Global and Discovery Proteomics Lecture Agenda

Size: px
Start display at page:

Download "Global and Discovery Proteomics Lecture Agenda"

Transcription

1 Global and Discovery Proteomics Christine A. Jelinek, Ph.D. Johns Hopkins University School of Medicine Department of Pharmacology and Molecular Sciences Middle Atlantic Mass Spectrometry Laboratory Global and Discovery Proteomics Lecture Agenda Genomics vs. Proteomics Discovery Proteomics: Basic Mass Spectrometry Techniques Discovery Proteomics: Basic Bioinformatic Techniques Database Searching: Mascot Sequest Combining Algorithms Cloud Computing 1

2 Human Genome Project Sequencing the human genome has transformed current biomedical research Human Genome Project Initiated : October 1990 Working Draft : 2000 Complete : 2003 Coding genes: 20,476 Non coding genes: 22,170 Pseudogenes: 13,322 Ensembl Current Totals Inferences about biological systems Completion of genome sequencing inspired corresponding approach to identify and characterize proteins comprising the human proteome Protein-Coding Genes Gregory, TR. Nature Reviews Genetics. 6, doi: /nrg1674 2

3 Proteomics A proteome consists of all proteins present in a sample (cell, tissue, body fluid, etc.) at a defined point in time and under defined conditions Proteomics is the large-scale study of the expression, localization, function, and interaction of proteins expressed by an organism s genome Proteomics Using Mass Spectrometry for Proteomics Experiments Surinova S. et al. J. Prot. Res :5-16 Over the last two decades, mass spectrometry-based technologies have undergone rapid advances and a high degree of innovation to fulfill the expectations of the proteomics and life science communities 3

4 Proteomics Using Mass Spectrometry for Proteomics Experiments Nagaraj N et al. Mol. Syst Biol :548 Schwanhäusser B et al. Nature : Beck M et al. Mol. Syst. Biol :549 Leading mass spectrometry-based proteomics laboratories have demonstrated that protein products of up to ~10,000 of the ~20,000 protein-coding human genes can be identified and quantified in a single experimental system The -omics Iceberg 4

5 Human Plasma Proteome A case of the -omics Iceberg Anderson N L, Anderson N G Mol Cell Proteomics 2002;1: Challenges in Proteomics Aebersold R.Nature Methods. 6: doi: /nmeth.f.255 5

6 Shotgun Proteomics Bottom-Up Proteomics General procedure using LC-MS/MS for proteomic profiling Aebersold R and Mann M. Nature : Sample Preparation Proteins Peptides HPLC-MS/MS Analysis Statistical Analysis Bioinformatics MS Data MS/MS Data 6

7 Bottom-Up Proteomics Common Sample Preparative Steps Bottom-Up Proteomics General procedure using LC-MS/MS for proteomic profiling Aebersold R and Mann M. Nature : Sample Preparation Proteins Peptides HPLC-MS/MS Analysis Statistical Analysis Bioinformatics MS Data MS/MS Data 7

8 Commonly used Enzymes Bottom-up Mass Spectrometry Bottom-Up Proteomics General procedure using LC-MS/MS for proteomic profiling Aebersold R and Mann M. Nature : Sample Preparation Proteins Peptides HPLC-MS/MS Analysis Statistical Analysis Bioinformatics MS Data MS/MS Data 8

9 Bottom-Up Proteomics Data-Dependent Tandem Mass Spectrometry Tandem MS/MS Scans Fourier transformed MS Scan Fragmentation A B C Bottom-Up Proteomics Data-Dependent Tandem Mass Spectrometry 9

10 Bottom-Up Proteomics Peptide Fragmentation Biomed. Mass Spectrom. 11 (11): 601. doi: /bms Bottom-Up Proteomics Peptide Fragmentation 10

11 Bottom-Up Proteomics Identifying Post-Translational Modifications Technical Limitations: LOD Data Dependent Mass Spectrometry 11

12 Technical Limitations: LOD Data Dependent Mass Spectrometry Ghaemmaghami S. et al. Nature : Technical Limitations: Dynamic Range Data Dependent Mass Spectrometry Smith R. et al. Advances in Protein Chemistry :

13 Technical Limitations: Sampling Data Dependent Mass Spectrometry Michalski A., Cox J., and Mann M. J. Proteome Res. 10, Bottom-Up Proteomics General procedure using LC-MS/MS for proteomic profiling Aebersold R and Mann M. Nature : Sample Preparation Proteins Peptides HPLC-MS/MS Analysis Statistical Analysis Bioinformatics MS Data MS/MS Data 13

14 m/z 11/9/2012 Bottom-Up Proteomics Protein and Peptide Identification Protein Tryptic Peptides Experimental Mass Spectrum BSA_500fmol_02_ #1854 RT: AV: 1 NL: 1.91E3 T: ITMS + c NSI d Full ms @cid35.00 [ ] Relative Abundance Protein Sequence SEMHIKHYTTKILGFREE GDSCPLKQWDDSKILVAV ADKLLEYEEKILLFNSAKY LLDESSTYKLMHDDSV Theoretical Tryptic Peptides SEMHIKHYTTK ILGFR EEGDSCPLK QWDDSK ILVAVADK LLEYEEK ILLFNSAK YLLDESSTYK LMHDDSV Theoretical Mass Spectrum Bioinformatics Resources Protein and Peptide Identification 14

15 Database Searching Database Search Algorithms Protein and Peptide Identification Protein Comparing raw MS/MS data with molecular sequence databases to indentify constituent proteins Peptide molecular masses Fragment ion mass & intensity values Protein/DNA sequence databases Search Engine Protein identification and characterization 15

16 Public Proteomic Databases MSDB: Comprehensive, non-identical protein sequence database maintained by the Proteomics Department at the Hammersmith Campus of Imperial College London NCBInr: Comprehensive, non-identical protein database maintained by NCBI. The entries have been compiled from GenBank CDS translations, PIR, SWISS-PROT, PRF, and PDB SwissProt: High quality, curetted protein database dbest: Division of GenBank containing "single-pass" cdna sequences, or Expressed Sequence Tags ThermoFisher Public Proteomic Databases Uniprot FASTA file >gi gb AAD cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYV LPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHE TGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEW YFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQP VEYPYTIIGQMASILYFSIILAFLPIAGX IENY 16

17 Mascot Search Algorithm MASCOT Software Protein and Peptide Identification Mascot combines 3 types of searches: Peptide Mass Fingerprinting MS/MS ions Sequence Query Searches against any FASTA database Unique, true probability based scoring Accepts mass spectrometry data from all leading instrument manufacturers High throughput format for single and multi- processor systems and clusters Automates search submission without custom programming Results summary of search results in web browser format Licensed be more than a thousand academic and commercial laboratories 17

18 Peptide Mass Fingerprinting (PMF) Peptide Identification using MASCOT Peptide Mass Fingerprinting (PMF) Peptide Identification using MASCOT 18

19 MS/MS Ion Searching Peptide Identification using MASCOT MS/MS Ion Searching Peptide Identification using MASCOT 19

20 Protein Identification using MASCOT Using MS and MS/MS spectra x Protein identified using both MS and MS/MS spectra Protein Identification using MASCOT Combining MS and MS/MS spectra 20

21 Protein Identification using MASCOT Combining MS and MS/MS spectra Protein Identification using MASCOT Interpreting Results ThermoFisher 21

22 Protein Identification using MASCOT Interpreting Results ThermoFisher Protein Identification using MASCOT Interpreting Results ThermoFisher 22

23 Protein Identification using MASCOT Interpreting Results ThermoFisher Protein Identification using MASCOT Common Settings for Search ThermoFisher 23

24 Protein Identification using MASCOT Common Settings for Search ThermoFisher Sequest Search Algorithm 24

25 Protein Identification using Sequest MS/MS spectra-based Identification Data Dependent Mass Spectral Scans: MS/MS depends on the MS Correlation Analysis >gi pir B27257 coagulogen II precursor - horseshoe crab (Tachypleus tridentatus)gi (X04192) coagulogen type II [Tachypleus tridentatus]gi gnl PID d (D00077) coagulogen type 2 [Tachypleus tridentatus]gi prf A coagulogen [Tachypleus sp.] [MASS=21826] MEKKLFGIALLLTTVASVLAADTNAPICLCDEPGVLGRTQIV TTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHPVFREC GKYECRTVRPEHSRCYNFPPFIHFKSECPVSTRDCEPVFGYT VAGEFRVIVQAPRAGFRQCVWQHKCRFGSNSCGYNGRC TQQRSVVRLVTYNLEKDGFLCESFRTCCGCPCRSF >gi sp P28175 LFC_TACTR LIMULUS FASTA Protein Database Protein / Peptide / Modification Identification Protein Identification using Sequest Sequest Search Workflow 25

26 Protein Identification using Sequest Sequest Search Parameters Extraction Parameters Search Parameters Modifications Comparing Algorithms Mascot vs. Sequest 26

27 Comparing Algorithms Mascot vs. Sequest Data file format ThermoFisher Proteome Discoverer Software 27

28 Combining Algorithms Mascot and Sequest using Proteome Discoverer ThermoFisher Combining Algorithms Mascot and Sequest using Proteome Discoverer ThermoFisher 28

29 Proteome Discoverer Interpreting Results ThermoFisher Proteome Discoverer Interpreting Results ThermoFisher 29

30 Proteome Discoverer Interpreting Results ThermoFisher Proteome Discoverer Interpreting Results ThermoFisher 30

31 Cloud Computing Strategies Cloud Computing OLD 40:00:00 NEW 01:00:00 31

32 Combining Bioinformatic Tools Integrated Analysis Inc. Pass Software Convert MS. (.mzxml,.mgf,.mzml) FASTA. Merger Create Decoy. FASTA Peptide Prophet. Isobaric Labeled. Quantitation Refine & Merge. Results OMSSA. X! Tandem. Custom Protein Prophet. Custom Algorithms. Combining Bioinformatic Tools Customizing Bioinformatic Workflows High Resolution MS OMSSA and X!Tandem Merge FASTA Create Reverse Sequence Convert MS 32

Aiping Lu. Key Laboratory of System Biology Chinese Academic Society [email protected]

Aiping Lu. Key Laboratory of System Biology Chinese Academic Society APLV@sibs.ac.cn Aiping Lu Key Laboratory of System Biology Chinese Academic Society [email protected] Proteome and Proteomics PROTEin complement expressed by genome Marc Wilkins Electrophoresis. 1995. 16(7):1090-4. proteomics

More information

Tutorial for Proteomics Data Submission. Katalin F. Medzihradszky Robert J. Chalkley UCSF

Tutorial for Proteomics Data Submission. Katalin F. Medzihradszky Robert J. Chalkley UCSF Tutorial for Proteomics Data Submission Katalin F. Medzihradszky Robert J. Chalkley UCSF Why Have Guidelines? Large-scale proteomics studies create huge amounts of data. It is impossible/impractical to

More information

泛 用 蛋 白 質 體 學 之 質 譜 儀 資 料 分 析 平 台 的 建 立 與 應 用 Universal Mass Spectrometry Data Analysis Platform for Quantitative and Qualitative Proteomics

泛 用 蛋 白 質 體 學 之 質 譜 儀 資 料 分 析 平 台 的 建 立 與 應 用 Universal Mass Spectrometry Data Analysis Platform for Quantitative and Qualitative Proteomics 泛 用 蛋 白 質 體 學 之 質 譜 儀 資 料 分 析 平 台 的 建 立 與 應 用 Universal Mass Spectrometry Data Analysis Platform for Quantitative and Qualitative Proteomics 2014 Training Course Wei-Hung Chang ( 張 瑋 宏 ) ABRC, Academia

More information

ProteinScape. Innovation with Integrity. Proteomics Data Analysis & Management. Mass Spectrometry

ProteinScape. Innovation with Integrity. Proteomics Data Analysis & Management. Mass Spectrometry ProteinScape Proteomics Data Analysis & Management Innovation with Integrity Mass Spectrometry ProteinScape a Virtual Environment for Successful Proteomics To overcome the growing complexity of proteomics

More information

Session 1. Course Presentation: Mass spectrometry-based proteomics for molecular and cellular biologists

Session 1. Course Presentation: Mass spectrometry-based proteomics for molecular and cellular biologists Program Overview Session 1. Course Presentation: Mass spectrometry-based proteomics for molecular and cellular biologists Session 2. Principles of Mass Spectrometry Session 3. Mass spectrometry based proteomics

More information

Quantitative proteomics background

Quantitative proteomics background Proteomics data analysis seminar Quantitative proteomics and transcriptomics of anaerobic and aerobic yeast cultures reveals post transcriptional regulation of key cellular processes de Groot, M., Daran

More information

Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance?

Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance? Optimization 1 Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance? Where to begin? 2 Sequence Databases Swiss-prot MSDB, NCBI nr dbest Species specific ORFS

More information

Error Tolerant Searching of Uninterpreted MS/MS Data

Error Tolerant Searching of Uninterpreted MS/MS Data Error Tolerant Searching of Uninterpreted MS/MS Data 1 In any search of a large LC-MS/MS dataset 2 There are always a number of spectra which get poor scores, or even no match at all. 3 Sometimes, this

More information

Application Note # LCMS-81 Introducing New Proteomics Acquisiton Strategies with the compact Towards the Universal Proteomics Acquisition Method

Application Note # LCMS-81 Introducing New Proteomics Acquisiton Strategies with the compact Towards the Universal Proteomics Acquisition Method Application Note # LCMS-81 Introducing New Proteomics Acquisiton Strategies with the compact Towards the Universal Proteomics Acquisition Method Introduction During the last decade, the complexity of samples

More information

Searching Nucleotide Databases

Searching Nucleotide Databases Searching Nucleotide Databases 1 When we search a nucleic acid databases, Mascot always performs a 6 frame translation on the fly. That is, 3 reading frames from the forward strand and 3 reading frames

More information

Chapter 14. Modeling Experimental Design for Proteomics. Jan Eriksson and David Fenyö. Abstract. 1. Introduction

Chapter 14. Modeling Experimental Design for Proteomics. Jan Eriksson and David Fenyö. Abstract. 1. Introduction Chapter Modeling Experimental Design for Proteomics Jan Eriksson and David Fenyö Abstract The complexity of proteomes makes good experimental design essential for their successful investigation. Here,

More information

Interpretation of MS-Based Proteomics Data

Interpretation of MS-Based Proteomics Data Interpretation of MS-Based Proteomics Data Yet-Ran Chen, 陳 逸 然 Agricultural Biotechnology Research Center Academia Sinica Brief Overview of Protein Identification Workflow Protein Sample Specific Protein

More information

PeptidomicsDB: a new platform for sharing MS/MS data.

PeptidomicsDB: a new platform for sharing MS/MS data. PeptidomicsDB: a new platform for sharing MS/MS data. Federica Viti, Ivan Merelli, Dario Di Silvestre, Pietro Brunetti, Luciano Milanesi, Pierluigi Mauri NETTAB2010 Napoli, 01/12/2010 Mass Spectrometry

More information

MRMPilot Software: Accelerating MRM Assay Development for Targeted Quantitative Proteomics

MRMPilot Software: Accelerating MRM Assay Development for Targeted Quantitative Proteomics MRMPilot Software: Accelerating MRM Assay Development for Targeted Quantitative Proteomics With Unique QTRAP and TripleTOF 5600 System Technology Targeted peptide quantification is a rapidly growing application

More information

Pep-Miner: A Novel Technology for Mass Spectrometry-Based Proteomics

Pep-Miner: A Novel Technology for Mass Spectrometry-Based Proteomics Pep-Miner: A Novel Technology for Mass Spectrometry-Based Proteomics Ilan Beer Haifa Research Lab Dec 10, 2002 Pep-Miner s Location in the Life Sciences World The post-genome era - the age of proteome

More information

Research-grade Targeted Proteomics Assay Development: PRMs for PTM Studies with Skyline or, How I learned to ditch the triple quad and love the QE

Research-grade Targeted Proteomics Assay Development: PRMs for PTM Studies with Skyline or, How I learned to ditch the triple quad and love the QE Research-grade Targeted Proteomics Assay Development: PRMs for PTM Studies with Skyline or, How I learned to ditch the triple quad and love the QE Jacob D. Jaffe Skyline Webinar July 2015 Proteomics and

More information

Proteomic Analysis using Accurate Mass Tags. Gordon Anderson PNNL January 4-5, 2005

Proteomic Analysis using Accurate Mass Tags. Gordon Anderson PNNL January 4-5, 2005 Proteomic Analysis using Accurate Mass Tags Gordon Anderson PNNL January 4-5, 2005 Outline Accurate Mass and Time Tag (AMT) based proteomics Instrumentation Data analysis Data management Challenges 2 Approach

More information

AB SCIEX TOF/TOF 4800 PLUS SYSTEM. Cost effective flexibility for your core needs

AB SCIEX TOF/TOF 4800 PLUS SYSTEM. Cost effective flexibility for your core needs AB SCIEX TOF/TOF 4800 PLUS SYSTEM Cost effective flexibility for your core needs AB SCIEX TOF/TOF 4800 PLUS SYSTEM It s just what you expect from the industry leader. The AB SCIEX 4800 Plus MALDI TOF/TOF

More information

Introduction to Proteomics 1.0

Introduction to Proteomics 1.0 Introduction to Proteomics 1.0 CMSP Workshop Tim Griffin Associate Professor, BMBB Faculty Director, CMSP Objectives Why are we here? For participants: Learn basics of MS-based proteomics Learn what s

More information

Proteomic data analysis for Orbitrap datasets using Resources available at MSI. September 28 th 2011 Pratik Jagtap

Proteomic data analysis for Orbitrap datasets using Resources available at MSI. September 28 th 2011 Pratik Jagtap Proteomic data analysis for Orbitrap datasets using Resources available at MSI. September 28 th 2011 Pratik Jagtap The Minnesota http://www.mass.msi.umn.edu/ Proteomics workflow Trypsin Protein Peptides

More information

Effects of Intelligent Data Acquisition and Fast Laser Speed on Analysis of Complex Protein Digests

Effects of Intelligent Data Acquisition and Fast Laser Speed on Analysis of Complex Protein Digests Effects of Intelligent Data Acquisition and Fast Laser Speed on Analysis of Complex Protein Digests AB SCIEX TOF/TOF 5800 System with DynamicExit Algorithm and ProteinPilot Software for Robust Protein

More information

ProSightPC 3.0 Quick Start Guide

ProSightPC 3.0 Quick Start Guide ProSightPC 3.0 Quick Start Guide The Thermo ProSightPC 3.0 application is the only proteomics software suite that effectively supports high-mass-accuracy MS/MS experiments performed on LTQ FT and LTQ Orbitrap

More information

La Protéomique : Etat de l art et perspectives

La Protéomique : Etat de l art et perspectives La Protéomique : Etat de l art et perspectives Odile Schiltz Institut de Pharmacologie et de Biologie Structurale CNRS, Université de Toulouse, [email protected] Protéomique et Spectrométrie de Masse

More information

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want 1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very

More information

Using Ontologies in Proteus for Modeling Data Mining Analysis of Proteomics Experiments

Using Ontologies in Proteus for Modeling Data Mining Analysis of Proteomics Experiments Using Ontologies in Proteus for Modeling Data Mining Analysis of Proteomics Experiments Mario Cannataro, Pietro Hiram Guzzi, Tommaso Mazza, and Pierangelo Veltri University Magna Græcia of Catanzaro, 88100

More information

Introduction to Proteomics

Introduction to Proteomics Introduction to Proteomics Åsa Wheelock, Ph.D. Division of Respiratory Medicine & Karolinska Biomics Center [email protected] In: Systems Biology and the Omics Cascade, Karolinska Institutet, June 9-13,

More information

The Scheduled MRM Algorithm Enables Intelligent Use of Retention Time During Multiple Reaction Monitoring

The Scheduled MRM Algorithm Enables Intelligent Use of Retention Time During Multiple Reaction Monitoring The Scheduled MRM Algorithm Enables Intelligent Use of Retention Time During Multiple Reaction Monitoring Delivering up to 2500 MRM Transitions per LC Run Christie Hunter 1, Brigitte Simons 2 1 AB SCIEX,

More information

Advantages of the LTQ Orbitrap for Protein Identification in Complex Digests

Advantages of the LTQ Orbitrap for Protein Identification in Complex Digests Application Note: 386 Advantages of the LTQ Orbitrap for Protein Identification in Complex Digests Rosa Viner, Terry Zhang, Scott Peterman, and Vlad Zabrouskov, Thermo Fisher Scientific, San Jose, CA,

More information

Introduction to mass spectrometry (MS) based proteomics and metabolomics

Introduction to mass spectrometry (MS) based proteomics and metabolomics Introduction to mass spectrometry (MS) based proteomics and metabolomics Tianwei Yu Department of Biostatistics and Bioinformatics Rollins School of Public Health Emory University September 10, 2015 Background

More information

Statistical Analysis Strategies for Shotgun Proteomics Data

Statistical Analysis Strategies for Shotgun Proteomics Data Statistical Analysis Strategies for Shotgun Proteomics Data Ming Li, Ph.D. Cancer Biostatistics Center Vanderbilt University Medical Center Ayers Institute Biomarker Pipeline normal shotgun proteome analysis

More information

Protein Prospector and Ways of Calculating Expectation Values

Protein Prospector and Ways of Calculating Expectation Values Protein Prospector and Ways of Calculating Expectation Values 1/16 Aenoch J. Lynn; Robert J. Chalkley; Peter R. Baker; Mark R. Segal; and Alma L. Burlingame University of California, San Francisco, San

More information

Challenges in Computational Analysis of Mass Spectrometry Data for Proteomics

Challenges in Computational Analysis of Mass Spectrometry Data for Proteomics Ma B. Challenges in computational analysis of mass spectrometry data for proteomics. SCIENCE AND TECHNOLOGY 25(1): 1 Jan. 2010 JOURNAL OF COMPUTER Challenges in Computational Analysis of Mass Spectrometry

More information

CPAS Overview. Josh Eckels LabKey Software [email protected]

CPAS Overview. Josh Eckels LabKey Software jeckels@labkey.com CPAS Overview Josh Eckels LabKey Software [email protected] CPAS Web-based system for processing, storing, and analyzing results of MS/MS experiments Key goals: Provide a great analysis front-end for

More information

ProteinPilot Report for ProteinPilot Software

ProteinPilot Report for ProteinPilot Software ProteinPilot Report for ProteinPilot Software Detailed Analysis of Protein Identification / Quantitation Results Automatically Sean L Seymour, Christie Hunter SCIEX, USA Pow erful mass spectrometers like

More information

Thermo Scientific PepFinder Software A New Paradigm for Peptide Mapping

Thermo Scientific PepFinder Software A New Paradigm for Peptide Mapping Thermo Scientific PepFinder Software A New Paradigm for Peptide Mapping For Conclusive Characterization of Biologics Deep Protein Characterization Is Crucial Pharmaceuticals have historically been small

More information

High Throughput Proteomics

High Throughput Proteomics High Throughput Proteomics 1 High throughput means... Continuous real-time searching of data Human scrutiny of results is not practical High throughput doesn t necessarily mean large scale. We would characterise

More information

A Primer of Genome Science THIRD

A Primer of Genome Science THIRD A Primer of Genome Science THIRD EDITION GREG GIBSON-SPENCER V. MUSE North Carolina State University Sinauer Associates, Inc. Publishers Sunderland, Massachusetts USA Contents Preface xi 1 Genome Projects:

More information

Introduction to Database Searching using MASCOT

Introduction to Database Searching using MASCOT Introduction to Database Searching using MASCOT 1 Three ways to use mass spectrometry data for protein identification 1.Peptide Mass Fingerprint A set of peptide molecular masses from an enzyme digest

More information

MultiQuant Software 2.0 for Targeted Protein / Peptide Quantification

MultiQuant Software 2.0 for Targeted Protein / Peptide Quantification MultiQuant Software 2.0 for Targeted Protein / Peptide Quantification Gold Standard for Quantitative Data Processing Because of the sensitivity, selectivity, speed and throughput at which MRM assays can

More information

BBSRC TECHNOLOGY STRATEGY: TECHNOLOGIES NEEDED BY RESEARCH KNOWLEDGE PROVIDERS

BBSRC TECHNOLOGY STRATEGY: TECHNOLOGIES NEEDED BY RESEARCH KNOWLEDGE PROVIDERS BBSRC TECHNOLOGY STRATEGY: TECHNOLOGIES NEEDED BY RESEARCH KNOWLEDGE PROVIDERS 1. The Technology Strategy sets out six areas where technological developments are required to push the frontiers of knowledge

More information

Increasing the Multiplexing of High Resolution Targeted Peptide Quantification Assays

Increasing the Multiplexing of High Resolution Targeted Peptide Quantification Assays Increasing the Multiplexing of High Resolution Targeted Peptide Quantification Assays Scheduled MRM HR Workflow on the TripleTOF Systems Jenny Albanese, Christie Hunter AB SCIEX, USA Targeted quantitative

More information

MaxQuant User s Guide Version 1.2.2.5

MaxQuant User s Guide Version 1.2.2.5 MaxQuant User s Guide Version 1.2.2.5 Jűrgen Cox and Matthias Mann Nature Biotechnology 26, 1367-1372 (2008) Sara ten Have 2012 http://www.lamondlab.com/ http://greproteomics.lifesci.dundee.ac.uk/ References

More information

BIOINF 525 Winter 2016 Foundations of Bioinformatics and Systems Biology http://tinyurl.com/bioinf525-w16

BIOINF 525 Winter 2016 Foundations of Bioinformatics and Systems Biology http://tinyurl.com/bioinf525-w16 Course Director: Dr. Barry Grant (DCM&B, [email protected]) Description: This is a three module course covering (1) Foundations of Bioinformatics, (2) Statistics in Bioinformatics, and (3) Systems

More information

Challenges and Opportunities in Proteomics Data Analysis*

Challenges and Opportunities in Proteomics Data Analysis* Perspectives Challenges and Opportunities in Proteomics Data Analysis* Bruno Domon and Ruedi Aebersold Accurate, consistent, and transparent data processing and analysis are integral and critical parts

More information

Master course KEMM03 Principles of Mass Spectrometric Protein Characterization. Exam

Master course KEMM03 Principles of Mass Spectrometric Protein Characterization. Exam Exam Master course KEMM03 Principles of Mass Spectrometric Protein Characterization 2010-10-29 kl 08.15-13.00 Use a new paper for answering each question! Write your name on each paper! Aids: Mini calculator,

