Appendix 1A. ASX Listing Application and Agreement. Appendix ra. Contango Income Generator Limited

Size: px
Start display at page:

Download "Appendix 1A. ASX Listing Application and Agreement. Appendix ra. Contango Income Generator Limited"

Transcription

1 ASX Listing pplictin nd greement Appendix 1A Rules r.r Cnd j, t7 ASX Listing Applictin nd Agreement This frm is required by listing rule t.7 t be used by n entity seeking dmissin t the +ffcil list s n ASX Listing (fr clssificéin s n ASX Debt Listing use Appendix ß nd fr clssifctin s øn ASX Fr eign Exempt Listing use Appendix {). AII entity's seeking dmissin t the +fficil list s n ASX Listing must ls prviile t ASX the infrmtin nd dcuments referred t in the Inþrmtin Frm nd Checklist (ASX Lísting) published n the ASXwebsite. The Appendix ta nd the Infrmtin Frm nd Checklist (ASX Listing) given t ASX becme ASX's prperty nd will be mde public by wy f relese n ASX Mrkets Annuncement Pltfrm. Supprting dcuments my ls be mde publíc. This my ccut prir t dmissin f the entity nd+quttin /its +securities. If it des, publictin des nt men tht the entity will be dmitted r tht its +securities wiii be quted. Intrduced lt 96 Origin: Appendix r Amended r/7 lgz, t/z lg8, l gl 99, ryl3l, rlt/,3l9l ttl1,l z, t/l7, z4ltl5, zl 7 l7, rlrltz, r/5/17 Nme f entity Cntng Incme Genertr Limited ABN/ARBN/ARSN ACN 16 g 999r We (the entity nmed bve) pply fr dmissin t the +fficil list f ASX Limited (ASX) s n ASX Listing nd fr +quttin f the fllwing +securities: +Min clss f +securities Number t be quted 30,,2 (Minimum) l2,,2 (Mximum) +Clss Ordinry shres + See chpter r9 fr defined terms. Appendix ra Pge r ME,rzz898rB -r (Wz3x)

2 ASX Listing pplictin nd greement Additinl +clsses f +securities t be quted (ifny) [D nt include *CDIs] 15,, (Minimum) 60,, (Mximum) Optins In ccrdnce with ASIC Instrument r5l65, quttin f the Optins is sught nly frm the dte tht is 6 mnths fter the clsing dte f the ffer under the Prspectus (such dte, currently nticipted t be z9 Jnury z16) (Vesting Dte). Ech Optin will hve nil issue price nd, subject t vesting, will be exercisble t $1.. Ech Optin cnverts int ne Shre upn exercise. Optins will vest n the Vesting Dte if, nd nly if the pplicnt hlds t the Vesting Dte the sme r greter number f Shres s the number f Shres issued t the pplicnt under the Prspectus. Ech vested Optin is exercisble until 5.pm (Melburne time) n 3 Mrch zr8. We gree: 1. Our dmissin t the +fficil list nd clssifictin s n ASX Listing is in ASX's bslute discretin. ASX my dmit us n ny cnditins it decides. +Quttin f ur *securities is in ASX's bslute discretin. ASX my qute ur +securities n ny cnditins it decides. Our remvl frm the *fficil list, the suspensin r ending f +quttin f ur *securities, r chnge in the ctegry f ur dmissin is in ASX's bslute discretin. ASX is entitled immeditely t suspend +quttin f ur +securities r remve us frm the *ffìcil list if we brek this greement, but the bslute discretin f ASX is nt limited. 2 We wrrnt the fllwing t ASX: The issue f the *securities t be quted cmplies with the lw nd is nt fr n illegl purpse. The +securities t be quted cmply with listing rule z.r nd there is n resn why the *securities shuld nt be grnted *quttin. An ffer f the *securities fr sle within rz mnths fter their issue will nt require disclsure under sectin ZZG) r sectin rrzc(6) f the Crprtins Act. Nte: An entity my need t btin pptprite wrrnties frm subscribers fr the securities in rder t be ble t give this wrrnty Sectin 724 nd sectin rr6e f the Crprtins Act d nt pply t ny pplictins received by us in reltin t ny *securities t be quted nd tht nne hs ny right t return ny *securities t be quted under sectins 6rMB(r), + See chpter r.9 fr defined terms, Appendix ra Pge z ME-rzz898r8 r (Wz3x) rl5lzrs

3 ASX Listing pplictin nd greement 737,7i.8, gg2{, ggz\ar rr6f f the Crprtins Act t the time tht we request tht the *securities be quted.. If we re trust, we wrrnt tht n persn hs the right t return the *securities t be quted under sectin rrgb f the Crprtins Act t the time tht we request tht the *securities be quted We will indemnisr ASX t the fullest extent permitted by lw in respect f ny clim, ctin r expense rising frm, r cnnected with, ny brech f the wrrnties in this greement. We give ASX the infrmtin nd dcuments required by this frm, including the infrmtin nd dcuments referred t in the Infrmtin Frm nd Checklist (ASX Listing) published n the ASX website. If ny infrmtin r dcument is nt vilble nw, we will give it t ASX befre +quttin f the *securities begins. We cknwledge tht ASX is relying n the infrmtin nd dcuments. We wrrnt tht they re (r will be) true nd cmplete. We will cmply with the listing rules tht re in frce frm time t time, even if +quttin f ur +securities is deferred, suspended r subject t +trding hlt. 6. The listing rules re t be interpreted: in ccrdnce with their spirit, intentin nd purpse; by lking beynd frm t substnce; nd in wy tht best prmtes the principles n which the listing rules re bsed. 7 ASX hs discretin t tke n ctin in respnse t brech f listing rule. ASX my ls wive listing rule (except ne tht specifies tht ASX will nt wive it) either n ur pplictin r f its wn ccrd n ny cnditins. ASX my t ny time vry r revke decisin n ur pplictin r f its wn ccrd l A dcument given t ASX by n entity, r n its behlf, becmes nd remins the prperty f ASX t del with s it wishes, including cpying, string in retrievl system, trnsmitting t the public, nd publishing ny prt f the dcument nd permitting thers t d s. The dcuments include dcument given t ASX in supprt f the listing pplictin r in cmplince with the listing rules. In ny prceedings, cpy r extrct f ny dcument r infrmtin given t ASX is f equl vlidity in evidence s the riginl. Except in the cse f n entity estblished in jurisdictin whse lws hve the effect tht the entity's *securities cnnt be pprved under the perting rules f the *pprved CS fcility: We will stisf the *technicl nd perfrmnce requirements f the *pprved CS fcility nd meet ny ther requirements the *pprved CS fcility impses in cnnectin with pprvl f ur *securities. + See chpter r9 fr defined terms. Appendix ra Pge 3 ME rzz898r8 -r (Wz3x)!5lzry

