describes some of the differences between object-oriented programming in Scheme (which we hope you
Basic attributes of genetic processes (replication, transcription, translation)
411-3 2008 Lecture notes I. First general topic in the course will be mutation (in broadest sense, any change to an organismʼs genetic material). Intimately intertwined with this is the process of DNA
DNA, RNA, Protein synthesis, and Mutations. Chapters 12-13.3
DNA, RNA, Protein synthesis, and Mutations Chapters 12-13.3 1A)Identify the components of DNA and explain its role in heredity. DNA s Role in heredity: Contains the genetic information of a cell that can
Frequently Asked Questions Next Generation Sequencing
Frequently Asked Questions Next Generation Sequencing Import These Frequently Asked Questions for Next Generation Sequencing are some of the more common questions our customers ask. Questions are divided
A Tutorial Introduc/on to Big Data. Hands On Data Analy/cs over EMR. Robert Grossman University of Chicago Open Data Group
A Tutorial Introduc/on to Big Data Hands On Data Analy/cs over EMR Robert Grossman University of Chicago Open Data Group Collin BenneE Open Data Group November 12, 2012 1 Amazon AWS Elas/c MapReduce allows
BioHPC Web Computing Resources at CBSU
BioHPC Web Computing Resources at CBSU 3CPG workshop Robert Bukowski Computational Biology Service Unit http://cbsu.tc.cornell.edu/lab/doc/biohpc_web_tutorial.pdf BioHPC infrastructure at CBSU BioHPC Web
13.2 Ribosomes & Protein Synthesis
13.2 Ribosomes & Protein Synthesis Introduction: *A specific sequence of bases in DNA carries the directions for forming a polypeptide, a chain of amino acids (there are 20 different types of amino acid).
Module 3 Questions. 7. Chemotaxis is an example of signal transduction. Explain, with the use of diagrams.
Module 3 Questions Section 1. Essay and Short Answers. Use diagrams wherever possible 1. With the use of a diagram, provide an overview of the general regulation strategies available to a bacterial cell.
BIO 3350: ELEMENTS OF BIOINFORMATICS PARTIALLY ONLINE SYLLABUS
BIO 3350: ELEMENTS OF BIOINFORMATICS PARTIALLY ONLINE SYLLABUS NEW YORK CITY COLLEGE OF TECHNOLOGY The City University Of New York School of Arts and Sciences Biological Sciences Department Course title:
