Protein Sequence Analysis - Overview -

Size: px
Start display at page:

Download "Protein Sequence Analysis - Overview -"

Transcription

1 Protein Sequence Analysis - Overview - UDEL Workshop Raja Mazumder Research Associate Professor, Department of Biochemistry and Molecular Biology Georgetown University Medical Center

2 Topics Why do protein sequence analysis? Searching sequence databases (similarity search) Post-processing search results Protein classification & function prediction. Detecting remote homologs Multiple sequence alignment and Phylogenetic analysis

3 Protein bioinformatics: protein sequence analysis Helps characterize protein sequences in silico and allows prediction of protein structure and function Statistically significant BLAST hits usually signifies sequence homology Homologous sequences may or may not have the same function but would always (very few exceptions) have the same structural fold Protein sequence analysis allows protein classification

4 Comparative protein sequence analysis and evolution Patterns of conservation in sequences allows us to determine which residues are under selective constraint (and thus likely important for protein function) Comparative analysis of proteins is more sensitive than comparing DNA Homologous proteins have a common ancestor Different proteins evolve at different rates Protein classification systems based on evolution: PIRSF and COG

5 Comparing proteins Amino acid sequence of protein generated from proteomics experiment e.g. protein fragment DTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT Amino-acids of two sequences can be aligned and we can easily count the number of identical residues (or use an index of similarity) as a measure of relatedness. Protein structures can be compared by superimposition

6 Protein sequence alignment Pairwise alignment a b a c d a b _ c d Multiple sequence alignment provides more information a b a c d a b _ c d x b a c e MSA difficult to do for distantly related proteins

7 Protein sequence analysis overview Protein databases PIR (pir.georgetown.edu) and UniProt ( Searching databases Peptide search, BLAST search, Text search Information retrieval and analysis Protein records at UniProt and PIR Multiple sequence alignment Secondary structure prediction Homology modeling

8 Query Sequence Unknown sequence is Q9I7I7 BLAST Q9I7I7 against the UniProt Knowledgebase ( Analyze results

9 BLAST results

10 SIR2_HUMAN protein record

11 Are Q9I7I7 and SIR2_HUMAN homologs? Check BLAST results Check pairwise alignment

12 Protein structure prediction Programs can predict secondary structure information with 70% accuracy Homology modeling - prediction of target structure from closely related template structure

13 Secondary structure prediction

14 Secondary structure prediction results

15 Sir2 structure

16 Homology modeling

17 Homology model of Q9I7I7 Blue - excellent Green - so so Red - not good Yellow - beta sheet Red - alpha helix Grey - loop

18 Sequence features: SIR2_HUMAN

19 Multiple sequence alignment

20 Multiple sequence alignment Q9I7I7, Q82QG9, SIR2_HUMAN

21 Identifying Remote Homologs

22 Function prediction

23 Function prediction

24 Molecular Phylogenetics and Evolution Overview History of phylogenetics Sequence analysis and classification Methods in phylogenetic analysis

25 Phylogenetics Field of biology that studies the evolutionary relationships between organisms, proteins or genes that share a common ancestor Phylogenetics includes the discovery (estimation) of these relationships, and the study of the causes behind this pattern Phylogenetics is related taxonomy

26 Tree of Life Aristotle (384 BC 322 BC), classified all living organisms as either a plant or an animal. Whittaker (1969), summarized the "Five Kingdoms" of life: animals, plants, fungi, protists ("protozoa"), and monera (bacteria). R. H. Whittaker, Science 163, 150 (1969) Zuckerkandl et al. (1965) forwarded the concept that sequences could be used to relate organisms. E. Zuckerkandl et al. Biol. 8, 357 (1965). Woese (1990) proposed "urkingdoms" or "domains": Eucarya (eukaryotes), Bacteria (initially called eubacteria), and Archaea (initially called archaebacteria). Woese et al.proc. Natl. Acad. Sci. U.S.A. 87, 4576 (1990). Norman R. Pace Science Vol

27 History of Phylogenetics Charles Darwin Author of The Origin of Species Ernst Haeckel Mapped a genealogical tree relating all animal life. Romanes's 1892 copy of Ernst Haeckel's allegedly fraudulent embryo drawings.