4 ASX Listing pplictin nd greement When *securities re issued we will enter them in the *pprved CS fcility's subregister hlding f the pplicnt befre they re quted, if the pplicnt instructs us n the pplictin frm t d s. The *pprved CS fcility is irrevcbly uthrised t estblish nd dminister subregister in respect f the *securities fr which *quttin is sught. 11. Except in the cse f n entity estblished in jurisdictin whse lws hve the effect tht the entity's *securities cnnt be pprved under the perting rules f the *pprved CS fcility, we cnfirm tht either: we hve given cpy f this pplictin t the *pprved CS fcility in ccrdnce with the perting rules f the *pprved CS fcility ; r we sk ASX t frwrd cpy f this pplictin t the *pprved CS fcility. 12. In the cse f n entity estblished in jurisdictin whse lws hve the effect tht the entity's *securities cnnt be pprved under the perting rules f the *pprved CS fcility: The *pprved CS fcility is irrevcbly uthrised t estblish nd dminister subregister in respect f *CDIs. We will mke sure tht *CDIs re issued ver *securities if the hlder f quted *securities sks fr *CDIs. 13 In the cse f n entity estblished in jurisdictin whse lws hve the effect tht the entity's *securities cnnt be pprved under the perting rules f the *pprved CS fcility: we hve given cpy f this pplictin t the pprved CS fcility in ccrdnce with the perting rules f the *pprved CS fcility; r we sk ASX t frwrd cpy f this pplictin t the *pprved CS fcility + See chpter r9 fr defined terms. Appendix ra Pge 4 ME rzz898r8 r (Wz3x)

5 ASX Listing pplictin nd greement Dted: t(- f c Executed s deed: Executed by Cntng Incme Genertr Limited ACN in ccrdnce with Sectin 127 f the Crprtins Acf 2001 //h e e directr Signture secretry (Plese pp /,tûr t< Kf r( Nme f directr (print) t^tt ^,t h.r-,t,es Nme f directr/cmpny sêcietry (print) Yu must cmplete, dte nd sígn this greement s tht it tkes effect s deed. If the entity is naustrs.iín cmpny,thesignturesfdirectrnddirectrlcmpnysecretrywillberequired. IftheentityisnAustrlin trust, the signtures f directr nd d.irectr/cmpny secrctry f the respnsible entity f the trust wiii be requíred. If the entity is estblished utside Austrli, executin wiii hve t cmply with requirements fr deed in bth the plce f estblishment f the entity nd in Austrli. If this greement is signed under pwer f ttrney, plese ttch cpy fthe pwer fttrney. + See chpter r9 fr defined terms. Appendix ra Pge 5 ME rzz898rl)-_r (Wz3x)

FORM ADV (Paper Version) UNIFORM APPLICATION FOR INVESTMENT ADVISER REGISTRATION AND REPORT FORM BY EXEMPT REPORTING ADVISERS

FORM ADV (Paper Version) UNIFORM APPLICATION FOR INVESTMENT ADVISER REGISTRATION AND REPORT FORM BY EXEMPT REPORTING ADVISERS APPENDIX A FORM ADV (Paper Versin) UNIFORM APPLICATION FOR INVESTMENT ADVISER REGISTRATION AND REPORT FORM BY EXEMPT REPORTING ADVISERS Frm ADV: General Instructins Read these instructins carefully befre

More information

WHAT YOU NEED TO KNOW ABOUT. Protecting your Privacy

WHAT YOU NEED TO KNOW ABOUT. Protecting your Privacy WHAT YOU NEED TO KNOW ABOUT Prtecting yur Privacy YOUR PRIVACY IS OUR PRIORITY Credit unins have a histry f respecting the privacy f ur members and custmers. Yur Bard f Directrs has adpted the Credit Unin

More information

IDENTIFICATION FORM 3: TRUSTS, TRUSTEES & SMSFs

IDENTIFICATION FORM 3: TRUSTS, TRUSTEES & SMSFs IDENTIFICATION FORM 3: TRUSTS, TRUSTEES & SMSFs GUIDE TO COMPLETING THIS FORM Cmplete the fllwing in BLOCK LETTERS: Sectin 1 (all parts) all trusts. AND select and cmplete ne f the fllwing sectins fr ONLY

More information

NextGenJustice Florida attorneys have prepared the following Frequently Asked Questions to help you with your uncontested divorce.

NextGenJustice Florida attorneys have prepared the following Frequently Asked Questions to help you with your uncontested divorce. NextGenJustice Flrida attrneys have prepared the fllwing Frequently Asked Questins t help yu with yur uncntested divrce. Frequently asked questins abut yur uncntested Flrida divrce: Q. Hw lng will my divrce

More information

Bill Payment Agreement & Disclosures

Bill Payment Agreement & Disclosures Bill Payment Agreement & Disclsures Welcme t Online Banking Bill Payment Service. Use f the Bill Payment Service indicates acceptance f terms and cnditins set frth in the Online Banking Agreement & Disclsures

More information

GUARD1 /plus. PIPE Utility. User's Manual. Version 2.0

GUARD1 /plus. PIPE Utility. User's Manual. Version 2.0 GUARD1 /plus PIPE Utility User's Manual Versin 2.0 30700 Bainbridge Rad Sln, Ohi 44139 Phne 216-595-0890 Fax 216-595-0991 supprt@guard1.cm www.guard1.cm 2010 TimeKeeping Systems, Inc. GUARD1 PLUS and THE

More information

CFD AND SPOT FOREX TERMS: DEPOSIT ACCOUNTS

CFD AND SPOT FOREX TERMS: DEPOSIT ACCOUNTS 1. Structure 1.1 When we engage in cfd r spt frex trading with yu, we d s n the basis f: - ur General Terms; these terms, i.e. ur CFD and Spt Frex Terms. 1.2 The CFD and Spt Frex Terms deal with matters

More information

Enterprise Investment Scheme. Tax efficiency for investors

Enterprise Investment Scheme. Tax efficiency for investors Enterprise Investment Scheme Tax efficiency fr investrs Intrductin Welcme t Keyntes. Keyntes is a mnthly event and publicatin t help early stage businesses get t grips with key legal issues. A bit abut

More information

Investment Adviser Switch Workshop

Investment Adviser Switch Workshop Investment Adviser Switch Wrkshp Investment Adviser Registratin, Renewal, Amendment And Pst-Registratin Requirements Presented by Office f the Attrney General Maryland Divisin f Securities 1 Registratin

More information

Customer no.: enter customer no. Contract no.: enter contract no.

Customer no.: enter customer no. Contract no.: enter contract no. Annex Versin: 2.0 Specificatin f services E-mail and telephne supprt by and between (client) and secunet Security Netwrks AG Krnprinzenstrasse 30 45128 Essen Germany (secunet r cntractr) Custmer n.: enter

More information

67.50. Your child s health is our priority. Bupa schools scheme. bupa.co.uk ONLY PER TERM PER CHILD. Provided by

67.50. Your child s health is our priority. Bupa schools scheme. bupa.co.uk ONLY PER TERM PER CHILD. Provided by Prvided by Bupa schls scheme Yur child s health is ur pririty 67.50 PER TERM PER CHILD * ONLY bupa.c.uk *Thesubscriptinrateappliesfrmembershipyear1September2013 t31august2014.thissubscriptinrateincludesinsurancepremium

More information

LOUISIANA TECH UNIVERSITY Division of Student Financial Aid Post Office Box 7925 Ruston, LA 71272

LOUISIANA TECH UNIVERSITY Division of Student Financial Aid Post Office Box 7925 Ruston, LA 71272 LOUISIANA TECH UNIVERSITY Divisin f Student Financial Aid Pst Office Bx 7925 Rustn, LA 71272 Dear Financial Aid Applicant, Accrding t yur 2011-2012 Student Aid Reprt (SAR), yu did nt include any parental

More information

WORKPLACE INJURY/ILLNESS/INCIDENT INVESTIGATION & REPORTING POLICY (BC VERSION)

WORKPLACE INJURY/ILLNESS/INCIDENT INVESTIGATION & REPORTING POLICY (BC VERSION) WORKPLACE INJURY/ILLNESS/INCIDENT INVESTIGATION & REPORTING POLICY (BC VERSION) Intrductin: Hw t Use This Tl As d all ther jurisdictins, BC requires emplyers t investigate and reprt specific kinds f wrkplace

More information

United States Department of Commerce International Trade Administration

United States Department of Commerce International Trade Administration Case Number Segment f Prceeding (Perid f Review) Number f Pages Public Dcument United States Department f Cmmerce Internatinal Trade Administratin APPLICATION FOR ADMINISTRATIVE PROTECTIVE ORDER in ANTIDUMPING

More information

RQ10.06 AACo Share Trading Policy

RQ10.06 AACo Share Trading Policy Australian Agricultural Cmpany Limited ACN 010 892 270 RQ10.06 AAC Share Trading Plicy Versin 5 This plicy was apprved by the Bard f Australian Agricultural Cmpany Limited n 15 December 2010. This plicy

More information

ISAM TO SQL MIGRATION IN SYSPRO

ISAM TO SQL MIGRATION IN SYSPRO 118 ISAM TO SQL MIGRATION IN SYSPRO This dcument is aimed at assisting yu in the migratin frm an ISAM data structure t an SQL database. This is nt a detailed technical dcument and assumes the reader has

More information

New Hampshire. Address: New Hampshire Real Estate Commission 64 South Street Concord, NH 03301-3670

New Hampshire. Address: New Hampshire Real Estate Commission 64 South Street Concord, NH 03301-3670 New Hampshire Gverning Agency New Hampshire Real Estate Cmmissin Website: http://www.nh.gv/nhrec/ Address: New Hampshire Real Estate Cmmissin 64 Suth Street Cncrd, NH 03301-3670 Telephne N.: (603) 271-2701

More information

FACT SHEET BORROWING THROUGH SUPER. Prepared by Brett Griffiths, Director Superannuation Consulting e bgriffiths@vincents.com.au

FACT SHEET BORROWING THROUGH SUPER. Prepared by Brett Griffiths, Director Superannuation Consulting e bgriffiths@vincents.com.au FACT SHEET BORROWING THROUGH SUPER Prepared by Brett Griffiths, Directr Superannuatin Cnsulting e bgriffiths@vincents.cm.au FACT SHEET Since September 2007 Self Managed Superannuatin Funds (SMSF s) can

More information

Other (please specify):

Other (please specify): Trusted Partner New Applicatin This frm shuld be used by Persns wh will make an ffer f emplyment, Emplyers, Cnnected Persns r EEA Cntractrs wh wish t apply fr Trusted Partner status fr the purpses f future

More information

SPECIFIK TERMS AND CONDITIONS OF SUBSCRIPTION TO DIGITAL CABLE TELEVISION SERVICES FOR BUSINESSES OFFERED BY "IPKO" TELECOMMUNICATIONS LLC

SPECIFIK TERMS AND CONDITIONS OF SUBSCRIPTION TO DIGITAL CABLE TELEVISION SERVICES FOR BUSINESSES OFFERED BY IPKO TELECOMMUNICATIONS LLC SPECIFIK TERMS AND CONDITIONS OF SUBSCRIPTION TO DIGITAL CABLE TELEVISION SERVICES FOR BUSINESSES OFFERED BY "IPKO" TELECOMMUNICATIONS LLC Article 1 - Cntents f Special Cnditins 1.1 These Special cnditins

More information

APPLICATION FOR SIDEWALK CAFÉ LICENSE. Minimum Submittal Requirements - The following must be attached to this completed form for the City's review:

APPLICATION FOR SIDEWALK CAFÉ LICENSE. Minimum Submittal Requirements - The following must be attached to this completed form for the City's review: City f Trinidd Plnning Deprtment 135 N. Anims Trinidd, Clrd 81082 Telephne (719) 846-9843 X 130 Fx (719) 846-4140 plnning@histrictrinidd.cm APPLICATION FOR SIDWALK CAFÉ LICNS Minimum Submittl Requirements

More information

YOUR NEW SOUTH WALES WORKERS COMPENSATION CLAIM

YOUR NEW SOUTH WALES WORKERS COMPENSATION CLAIM Gibney & Gunsn LAWYERS New Suth Wales & Victria YOUR NEW SOUTH WALES WORKERS COMPENSATION CLAIM Nt cvered by the scheme Injuries that ccur n the way t r frm wrk (wrkers wh are injured while driving during

More information

Hearing Loss Regulations Vendor information pack

Hearing Loss Regulations Vendor information pack Hearing Lss Regulatins Vendr infrmatin pack Nvember 2010 Implementing the Accident Cmpensatin (Apprtining Entitlements fr Hearing Lss) Regulatins 2010 The Minister fr ACC, the Hn. Dr Nick Smith, has annunced

More information

Amazon Marketing Services Content Policies and Standards

Amazon Marketing Services Content Policies and Standards Amazn Marketing Services Cntent Plicies and Standards Cntents Intrductin... 2 Acceptance f Creative Assets... 2 General Creative Plicies... 3 Reprting Abuse... 3 Cnsequences fr Vilatins... 3 Image Guidelines...

More information

Office Use Only Account # Approved By:

Office Use Only Account # Approved By: Office Use Only Accunt # Apprved By: Dealer Applicatin Please cmplete and submit this applicatin alng with a cpy f yur (EIN) Federal Tax Id Number certificate befre placing yur 1 st rder. We will review

More information

IN THIS POLICY, THE INVESTMENT RISK IN INVESTMENT PORTFOLIO IS BORNE BY THE POLICYHOLDER.

IN THIS POLICY, THE INVESTMENT RISK IN INVESTMENT PORTFOLIO IS BORNE BY THE POLICYHOLDER. Life Invest TM Plan UIN 104L031V01 IN THIS POLICY, THE INVESTMENT RISK IN INVESTMENT PORTFOLIO IS BORNE BY THE POLICYHOLDER. Life Invest is a pwerful insurance plan that empwers yu t manage yur investments

More information

Exemptions and Deductions Part-I

Exemptions and Deductions Part-I Exemptins and Deductins Part-I CA Paras K. Savla Exemptins and Deductins Part-I I) Sectin 10(10D) Taxability f receipts under Life insurance plicy A. Life Insurance n live s f persns with disability r

More information

Loan Application for Pre- Approval

Loan Application for Pre- Approval Lan Applicatin fr Pre- Apprval Get pre-apprved fr yur hme lan financing tday by cmpleting this applicatin. Please cmplete the entire applicatin and return with the dcumentatin requested n the attached

More information

Spread Bet Terms: Deposit Accounts

Spread Bet Terms: Deposit Accounts Spread Bet Terms: Depsit Accunts 1. Structure 1.1 When we engage in Spread Betting with yu, we d s n the basis f: - ur General Terms; these terms, i.e. ur Spread Terms. 1.2 The Spread Terms deal with matters

More information

FINRA Regulation Filing Application Batch Submissions

FINRA Regulation Filing Application Batch Submissions FINRA Regulatin Filing Applicatin Batch Submissins Cntents Descriptin... 2 Steps fr firms new t batch submissin... 2 Acquiring necessary FINRA accunts... 2 FTP Access t FINRA... 2 FTP Accunt n FINRA s

More information

Annuities and Senior Citizens

Annuities and Senior Citizens Illinis Insurance Facts Illinis Department f Insurance January 2010 Annuities and Senir Citizens Nte: This infrmatin was develped t prvide cnsumers with general infrmatin and guidance abut insurance cverages

More information

BRILL s Editorial Manager (EM) Manual for Authors Table of Contents

BRILL s Editorial Manager (EM) Manual for Authors Table of Contents BRILL s Editrial Manager (EM) Manual fr Authrs Table f Cntents Intrductin... 2 1. Getting Started: Creating an Accunt... 2 2. Lgging int EM... 3 3. Changing Yur Access Cdes and Cntact Infrmatin... 3 3.1

More information

Errors & Omissions Insurance for Title, Escrow Agents and Abstractors. Endorsed by the American Land Title Association

Errors & Omissions Insurance for Title, Escrow Agents and Abstractors. Endorsed by the American Land Title Association Errrs & Omissins Insurance fr Title, Escrw Agents and Abstractrs Endrsed by the American Land Title Assciatin The Insurance Cmpany: Title Industry Assurance Cmpany, a Risk Retentin Grup TIAC issued its

More information

Special Procedures for United States and NATO Contractors

Special Procedures for United States and NATO Contractors Special Prcedures fr United States and NATO Cntractrs New AISA License and its Renewal Prcedures Gvernment f the Islamic Republic f Afghanistan Afghanistan Investment Supprt Agency (AISA) Directrate f

More information

CFD and Spot Forex Terms: Deposit Accounts

CFD and Spot Forex Terms: Deposit Accounts CFD and Spt Frex Terms: Depsit Accunts 1. Structure 1.1 When we engage in CFD r Spt Frex trading with yu, we d s n the basis f: - ur General Terms; these terms, i.e. ur CFD and Spt Frex Terms. 1.2 The

More information

Nature of the investment

Nature of the investment March 2014 Real Estate and Capital Markets Bulletin The Mrtgage Investment Crpratin - an Alternative Lender Intrductin In 1973, the federal gvernment intrduced measures aimed at stimulating investments

More information

Products will be listed on web site after successful completion, in one of the following two Listing Categories

Products will be listed on web site after successful completion, in one of the following two Listing Categories Test & Certificatin Applicatin Certificatin Prcess Submissin Prcess 1. Custmer cntacts Qualcmm directly regarding Trademark Agreement and Brand Guidelines 2. Custmer submits Test and Certificatin applicatin

More information

Remote Desktop Tutorial. By: Virginia Ginny Morris

Remote Desktop Tutorial. By: Virginia Ginny Morris Remte Desktp Tutrial By: Virginia Ginny Mrris 2008 Remte Desktp Tutrial Virginia Ginny Mrris Page 2 Scpe: The fllwing manual shuld accmpany my Remte Desktp Tutrial vide psted n my website http://www.ginnymrris.cm

More information

UNIVERSITY OF WINCHESTER

UNIVERSITY OF WINCHESTER UNIVERSITY OF WINCHESTER INTRODUCTION DEBT MANAGEMENT POLICY: STUDENTS ACADEMIC YEAR 15/16 This dcument sets ut the plicy f the University in relatin t student debt, alng with the debt management prcedures

More information

Heythrop College Disciplinary Procedure for Support Staff

Heythrop College Disciplinary Procedure for Support Staff Heythrp Cllege Disciplinary Prcedure fr Supprt Staff Intrductin 1. This prcedural dcument des nt apply t thse academic-related staff wh are mentined in the Cllege s Ordinance, namely the Librarian and

More information

INFORMATIONAL NOTICE MISCELLANEOUS TAX 2013-01. Issued: January 02, 2013

INFORMATIONAL NOTICE MISCELLANEOUS TAX 2013-01. Issued: January 02, 2013 INFORMATIONAL NOTICE MISCELLANEOUS TAX 2013-01 Issued: January 02, 2013 Pennsylvania Department f Revenue Guidelines fr Cllectin and Administrative Bank Attachment Required by Act 85 f 2012 Per the Tax

More information

Life Maker Pension Plan

Life Maker Pension Plan COVER PAGE Life Maker Pensin Plan IN THIS POLICY, THE INVESTMENT RISK IN INVESTMENT PORTFOLIO IS BORNE BY THE POLICYHOLDER. A pensin plan that helps yu plan yur secnd innings. INSIDE PAGES The Life Maker

More information

Frequently Asked Questions About I-9 Compliance

Frequently Asked Questions About I-9 Compliance Frequently Asked Questins Abut I-9 Cmpliance What is required t verify wrk authrizatin? The basic requirement t verify wrk authrizatin is the Frm I-9. This frm is available n the HR website: http://www.fit.edu/hr/dcuments/frms/i-9.pdf

More information

THE EMPLOYMENT LAW DISPUTE SPECIALISTS DAMAGES BASED AGREEMENT. Your Employment Tribunal claim relating to your employment with...

THE EMPLOYMENT LAW DISPUTE SPECIALISTS DAMAGES BASED AGREEMENT. Your Employment Tribunal claim relating to your employment with... THE EMPLOYMENT LAW DISPUTE SPECIALISTS DAMAGES BASED AGREEMENT 1. What is cvered by this agreement Yur Emplyment Tribunal claim relating t yur emplyment with... 2. What is nt cvered by this agreement 2.1

More information

2001 Attachment Sequence No. 118

2001 Attachment Sequence No. 118 Form Deprtment of the Tresury Internl Revenue Service Importnt: Return of U.S. Persons With Respect to Certin Foreign Prtnerships Attch to your tx return. See seprte instructions. Informtion furnished

More information

SMSF 2015 year end action and checklist In brief

SMSF 2015 year end action and checklist In brief Visin, understanding and results SMSF 2015 year end actin and checklist In brief Date 19 March 2015 but applies retrspectively frm 2013-14. Pre 30 June 2015 Changes and actins Excess nn-cncessinal cntributins

More information

Small Business, Enterprise and Employment Bill: Insolvency fact sheets Contents

Small Business, Enterprise and Employment Bill: Insolvency fact sheets Contents 1 Small Business, Enterprise and Emplyment Bill: Inslvency fact sheets Cntents Directr Disqualificatin and Inslvency General Aims... 2 Administratin: sales t cnnected persns (prepack administratins)...

More information

CENTURIC.COM ONLINE DATA BACKUP AND DISASTER RECOVERY SOLUTION ADDENDUM TO TERMS OF SERVICE

CENTURIC.COM ONLINE DATA BACKUP AND DISASTER RECOVERY SOLUTION ADDENDUM TO TERMS OF SERVICE CENTURIC.COM ONLINE DATA BACKUP AND DISASTER RECOVERY SOLUTION ADDENDUM TO TERMS OF SERVICE This Agreement, named the Online Data Backup and Disaster Recvery Slutin Addendum t Centuric s Terms f Service

More information

Town of Windham. Property Tax Credit & Exemption Programs - RSA 72

Town of Windham. Property Tax Credit & Exemption Programs - RSA 72 Twn f Windham Prperty Tax Credit & Exemptin Prgrams - RSA 72 T be eligible, Applicant must file a request, in persn, with the Assessr s Office n r befre April 15 th f any given year, and Applicant must

More information

The Jackson Laboratory Third-Party Fundraising Guidelines

The Jackson Laboratory Third-Party Fundraising Guidelines The Jacksn Labratry Third-Party Fundraising Guidelines DEFINITION A Third-Party Fundraiser ( Fundraiser ) is defined as an rganizatin, crpratin, grup r individual raising mney fr The Jacksn Labratry (the

More information

Request for Proposals

Request for Proposals Request fr Prpsals GIS Prject Water & Sewer Systems Issued by: NEOnet Inc. 4715 Highway 101 East Suth Prcupine, ON P0N1H0 Phne: 705.360.1353 Web: www.nenet.n.ca Deadline fr Submissin: 5:00 p.m. March 11,

More information

Dial Backup for Dedicated T1 Circuits using the ATLAS

Dial Backup for Dedicated T1 Circuits using the ATLAS Article ID: 1449 Q&A Dial Backup fr Dedicated T1 Circuits using the ATLAS Q: Dial Backup fr Dedicated T1 Circuits using the ATLAS A: Intrductin This technical supprt nte describes hw t cnfigure the ATLAS

More information

Spread Bet Terms: Deposit Accounts

Spread Bet Terms: Deposit Accounts Spread Bet Terms: Depsit Accunts 1. Structure 1.1 When we engage in Spread Betting with yu, we d s n the basis f: - ur General Terms; these terms, i.e. ur Spread Terms. 1.2 The Spread Terms deal with matters

More information

Spread Bet Terms: Deposit Accounts

Spread Bet Terms: Deposit Accounts Spread Bet Terms: Depsit Accunts 1. Structure 1.1 When we engage in Spread Betting with yu, we d s n the basis f: - ur General Terms; these terms, i.e. ur Spread Terms. 1.2 The Spread Terms deal with matters

More information

Dreamweaver MX 2004. Templates

Dreamweaver MX 2004. Templates Dreamweaver MX 2004 Templates Table f Cntents Dreamweaver Templates... 3 Creating a Dreamweaver template... 3 Types f template regins... 4 Inserting an editable regin... 4 Selecting editable regins...

More information

AMWA Chapter Subgroups on LinkedIn Guidance for Subgroup Managers and Chapter Leaders, updated 2-12-15

AMWA Chapter Subgroups on LinkedIn Guidance for Subgroup Managers and Chapter Leaders, updated 2-12-15 AMWA Chapter Subgrups n LinkedIn Guidance fr Subgrup Managers and Chapter Leaders, updated 2-12-15 1. Chapters may nt have an independent grup n LinkedIn, Facebk, r ther scial netwrking site. AMWA prvides

More information

CFD and Spot Forex Terms: Deposit Accounts

CFD and Spot Forex Terms: Deposit Accounts CFD and Spt Frex Terms: Depsit Accunts 1. Structure 1.1 When we engage in CFD r Spt Frex trading with yu, we d s n the basis f: - ur General Terms; these terms, i.e. ur CFD and Spt Frex Terms. 1.2 The

More information

FAFSA / DREAM ACT COMPLETION PROGRAM AGREEMENT

FAFSA / DREAM ACT COMPLETION PROGRAM AGREEMENT FAFSA / DREAM ACT COMPLETION PROGRAM AGREEMENT If using US Pstal Service, please return t: Califrnia Student Aid Cmmissin Prgram Administratin & Services Divisin ATTN: Institutinal Supprt P.O. Bx 419028

More information

Bank switching service - Regulation

Bank switching service - Regulation versin 3.0-1/7/2011 Bank switching service - Regulatin This Regulatin cnstitutes the verall framewrk in which the participating banks in Belgium ffer cnsumers a bank switching service fr current accunts.

More information

STEP 1: Student Application Submission

STEP 1: Student Application Submission Student Applicatin Prcess fr Chice Districts Interdistrict Public Schl Chice Prgram New Jersey State Department f Educatin P.O. Bx 500 Trentn, New Jersey 08625-0500 Email: pschice@de.state.nj.us STEP 1:

More information

Training Script: Documenting Provider

Training Script: Documenting Provider Training Script: Dcumenting Prvider Training Script: Dcumenting Prvider Agenda Item Intrductin Lg int Cmputer EMR Mdule Desktp Mdule Review Desktp and EMR in Meditech Test CPOE Sessin 1 Discussin Intrduce

More information

We will record and prepare documents based off the information presented

We will record and prepare documents based off the information presented Dear Client: We appreciate the pprtunity f wrking with yu regarding yur Payrll needs. T ensure a cmplete understanding between us, we are setting frth the pertinent infrmatin abut the services that we

More information

Biznet GIO Cloud - Build Site to Site VPNWith Cisco Router. Site to Site VPN with Cisco Router

Biznet GIO Cloud - Build Site to Site VPNWith Cisco Router. Site to Site VPN with Cisco Router Site t Site VPN with Cisc Ruter Intrductin This dcument is intended t guide yu thrugh the necessary steps t build a site-t-site VPN. Please nte a site-t-site VPN can nly be built frm a VPC therefre fr

More information

Using McAllister Payment Solutions and Updating to AVImark version 2009.0.0.7263

Using McAllister Payment Solutions and Updating to AVImark version 2009.0.0.7263 Using McAllister Payment Slutins and Updating t AVImark versin 2009.0.0.7263 Befre the cnfiguratin f McAllister Payment Slutins (MPS) and AVImark, the McAllister Payment Slutins PA-DSS Implementatin Guide

More information

CORE 8 to 9 Data Migration Guide

CORE 8 to 9 Data Migration Guide CORE 8 t 9 Data Migratin Guide i CORE 8 t 9 Data Migratin Guide Cpyright 2009-2015 Vitech Crpratin. All rights reserved. N part f this dcument may be reprduced in any frm, including, but nt limited t,

More information

Texas Hold Em Poker Tournament licence application fee: $20.00 (non-refundable) A 25.00 administration fee will be charged for N.S.F. cheques.

Texas Hold Em Poker Tournament licence application fee: $20.00 (non-refundable) A 25.00 administration fee will be charged for N.S.F. cheques. Texas Hld Em Pker Turnament Applicatin The Saskatchewan Liqur and Gaming Authrity may issue a licence pursuant t subsectin 207 (1)(b) f the Criminal Cde f Canada, authrizing charitable r religius rganizatins

More information

Montana Acquisition & Contracting System (emacs) emacs Handbook. Vendor Registration and Data Management

Montana Acquisition & Contracting System (emacs) emacs Handbook. Vendor Registration and Data Management Mntana Acquisitin & Cntracting System (emacs) emacs Handbk Vendr Registratin and Data Management Welcme The purpse f this emacs Handbk fr Vendr Registratin and Data Management is t prvide vendrs with the

More information

SAEMA Document No. SDN. 14001

SAEMA Document No. SDN. 14001 SAEMA Dcument N. SDN. 14001 Issue Date: 6 th Nvember 2012 Guidance dcument n facade access mechanical/ electrical breakdwn, rescue and rescue planning. Specialist Access Engineering and Maintenance Assciatin

More information

YOUR DUTIES AS EXECUTOR

YOUR DUTIES AS EXECUTOR Gibney & Gunsn LAWYERS New Suth Wales & Victria YOUR DUTIES AS EXECUTOR The funeral Yu may be required t make the funeral arrangements. In mst instances, clse family r friends attend t funeral arrangements

More information

CHARTER OF THE COMPENSATION COMMITTEE OF THE BOARD OF DIRECTORS OF UPLAND SOFTWARE, INC.