28 Monophyly, Paraphyly & Polyphyly Phylogenetics Wikipedia

29 Molecular Phylogenetics Morphological or organismal character evolution not as consistent compared to molecular evolution Can be used to study any organism Rates of evolution can be studied in greater detail Abundant data available

30 Evolutionary Change in DNA Several models have been proposed to study the mechanisms of DNA evolution Jukes and Cantor s One- Parameter Model assumes no bias in the direction of change so the substitution occur randomly among four types of nucleotides. Kimura s Two-Parameter model transitions are generally more frequent than transversions. The rate of transitional substitution is different than the rate of transversional substitution Rate of change is dependent upon the rate of substitution and pattern of substitution A C T G A > C > T A C > G G T > A A A > C > T C G C Ancestral sequence A C T G A A C G T A A C G C A C > A T G A A C > A G T > A A A > T C G C > T > C Sequence 1 Sequence 2 Single substitution Multiple substitution Coincidental substitution Parallel substitution Convergent substitution Back substitution From Li and Graur 1991

31 Evolutionary Change in Protein Synonymous and nonsynonymous substitutions: Substitutions that result in amino acid replacements are said to be nonsynonymous while substitutions that do not cause an amino acid replacement are said to be synonymous substitutions Changes within the same amino acid classes. Example, hydrophobic, charged, etc.

32 Tutorial Retrieve 1FSI (PDB id) sequence and related sequences from UniProtKB using BLAST Align all the sequences in Clustal (desktop version) Generate tree (using Clustal) View tree (

33 Representation Of Phylogeny The evolutionary relationship between two proteins can be represented in the form of a tree A phylogeny is a bifurcating tree with nodes and branches and a root (represents the common ancestor) clade Branch Protein 1a Node Root Protein 1b Protein 1c Protein 1d Homologous proteins

34 Terminology Clade A monophyletic taxon Taxon any named group of organisms; not necessarily a clade Branches branches connect nodes Nodes any bifurcating branch point

35 Common Phylogenetic Tree Layout rectangular cladogram slanted cladogram Phylogram (branch lengths proportional to distance) Radial 11

36 Rooted vs. Unrooted Phylogenies R unrooted rooted only relationships not the evolutionary path root (R) is the common ancestor

37 How to Construct A Phylogenetic Tree Construct a multiple sequence alignment Determine the substitution model Build tree Evaluate tree

38 Bootstrapping Bootstrapping is a resampling tree evaluation method A number associated with a particular branch in the tree that gives the proportion of bootstrap replicates that support the monophyly of the clade Two-step process generation of many new data sets from the original set and then the computation of a number that tells how often a particular branch appears in the tree

39 Distance - Neighbor-joining Method NJ algorithm commonly is applied with distance tree building The fully resolved tree is decomposed from a fully unresolved star tree by inserting branches between a pair of closest neighbors and the remaining terminals in the tree. The process is repeated. Rapid method.

40 Function Prediction From Evolutionary Classification Example PFK: Phosphofructokinase classification revealed that major functional specialization can occur as a result not only of major sequence changes but also by mutation of a single amino-acid residue. Families E. coli (P06998) Gly105 Gly125 Classification tree ATP_PFK_DR0635 ATP_PFK_euk PPi_PFK_PfpB PPi_PFK_TM0289 PPi_PFK_TP0108 PPi_PFK_SMc01852 ATP-PFK: Gly105 + Gly125 PPi-PFK: Gly/Asp105 + Lys125 PFK_XF0274

41 Contact Myself- UniProt- PIR-

Name: Class: Date: Multiple Choice Identify the choice that best completes the statement or answers the question.

Name: Class: Date: Multiple Choice Identify the choice that best completes the statement or answers the question. Name: Class: Date: Chapter 17 Practice Multiple Choice Identify the choice that best completes the statement or answers the question. 1. The correct order for the levels of Linnaeus's classification system,

More information

Introduction to Phylogenetic Analysis

Introduction to Phylogenetic Analysis Subjects of this lecture Introduction to Phylogenetic nalysis Irit Orr 1 Introducing some of the terminology of phylogenetics. 2 Introducing some of the most commonly used methods for phylogenetic analysis.

More information

Name Class Date. binomial nomenclature. MAIN IDEA: Linnaeus developed the scientific naming system still used today.

Name Class Date. binomial nomenclature. MAIN IDEA: Linnaeus developed the scientific naming system still used today. Section 1: The Linnaean System of Classification 17.1 Reading Guide KEY CONCEPT Organisms can be classified based on physical similarities. VOCABULARY taxonomy taxon binomial nomenclature genus MAIN IDEA:

More information

Introduction to Bioinformatics AS 250.265 Laboratory Assignment 6

Introduction to Bioinformatics AS 250.265 Laboratory Assignment 6 Introduction to Bioinformatics AS 250.265 Laboratory Assignment 6 In the last lab, you learned how to perform basic multiple sequence alignments. While useful in themselves for determining conserved residues

More information

4. Why are common names not good to use when classifying organisms? Give an example.

4. Why are common names not good to use when classifying organisms? Give an example. 1. Define taxonomy. Classification of organisms 2. Who was first to classify organisms? Aristotle 3. Explain Aristotle s taxonomy of organisms. Patterns of nature: looked like 4. Why are common names not

More information

Phylogenetic Trees Made Easy

Phylogenetic Trees Made Easy Phylogenetic Trees Made Easy A How-To Manual Fourth Edition Barry G. Hall University of Rochester, Emeritus and Bellingham Research Institute Sinauer Associates, Inc. Publishers Sunderland, Massachusetts

More information

Sequence Analysis 15: lecture 5. Substitution matrices Multiple sequence alignment

Sequence Analysis 15: lecture 5. Substitution matrices Multiple sequence alignment Sequence Analysis 15: lecture 5 Substitution matrices Multiple sequence alignment A teacher's dilemma To understand... Multiple sequence alignment Substitution matrices Phylogenetic trees You first need

More information

Core Bioinformatics. Degree Type Year Semester. 4313473 Bioinformàtica/Bioinformatics OB 0 1

Core Bioinformatics. Degree Type Year Semester. 4313473 Bioinformàtica/Bioinformatics OB 0 1 Core Bioinformatics 2014/2015 Code: 42397 ECTS Credits: 12 Degree Type Year Semester 4313473 Bioinformàtica/Bioinformatics OB 0 1 Contact Name: Sònia Casillas Viladerrams Email: [email protected]

More information

The Central Dogma of Molecular Biology

The Central Dogma of Molecular Biology Vierstraete Andy (version 1.01) 1/02/2000 -Page 1 - The Central Dogma of Molecular Biology Figure 1 : The Central Dogma of molecular biology. DNA contains the complete genetic information that defines

More information

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the

More information

Linear Sequence Analysis. 3-D Structure Analysis

Linear Sequence Analysis. 3-D Structure Analysis Linear Sequence Analysis What can you learn from a (single) protein sequence? Calculate it s physical properties Molecular weight (MW), isoelectric point (pi), amino acid content, hydropathy (hydrophilic

More information

Algorithms in Computational Biology (236522) spring 2007 Lecture #1

Algorithms in Computational Biology (236522) spring 2007 Lecture #1 Algorithms in Computational Biology (236522) spring 2007 Lecture #1 Lecturer: Shlomo Moran, Taub 639, tel 4363 Office hours: Tuesday 11:00-12:00/by appointment TA: Ilan Gronau, Taub 700, tel 4894 Office

More information

Guide for Bioinformatics Project Module 3

Guide for Bioinformatics Project Module 3 Structure- Based Evidence and Multiple Sequence Alignment In this module we will revisit some topics we started to look at while performing our BLAST search and looking at the CDD database in the first

More information

Visualization of Phylogenetic Trees and Metadata

Visualization of Phylogenetic Trees and Metadata Visualization of Phylogenetic Trees and Metadata November 27, 2015 Sample to Insight CLC bio, a QIAGEN Company Silkeborgvej 2 Prismet 8000 Aarhus C Denmark Telephone: +45 70 22 32 44 www.clcbio.com [email protected]

More information

Principles of Evolution - Origin of Species

Principles of Evolution - Origin of Species Theories of Organic Evolution X Multiple Centers of Creation (de Buffon) developed the concept of "centers of creation throughout the world organisms had arisen, which other species had evolved from X

More information

Maximum-Likelihood Estimation of Phylogeny from DNA Sequences When Substitution Rates Differ over Sites1

Maximum-Likelihood Estimation of Phylogeny from DNA Sequences When Substitution Rates Differ over Sites1 Maximum-Likelihood Estimation of Phylogeny from DNA Sequences When Substitution Rates Differ over Sites1 Ziheng Yang Department of Animal Science, Beijing Agricultural University Felsenstein s maximum-likelihood

More information

PHYLOGENETIC ANALYSIS

PHYLOGENETIC ANALYSIS Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Second Edition Andreas D. Baxevanis, B.F. Francis Ouellette Copyright 2001 John Wiley & Sons, Inc. ISBNs: 0-471-38390-2 (Hardback);

More information

Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011

Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011 Sequence Formats and Sequence Database Searches Gloria Rendon SC11 Education June, 2011 Sequence A is the primary structure of a biological molecule. It is a chain of residues that form a precise linear

More information

Bio-Informatics Lectures. A Short Introduction

Bio-Informatics Lectures. A Short Introduction Bio-Informatics Lectures A Short Introduction The History of Bioinformatics Sanger Sequencing PCR in presence of fluorescent, chain-terminating dideoxynucleotides Massively Parallel Sequencing Massively

More information

BIO 3350: ELEMENTS OF BIOINFORMATICS PARTIALLY ONLINE SYLLABUS

BIO 3350: ELEMENTS OF BIOINFORMATICS PARTIALLY ONLINE SYLLABUS BIO 3350: ELEMENTS OF BIOINFORMATICS PARTIALLY ONLINE SYLLABUS NEW YORK CITY COLLEGE OF TECHNOLOGY The City University Of New York School of Arts and Sciences Biological Sciences Department Course title:

More information

Introduction to Bioinformatics 3. DNA editing and contig assembly

Introduction to Bioinformatics 3. DNA editing and contig assembly Introduction to Bioinformatics 3. DNA editing and contig assembly Benjamin F. Matthews United States Department of Agriculture Soybean Genomics and Improvement Laboratory Beltsville, MD 20708 [email protected]

More information

Systematics - BIO 615

Systematics - BIO 615 Outline - and introduction to phylogenetic inference 1. Pre Lamarck, Pre Darwin Classification without phylogeny 2. Lamarck & Darwin to Hennig (et al.) Classification with phylogeny but without a reproducible

More information

Pairwise Sequence Alignment

Pairwise Sequence Alignment Pairwise Sequence Alignment [email protected] SS 2013 Outline Pairwise sequence alignment global - Needleman Wunsch Gotoh algorithm local - Smith Waterman algorithm BLAST - heuristics What

More information

Section 3 Comparative Genomics and Phylogenetics

Section 3 Comparative Genomics and Phylogenetics Section 3 Section 3 Comparative enomics and Phylogenetics At the end of this section you should be able to: Describe what is meant by DNA sequencing. Explain what is meant by Bioinformatics and Comparative

More information

Final Project Report

Final Project Report CPSC545 by Introduction to Data Mining Prof. Martin Schultz & Prof. Mark Gerstein Student Name: Yu Kor Hugo Lam Student ID : 904907866 Due Date : May 7, 2007 Introduction Final Project Report Pseudogenes

More information

BIOINFORMATICS TUTORIAL

BIOINFORMATICS TUTORIAL Bio 242 BIOINFORMATICS TUTORIAL Bio 242 α Amylase Lab Sequence Sequence Searches: BLAST Sequence Alignment: Clustal Omega 3d Structure & 3d Alignments DO NOT REMOVE FROM LAB. DO NOT WRITE IN THIS DOCUMENT.

More information

Lab 2/Phylogenetics/September 16, 2002 1 PHYLOGENETICS

Lab 2/Phylogenetics/September 16, 2002 1 PHYLOGENETICS Lab 2/Phylogenetics/September 16, 2002 1 Read: Tudge Chapter 2 PHYLOGENETICS Objective of the Lab: To understand how DNA and protein sequence information can be used to make comparisons and assess evolutionary

More information

17.1. The Tree of Life CHAPTER 17. Organisms can be classified based on physical similarities. Linnaean taxonomy. names.

17.1. The Tree of Life CHAPTER 17. Organisms can be classified based on physical similarities. Linnaean taxonomy. names. SECTION 17.1 THE LINNAEAN SYSTEM OF CLASSIFICATION Study Guide KEY CONCEPT Organisms can be classified based on physical similarities. VOCABULARY taxonomy taxon binomial nomenclature genus MAIN IDEA: Linnaeus

More information

Building a phylogenetic tree

Building a phylogenetic tree bioscience explained 134567 Wojciech Grajkowski Szkoła Festiwalu Nauki, ul. Ks. Trojdena 4, 02-109 Warszawa Building a phylogenetic tree Aim This activity shows how phylogenetic trees are constructed using

More information

KEY CONCEPT Organisms can be classified based on physical similarities. binomial nomenclature

KEY CONCEPT Organisms can be classified based on physical similarities. binomial nomenclature Section 17.1: The Linnaean System of Classification Unit 9 Study Guide KEY CONCEPT Organisms can be classified based on physical similarities. VOCABULARY taxonomy taxon binomial nomenclature genus MAIN

More information

Bioinformatics Grid - Enabled Tools For Biologists.

Bioinformatics Grid - Enabled Tools For Biologists. Bioinformatics Grid - Enabled Tools For Biologists. What is Grid-Enabled Tools (GET)? As number of data from the genomics and proteomics experiment increases. Problems arise for the current sequence analysis

More information

Taxonomy and Classification

Taxonomy and Classification Taxonomy and Classification Taxonomy = the science of naming and describing species Wisdom begins with calling things by their right names -Chinese Proverb museums contain ~ 2 Billion specimens worldwide

More information

WJEC AS Biology Biodiversity & Classification (2.1 All Organisms are related through their Evolutionary History)

WJEC AS Biology Biodiversity & Classification (2.1 All Organisms are related through their Evolutionary History) Name:.. Set:. Specification Points: WJEC AS Biology Biodiversity & Classification (2.1 All Organisms are related through their Evolutionary History) (a) Biodiversity is the number of different organisms

More information

Genome Explorer For Comparative Genome Analysis

Genome Explorer For Comparative Genome Analysis Genome Explorer For Comparative Genome Analysis Jenn Conn 1, Jo L. Dicks 1 and Ian N. Roberts 2 Abstract Genome Explorer brings together the tools required to build and compare phylogenies from both sequence

More information

Core Bioinformatics. Degree Type Year Semester

Core Bioinformatics. Degree Type Year Semester Core Bioinformatics 2015/2016 Code: 42397 ECTS Credits: 12 Degree Type Year Semester 4313473 Bioinformatics OB 0 1 Contact Name: Sònia Casillas Viladerrams Email: [email protected] Teachers Use of

More information

A Step-by-Step Tutorial: Divergence Time Estimation with Approximate Likelihood Calculation Using MCMCTREE in PAML

A Step-by-Step Tutorial: Divergence Time Estimation with Approximate Likelihood Calculation Using MCMCTREE in PAML 9 June 2011 A Step-by-Step Tutorial: Divergence Time Estimation with Approximate Likelihood Calculation Using MCMCTREE in PAML by Jun Inoue, Mario dos Reis, and Ziheng Yang In this tutorial we will analyze

More information

AP Biology Essential Knowledge Student Diagnostic

AP Biology Essential Knowledge Student Diagnostic AP Biology Essential Knowledge Student Diagnostic Background The Essential Knowledge statements provided in the AP Biology Curriculum Framework are scientific claims describing phenomenon occurring in

More information

Name Class Date. Figure 13 1. 2. Which nucleotide in Figure 13 1 indicates the nucleic acid above is RNA? a. uracil c. cytosine b. guanine d.

Name Class Date. Figure 13 1. 2. Which nucleotide in Figure 13 1 indicates the nucleic acid above is RNA? a. uracil c. cytosine b. guanine d. 13 Multiple Choice RNA and Protein Synthesis Chapter Test A Write the letter that best answers the question or completes the statement on the line provided. 1. Which of the following are found in both

More information

Bayesian Phylogeny and Measures of Branch Support

Bayesian Phylogeny and Measures of Branch Support Bayesian Phylogeny and Measures of Branch Support Bayesian Statistics Imagine we have a bag containing 100 dice of which we know that 90 are fair and 10 are biased. The

More information

Protein Phylogenies and Signature Sequences: A Reappraisal of Evolutionary Relationships among Archaebacteria, Eubacteria, and Eukaryotes

Protein Phylogenies and Signature Sequences: A Reappraisal of Evolutionary Relationships among Archaebacteria, Eubacteria, and Eukaryotes MICROBIOLOGY AND MOLECULAR BIOLOGY REVIEWS, Dec. 1998, p. 1435 1491 Vol. 62, No. 4 1092-2172/98/$04.00 0 Copyright 1998, American Society for Microbiology. All Rights Reserved. Protein Phylogenies and

More information

Bioinformatics Resources at a Glance

Bioinformatics Resources at a Glance Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences

More information

Consensus alignment server for reliable comparative modeling with distant templates

Consensus alignment server for reliable comparative modeling with distant templates W50 W54 Nucleic Acids Research, 2004, Vol. 32, Web Server issue DOI: 10.1093/nar/gkh456 Consensus alignment server for reliable comparative modeling with distant templates Jahnavi C. Prasad 1, Sandor Vajda

More information

Phylogenetic Analysis using MapReduce Programming Model

Phylogenetic Analysis using MapReduce Programming Model 2015 IEEE International Parallel and Distributed Processing Symposium Workshops Phylogenetic Analysis using MapReduce Programming Model Siddesh G M, K G Srinivasa*, Ishank Mishra, Abhinav Anurag, Eklavya

More information

CD-HIT User s Guide. Last updated: April 5, 2010. http://cd-hit.org http://bioinformatics.org/cd-hit/

CD-HIT User s Guide. Last updated: April 5, 2010. http://cd-hit.org http://bioinformatics.org/cd-hit/ CD-HIT User s Guide Last updated: April 5, 2010 http://cd-hit.org http://bioinformatics.org/cd-hit/ Program developed by Weizhong Li s lab at UCSD http://weizhong-lab.ucsd.edu [email protected] 1. Introduction

More information

AS Biology Unit 2 Key Terms and Definitions. Make sure you use these terms when answering exam questions!

AS Biology Unit 2 Key Terms and Definitions. Make sure you use these terms when answering exam questions! AS Biology Unit 2 Key Terms and Definitions Make sure you use these terms when answering exam questions! Chapter 7 Variation 7.1 Random Sampling Sampling a population to eliminate bias e.g. grid square

More information

Activity IT S ALL RELATIVES The Role of DNA Evidence in Forensic Investigations

Activity IT S ALL RELATIVES The Role of DNA Evidence in Forensic Investigations Activity IT S ALL RELATIVES The Role of DNA Evidence in Forensic Investigations SCENARIO You have responded, as a result of a call from the police to the Coroner s Office, to the scene of the death of

More information

Biological Databases and Protein Sequence Analysis

Biological Databases and Protein Sequence Analysis Biological Databases and Protein Sequence Analysis Introduction M. Madan Babu, Center for Biotechnology, Anna University, Chennai 25, India Bioinformatics is the application of Information technology to

More information

Keywords: evolution, genomics, software, data mining, sequence alignment, distance, phylogenetics, selection

Keywords: evolution, genomics, software, data mining, sequence alignment, distance, phylogenetics, selection Sudhir Kumar has been Director of the Center for Evolutionary Functional Genomics in The Biodesign Institute at Arizona State University since 2002. His research interests include development of software,

More information

1. Over the past century, several scientists around the world have made the following observations:

1. Over the past century, several scientists around the world have made the following observations: Evolution Keystone Review 1. Over the past century, several scientists around the world have made the following observations: New mitochondria and plastids can only be generated by old mitochondria and

More information

PHYML Online: A Web Server for Fast Maximum Likelihood-Based Phylogenetic Inference

PHYML Online: A Web Server for Fast Maximum Likelihood-Based Phylogenetic Inference PHYML Online: A Web Server for Fast Maximum Likelihood-Based Phylogenetic Inference Stephane Guindon, F. Le Thiec, Patrice Duroux, Olivier Gascuel To cite this version: Stephane Guindon, F. Le Thiec, Patrice

More information

Worksheet - COMPARATIVE MAPPING 1

Worksheet - COMPARATIVE MAPPING 1 Worksheet - COMPARATIVE MAPPING 1 The arrangement of genes and other DNA markers is compared between species in Comparative genome mapping. As early as 1915, the geneticist J.B.S Haldane reported that

More information

Protein & DNA Sequence Analysis. Bobbie-Jo Webb-Robertson May 3, 2004

Protein & DNA Sequence Analysis. Bobbie-Jo Webb-Robertson May 3, 2004 Protein & DNA Sequence Analysis Bobbie-Jo Webb-Robertson May 3, 2004 Sequence Analysis Anything connected to identifying higher biological meaning out of raw sequence data. 2 Genomic & Proteomic Data Sequence

More information

Name: Date: Problem How do amino acid sequences provide evidence for evolution? Procedure Part A: Comparing Amino Acid Sequences

Name: Date: Problem How do amino acid sequences provide evidence for evolution? Procedure Part A: Comparing Amino Acid Sequences Name: Date: Amino Acid Sequences and Evolutionary Relationships Introduction Homologous structures those structures thought to have a common origin but not necessarily a common function provide some of

More information

DNA Sequence Alignment Analysis

DNA Sequence Alignment Analysis Analysis of DNA sequence data p. 1 Analysis of DNA sequence data using MEGA and DNAsp. Analysis of two genes from the X and Y chromosomes of plant species from the genus Silene The first two computer classes

More information

Rapid alignment methods: FASTA and BLAST. p The biological problem p Search strategies p FASTA p BLAST

Rapid alignment methods: FASTA and BLAST. p The biological problem p Search strategies p FASTA p BLAST Rapid alignment methods: FASTA and BLAST p The biological problem p Search strategies p FASTA p BLAST 257 BLAST: Basic Local Alignment Search Tool p BLAST (Altschul et al., 1990) and its variants are some

More information

Break down material outside their body and then absorb the nutrients. Most are single-celled organisms Usually green. Do not have nuclei

Break down material outside their body and then absorb the nutrients. Most are single-celled organisms Usually green. Do not have nuclei Name Date Class CHAPTER 9 REINFORCEMENT WORKSHEET Keys to the Kingdom Complete this worksheet after you have finished reading Chapter 9, Section 2. Patty dropped her notes while she was studying the six

More information

PROC. CAIRO INTERNATIONAL BIOMEDICAL ENGINEERING CONFERENCE 2006 1. E-mail: [email protected]

PROC. CAIRO INTERNATIONAL BIOMEDICAL ENGINEERING CONFERENCE 2006 1. E-mail: msm_eng@k-space.org BIOINFTool: Bioinformatics and sequence data analysis in molecular biology using Matlab Mai S. Mabrouk 1, Marwa Hamdy 2, Marwa Mamdouh 2, Marwa Aboelfotoh 2,Yasser M. Kadah 2 1 Biomedical Engineering Department,

More information

THREE DIMENSIONAL REPRESENTATION OF AMINO ACID CHARAC- TERISTICS

THREE DIMENSIONAL REPRESENTATION OF AMINO ACID CHARAC- TERISTICS THREE DIMENSIONAL REPRESENTATION OF AMINO ACID CHARAC- TERISTICS O.U. Sezerman 1, R. Islamaj 2, E. Alpaydin 2 1 Laborotory of Computational Biology, Sabancı University, Istanbul, Turkey. 2 Computer Engineering

More information

MASCOT Search Results Interpretation

MASCOT Search Results Interpretation The Mascot protein identification program (Matrix Science, Ltd.) uses statistical methods to assess the validity of a match. MS/MS data is not ideal. That is, there are unassignable peaks (noise) and usually

More information

Computational Systems Biology. Lecture 2: Enzymes

Computational Systems Biology. Lecture 2: Enzymes Computational Systems Biology Lecture 2: Enzymes 1 Images from: David L. Nelson, Lehninger Principles of Biochemistry, IV Edition, Freeman ed. or under creative commons license (search for images at http://search.creativecommons.org/)

More information

Theory of Evolution. A. the beginning of life B. the evolution of eukaryotes C. the evolution of archaebacteria D. the beginning of terrestrial life

Theory of Evolution. A. the beginning of life B. the evolution of eukaryotes C. the evolution of archaebacteria D. the beginning of terrestrial life Theory of Evolution 1. In 1966, American biologist Lynn Margulis proposed the theory of endosymbiosis, or the idea that mitochondria are the descendents of symbiotic, aerobic eubacteria. What does the

More information

Genomes and SNPs in Malaria and Sickle Cell Anemia

Genomes and SNPs in Malaria and Sickle Cell Anemia Genomes and SNPs in Malaria and Sickle Cell Anemia Introduction to Genome Browsing with Ensembl Ensembl The vast amount of information in biological databases today demands a way of organising and accessing

More information

Module 10: Bioinformatics

Module 10: Bioinformatics Module 10: Bioinformatics 1.) Goal: To understand the general approaches for basic in silico (computer) analysis of DNA- and protein sequences. We are going to discuss sequence formatting required prior

More information

2.3 Identify rrna sequences in DNA

2.3 Identify rrna sequences in DNA 2.3 Identify rrna sequences in DNA For identifying rrna sequences in DNA we will use rnammer, a program that implements an algorithm designed to find rrna sequences in DNA [5]. The program was made by

More information

Evidence for evolution factsheet

Evidence for evolution factsheet The theory of evolution by natural selection is supported by a great deal of evidence. Fossils Fossils are formed when organisms become buried in sediments, causing little decomposition of the organism.

More information

EMBL-EBI Web Services

EMBL-EBI Web Services EMBL-EBI Web Services Rodrigo Lopez Head of the External Services Team SME Workshop Piemonte 2011 EBI is an Outstation of the European Molecular Biology Laboratory. Summary Introduction The JDispatcher

More information

MAKING AN EVOLUTIONARY TREE

MAKING AN EVOLUTIONARY TREE Student manual MAKING AN EVOLUTIONARY TREE THEORY The relationship between different species can be derived from different information sources. The connection between species may turn out by similarities

More information

Just the Facts: A Basic Introduction to the Science Underlying NCBI Resources

Just the Facts: A Basic Introduction to the Science Underlying NCBI Resources 1 of 8 11/7/2004 11:00 AM National Center for Biotechnology Information About NCBI NCBI at a Glance A Science Primer Human Genome Resources Model Organisms Guide Outreach and Education Databases and Tools

More information

Amazing DNA facts. Hands-on DNA: A Question of Taste Amazing facts and quiz questions

Amazing DNA facts. Hands-on DNA: A Question of Taste Amazing facts and quiz questions Amazing DNA facts These facts can form the basis of a quiz (for example, how many base pairs are there in the human genome?). Students should be familiar with most of this material, so the quiz could be

More information

Bioinformatics: course introduction

Bioinformatics: course introduction Bioinformatics: course introduction Filip Železný Czech Technical University in Prague Faculty of Electrical Engineering Department of Cybernetics Intelligent Data Analysis lab http://ida.felk.cvut.cz

More information

Network Protocol Analysis using Bioinformatics Algorithms

Network Protocol Analysis using Bioinformatics Algorithms Network Protocol Analysis using Bioinformatics Algorithms Marshall A. Beddoe [email protected] ABSTRACT Network protocol analysis is currently performed by hand using only intuition and a protocol

More information

Data for phylogenetic analysis

Data for phylogenetic analysis Data for phylogenetic analysis The data that are used to estimate the phylogeny of a set of tips are the characteristics of those tips. Therefore the success of phylogenetic inference depends in large

More information

Introduction to Proteins and Enzymes

Introduction to Proteins and Enzymes Introduction to Proteins and Enzymes Basics of protein structure and composition The life of a protein Enzymes Theory of enzyme function Not all enzymes are proteins / not all proteins are enzymes Enzyme

More information

Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism )

Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism ) Biology 1406 Exam 3 Notes Structure of DNA Ch. 10 Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism ) Proteins

More information

DNA Replication & Protein Synthesis. This isn t a baaaaaaaddd chapter!!!