CHARTER OF THE COMPENSATION COMMITTEE OF THE BOARD OF DIRECTORS OF UPLAND SOFTWARE, INC. CHARTER OF THE COMPENSATION COMMITTEE OF THE BOARD OF DIRECTORS OF UPLAND SOFTWARE, INC. PURPOSE The purpse f the Cmpensatin Cmmittee f the Bard f Directrs (the Bard ) f Upland Sftware, Inc. (the Cmpany

More information

BUPA DENTAL PLAN A P P L I C AT I O N F O R M

BUPA DENTAL PLAN A P P L I C AT I O N F O R M BUPA DENTAL PLAN A P P L I C AT I O N F O R M Please cmplete all relevant sectins f the frm in BLOCK CAPITALS and BLACK INK and return it t: Cnsumer Partnerships, FPS Dental, Bupa, Willw Huse, Chertsey

More information

Chris Chiron, Interim Senior Director, Employee & Management Relations Jessica Moore, Senior Director, Classification & Compensation

Chris Chiron, Interim Senior Director, Employee & Management Relations Jessica Moore, Senior Director, Classification & Compensation TO: FROM: HR Officers & Human Resurces Representatives Chris Chirn, Interim Senir Directr, Emplyee & Management Relatins Jessica Mre, Senir Directr, Classificatin & Cmpensatin DATE: May 26, 2015 RE: Annual

More information

Bath Road Ind Est, Bath Road, Chippenham, Wiltshire, SN14 0AB 01249 461267

Bath Road Ind Est, Bath Road, Chippenham, Wiltshire, SN14 0AB 01249 461267 Rental Agreement Terms & Cnditins f Hire We are Bathwick Car and Van Hire Ltd. Bath Rad Ind Est, Bath Rad, Chippenham, Wiltshire, SN14 0AB 01249 461267 These terms apply, t the hire f the hrsebx, that

More information

GUIDELINES LICENSING OF FINANCIAL INSTITUTIONS

GUIDELINES LICENSING OF FINANCIAL INSTITUTIONS GUIDELINES FOR THE LICENSING OF FINANCIAL INSTITUTIONS IN TRINIDAD AND TOBAGO UNDER THE FINANCIAL INSTITUTIONS ACT, 1993 I. DEFINITIONS: Institutins may be licensed under the Financial Institutins Act,

More information

Emulation Tech Note 12 Testing XDS560V2 STM Emulator s Ethernet Port on Wi-Fi

Emulation Tech Note 12 Testing XDS560V2 STM Emulator s Ethernet Port on Wi-Fi Emulatin Tech Nte 12 Testing XDS560V2 STM Emulatr s Ethernet Prt n Wi-Fi Dcument Revisin 0.01 March 2, 2011 Page 1 f 6 TABLE OF CONTENTS 1 OVERVIEW... 3 2 HARDWARE TOOLS USED FOR TESTING... 3 3 SOFTWARE

More information

LeadStreet Broker Guide

LeadStreet Broker Guide RE/MAX f Western Canada LeadStreet Brker Guide Ver. 2.0 Revisin Histry Name Date Versin Descriptin Tamika Anglin 09/04/13 1.0 Initial Creatin Tamika Anglin 11/05/13 2.0 Inclusin f instructins n reprting

More information

Information Bulletin PT 204/09.15

Information Bulletin PT 204/09.15 Infrmatin Bulletin PT 204/09.15 Operatr Accreditatin fr Limusine Services What is peratr accreditatin? The Transprt Operatins (Passenger Transprt) Act 1994 requires peratrs f public passenger services

More information

Satisfactory Academic Progress Policy

Satisfactory Academic Progress Policy Satisfactry Academic Prgress Plicy This plicy defines satisfactry academic prgress fr all Bstn University Schl f Law financial aid recipients in the fllwing LL.M. prgrams: LL.M. in Taxatin, including the

More information

Conventional Condominium Policy

Conventional Condominium Policy Cnventinal Cndminium Plicy www.newleafwhlesale.cm Overview NewLeaf will riginate and fund mrtgage lans secured by units in cndminium prjects that meet FNMA/FHLMC/ NewLeaf eligibility criteria. Cndminium

More information

Frequently Asked Questions about the Faith A. Fields Nursing Scholarship Loan

Frequently Asked Questions about the Faith A. Fields Nursing Scholarship Loan ARKANSAS STATE BOARD OF NURSING 1123 S. University Avenue, Suite 800, University Twer Building, Little Rck, AR 72204 Phne: (501) 686-2700 Fax: (501) 686-2714 www.arsbn.rg Frequently Asked Questins abut

More information

National Australia Bank Limited Group Disclosure & External Communications Policy

National Australia Bank Limited Group Disclosure & External Communications Policy Natinal Australia Bank Limited Grup Disclsure & External Cmmunicatins Plicy Grup Disclsure & External Cmmunicatins Plicy Page 2 f 7 Grup Disclsure & External Cmmunicatins Plicy ( the Plicy ) 1. Overview

More information

Software and Hardware Change Management Policy for CDes Computer Labs

Software and Hardware Change Management Policy for CDes Computer Labs Sftware and Hardware Change Management Plicy fr CDes Cmputer Labs Overview The cmputer labs in the Cllege f Design are clsely integrated with the academic needs f faculty and students. Cmputer lab resurces

More information

Purpose Statement. Objectives

Purpose Statement. Objectives Apprved by Academic Affairs Cuncil, June 24, 2014 Faculty Handbk Part VI: Other Plicies and Prcedures Sectin R. Intellectual Prperty Classified Emplyee Handbk Part VI: Other Plicies and Prcedures Sectin

More information

Tel: +27 (012) 481 2842 Fax: +27 (012) 481 2843/50 admin@universitiessa.ac.za www.universitiessa.ac.za

Tel: +27 (012) 481 2842 Fax: +27 (012) 481 2843/50 admin@universitiessa.ac.za www.universitiessa.ac.za UNISA Sunnyside Campus, Building 3, Level 1 cnr Rissik & Steve Bik Streets Sunnyside, Pretria Suth Africa P.O. Bx 27392 Sunnyside, Pretria, 0132 Tel: +27 (012) 481 2842 Fax: +27 (012) 481 2843/50 admin@universitiessa.ac.za

More information

insurers cannot deny coverage for patients with preexisting conditions or because an insured got sick;

insurers cannot deny coverage for patients with preexisting conditions or because an insured got sick; The Affrdable Care Act Health Insurance Respnsibilities f Large, Midsize & Small Emplyers; Buying Insurance n the Individual Health Insurance Marketplace and the Small Business Health Optins Prgram Intrductin:

More information

Payment & Dispute Management Policy

Payment & Dispute Management Policy BACKGROUND, GOALS & OBJECTIVES Business Issue/Opprtunity In 2013, Lenv initiated a series f prjects t imprve the verall custmer experience fr ur custmers and business partners. The timeliness and accuracy

More information

BME Smart-Colo. Smart-Colo is a solution optimized for colocating trading applications, built and managed by BME.

BME Smart-Colo. Smart-Colo is a solution optimized for colocating trading applications, built and managed by BME. BME Smart-Cl 1. Intrductin The aim f this dcument is t describe the BME Smart-Cl service fr accessing BME Cash, BME Derivative markets and market data feeds. Smart-Cl service prvides at the BME Data Center

More information

Proposal for Development & Implementation of. Integrated Website Solution. For. Tej Shree. By: The Web Creation Delhi, INDIA

Proposal for Development & Implementation of. Integrated Website Solution. For. Tej Shree. By: The Web Creation Delhi, INDIA Prpsal fr Develpment & Implementatin f Integrated Website Slutin Fr Tej Shree By: The Web Creatin Delhi, INDIA SUB: Prpsal fr Designing & Implementatin f Integrated Web Slutin Please find enclsed ur prpsal

More information

HarePoint HelpDesk for SharePoint. For SharePoint Server 2010, SharePoint Foundation 2010. User Guide

HarePoint HelpDesk for SharePoint. For SharePoint Server 2010, SharePoint Foundation 2010. User Guide HarePint HelpDesk fr SharePint Fr SharePint Server 2010, SharePint Fundatin 2010 User Guide Prduct versin: 14.1.0 04/10/2013 2 Intrductin HarePint.Cm (This Page Intentinally Left Blank ) Table f Cntents

More information

Excel Contact Reports

Excel Contact Reports Excel Cntact Reprts v.1.0 Anther efficient and affrdable ACT! Add-On by http://www.expnenciel.cm Excel Cntact Reprts User s Manual 2 Table f cntents Purpse f the add-n... 3 Installatin prcedure... 3 The

More information

SETTING UP A SYNDICATE SERVICE COMPANY IN HONG KONG

SETTING UP A SYNDICATE SERVICE COMPANY IN HONG KONG SETTING UP A SYNDICATE SERVICE COMPANY IN HONG KONG 2012 2 Disclaimer This is fr reference nly and is nt cnsidered t be legal advice. Whilst all care has been taken t ensure the accuracy f the infrmatin

More information

Configuring Dynamic DNS on the LAN-Cell 2

Configuring Dynamic DNS on the LAN-Cell 2 Cnfiguring Dynamic DNS n the LAN-Cell 2 Technte LCTN0016 Prxicast, LLC 312 Sunnyfield Drive Suite 200 Glenshaw, PA 15116 1-877-77PROXI 1-877-777-7694 1-412-213-2477 Fax: 1-412-492-9386 E-Mail: supprt@prxicast.cm

More information

Application Fee Schedule Please check the appropriate box below. See also Additional Information starting on page 6.

Application Fee Schedule Please check the appropriate box below. See also Additional Information starting on page 6. DRIVING SCHOOL LICENSE APPLICATION N. APPLICATION DMV USE ONLY N. LICENSE Received Fee Amunt Expiratin Fee Amunt PART 1 Schl Infrmatin: l READ VEHICLE AND TRAFFIC LAW SECTION 394 AND DMV COMMISSIONER S

More information

Checklist for Columbia State Community College s Course Creation Process

Checklist for Columbia State Community College s Course Creation Process Checklist fr Clumbia State Cmmunity Cllege s Curse Creatin Prcess Curses cannt be added t the schedule until this prcess is cmpleted, all curse dcuments are submitted, and the curse is apprved by the Directr

More information

MAYFAIR INSURANCE & MORTGAGE CONSULTANTS LTD 11 Lurke Street, Bedford MK40 3HZ Telephone: 01234 242900

MAYFAIR INSURANCE & MORTGAGE CONSULTANTS LTD 11 Lurke Street, Bedford MK40 3HZ Telephone: 01234 242900 MAYFAIR INSURANCE & MORTGAGE CONSULTANTS LTD 11 Lurke Street, Bedfrd MK40 3HZ Telephne: 01234 242900 Please read this dcument carefully as it sets ut the terms n which we agree t act fr ur clients and

More information

Binary Representation of Numbers Autar Kaw

Binary Representation of Numbers Autar Kaw Binry Representtion of Numbers Autr Kw After reding this chpter, you should be ble to: 1. convert bse- rel number to its binry representtion,. convert binry number to n equivlent bse- number. In everydy

More information

What Does Specialty Own Occupation Really Mean?

What Does Specialty Own Occupation Really Mean? What Des Specialty Own Occupatin Really Mean? Plicy definitins are cnfusing, nt nly t cnsumers but als t many f the insurance prfessinals wh sell them. Belw we will try t prvide an understandable explanatin

More information

Pronestor Room & Catering

Pronestor Room & Catering Prnestr Rm Prnestr Rm & Catering Mdule 1 Technical requirements & installatin - Prnestr Rm & Catering Page 1.0 1.5 A guide t all the necessary server preparatins fr the installatin f Prnestr Rm & Catering.

More information

Regions File Transmission

Regions File Transmission Regins File Transmissin Getting Started with FTPS Regins Bank Member FDIC Revised 022113 It s time t expect mre. Table f Cntents Getting Started with FTPS Setting Up FTPS Cnnectin in FTP Client 3 4 9 Regins

More information

HSBC Online Home Loan Application Process

HSBC Online Home Loan Application Process HSBC Online Hme Lan Applicatin Prcess Versin 1.0 Nvember 2005 Cpyright. HSBC Bank Australia Limited 2005 ALL RIGHTS RESERVED N part f this publicatin may be reprduced, stred in a retrieval system, r transmitted,

More information