DNA Replication & Protein Synthesis. This isn t a baaaaaaaddd chapter!!! DNA Replication & Protein Synthesis This isn t a baaaaaaaddd chapter!!! The Discovery of DNA s Structure Watson and Crick s discovery of DNA s structure was based on almost fifty years of research by other

More information

Bioinformatics for Biologists. Protein Structure

Bioinformatics for Biologists. Protein Structure Bioinformatics for Biologists Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research

More information

LESSON 9. Analyzing DNA Sequences and DNA Barcoding. Introduction. Learning Objectives

LESSON 9. Analyzing DNA Sequences and DNA Barcoding. Introduction. Learning Objectives 9 Analyzing DNA Sequences and DNA Barcoding Introduction DNA sequencing is performed by scientists in many different fields of biology. Many bioinformatics programs are used during the process of analyzing

More information

Molecular Databases and Tools

Molecular Databases and Tools NWeHealth, The University of Manchester Molecular Databases and Tools Afternoon Session: NCBI/EBI resources, pairwise alignment, BLAST, multiple sequence alignment and primer finding. Dr. Georgina Moulton

More information

Amino Acids. Amino acids are the building blocks of proteins. All AA s have the same basic structure: Side Chain. Alpha Carbon. Carboxyl. Group.

Amino Acids. Amino acids are the building blocks of proteins. All AA s have the same basic structure: Side Chain. Alpha Carbon. Carboxyl. Group. Protein Structure Amino Acids Amino acids are the building blocks of proteins. All AA s have the same basic structure: Side Chain Alpha Carbon Amino Group Carboxyl Group Amino Acid Properties There are

More information

A comparison of methods for estimating the transition:transversion ratio from DNA sequences

A comparison of methods for estimating the transition:transversion ratio from DNA sequences Molecular Phylogenetics and Evolution 32 (2004) 495 503 MOLECULAR PHYLOGENETICS AND EVOLUTION www.elsevier.com/locate/ympev A comparison of methods for estimating the transition:transversion ratio from

More information

Structure Tools and Visualization

Structure Tools and Visualization Structure Tools and Visualization Gary Van Domselaar University of Alberta [email protected] Slides Adapted from Michel Dumontier, Blueprint Initiative 1 Visualization & Communication Visualization

More information

Discovering Bioinformatics

Discovering Bioinformatics Discovering Bioinformatics Sami Khuri Natascha Khuri Alexander Picker Aidan Budd Sophie Chabanis-Davidson Julia Willingale-Theune English version ELLS European Learning Laboratory for the Life Sciences

More information

Protein annotation and modelling servers at University College London

Protein annotation and modelling servers at University College London Nucleic Acids Research Advance Access published May 27, 2010 Nucleic Acids Research, 2010, 1 6 doi:10.1093/nar/gkq427 Protein annotation and modelling servers at University College London D. W. A. Buchan*,

More information

Chapter 5: The Structure and Function of Large Biological Molecules

Chapter 5: The Structure and Function of Large Biological Molecules Name Period Concept 5.1 Macromolecules are polymers, built from monomers 1. The large molecules of all living things fall into just four main classes. Name them. 2. Circle the three classes that are called

More information

Amino Acids and Their Properties

Amino Acids and Their Properties Amino Acids and Their Properties Recap: ss-rrna and mutations Ribosomal RNA (rrna) evolves very slowly Much slower than proteins ss-rrna is typically used So by aligning ss-rrna of one organism with that

More information

Given these characteristics of life, which of the following objects is considered a living organism? W. X. Y. Z.

Given these characteristics of life, which of the following objects is considered a living organism? W. X. Y. Z. Cell Structure and Organization 1. All living things must possess certain characteristics. They are all composed of one or more cells. They can grow, reproduce, and pass their genes on to their offspring.

More information

Protein Protein Interaction Networks

Protein Protein Interaction Networks Functional Pattern Mining from Genome Scale Protein Protein Interaction Networks Young-Rae Cho, Ph.D. Assistant Professor Department of Computer Science Baylor University it My Definition of Bioinformatics

More information

Analyzing A DNA Sequence Chromatogram

Analyzing A DNA Sequence Chromatogram LESSON 9 HANDOUT Analyzing A DNA Sequence Chromatogram Student Researcher Background: DNA Analysis and FinchTV DNA sequence data can be used to answer many types of questions. Because DNA sequences differ

More information

II. Germ Layers Ontogeny can reveal a great deal about evolutionary relationships. Answer and discuss the following:

II. Germ Layers Ontogeny can reveal a great deal about evolutionary relationships. Answer and discuss the following: Workshop: The Evolution of Animalia by Dana Krempels Perhaps even more than the other Eukarya, Animalia is characterized by a distinct progression of complexity in form and function as one moves from the

More information

A CONTENT STANDARD IS NOT MET UNLESS APPLICABLE CHARACTERISTICS OF SCIENCE ARE ALSO ADDRESSED AT THE SAME TIME.

A CONTENT STANDARD IS NOT MET UNLESS APPLICABLE CHARACTERISTICS OF SCIENCE ARE ALSO ADDRESSED AT THE SAME TIME. Biology Curriculum The Georgia Performance Standards are designed to provide students with the knowledge and skills for proficiency in science. The Project 2061 s Benchmarks for Science Literacy is used

More information