More information

A Quadrupole-Orbitrap Hybrid Mass Spectrometer Offers Highest Benchtop Performance for In-Depth Analysis of Complex Proteomes

A Quadrupole-Orbitrap Hybrid Mass Spectrometer Offers Highest Benchtop Performance for In-Depth Analysis of Complex Proteomes A Quadrupole-Orbitrap Hybrid Mass Spectrometer Offers Highest Benchtop Performance for In-Depth Analysis of Complex Proteomes Zhiqi Hao 1, Yi Zhang 1, Shannon Eliuk 1, Justin Blethrow 1, Dave Horn 1, Vlad

More information

Preprocessing, Management, and Analysis of Mass Spectrometry Proteomics Data

Preprocessing, Management, and Analysis of Mass Spectrometry Proteomics Data Preprocessing, Management, and Analysis of Mass Spectrometry Proteomics Data M. Cannataro, P. H. Guzzi, T. Mazza, and P. Veltri Università Magna Græcia di Catanzaro, Italy 1 Introduction Mass Spectrometry

More information

Just the Facts: A Basic Introduction to the Science Underlying NCBI Resources

Just the Facts: A Basic Introduction to the Science Underlying NCBI Resources 1 of 8 11/7/2004 11:00 AM National Center for Biotechnology Information About NCBI NCBI at a Glance A Science Primer Human Genome Resources Model Organisms Guide Outreach and Education Databases and Tools

More information

Pinpointing phosphorylation sites using Selected Reaction Monitoring and Skyline

Pinpointing phosphorylation sites using Selected Reaction Monitoring and Skyline Pinpointing phosphorylation sites using Selected Reaction Monitoring and Skyline Christina Ludwig group of Ruedi Aebersold, ETH Zürich The challenge of phosphosite assignment Peptides Phosphopeptides MS/MS

More information

In-Depth Qualitative Analysis of Complex Proteomic Samples Using High Quality MS/MS at Fast Acquisition Rates

In-Depth Qualitative Analysis of Complex Proteomic Samples Using High Quality MS/MS at Fast Acquisition Rates In-Depth Qualitative Analysis of Complex Proteomic Samples Using High Quality MS/MS at Fast Acquisition Rates Using the Explore Workflow on the AB SCIEX TripleTOF 5600 System A major challenge in proteomics

More information

Tutorial 9: SWATH data analysis in Skyline

Tutorial 9: SWATH data analysis in Skyline Tutorial 9: SWATH data analysis in Skyline In this tutorial we will learn how to perform targeted post-acquisition analysis for protein identification and quantitation using a data-independent dataset

More information

Shotgun Proteomic Analysis. Department of Cell Biology The Scripps Research Institute

Shotgun Proteomic Analysis. Department of Cell Biology The Scripps Research Institute Shotgun Proteomic Analysis Department of Cell Biology The Scripps Research Institute Biological/Functional Resolution of Experiments Organelle Multiprotein Complex Cells/Tissues Function Expression Analysis

More information

Sub menu of functions to give the user overall information about the data in the file

Sub menu of functions to give the user overall information about the data in the file Visualize The Multitool for Proteomics! File Open Opens an.ez2 file to be examined. Import from TPP Imports data from files created by Trans Proteomic Pipeline. User chooses mzxml, pepxml and FASTA files

More information

AGILENT S BIOINFORMATICS ANALYSIS SOFTWARE

AGILENT S BIOINFORMATICS ANALYSIS SOFTWARE ACCELERATING PROGRESS IS IN OUR GENES AGILENT S BIOINFORMATICS ANALYSIS SOFTWARE GENESPRING GENE EXPRESSION (GX) MASS PROFILER PROFESSIONAL (MPP) PATHWAY ARCHITECT (PA) See Deeper. Reach Further. BIOINFORMATICS

More information

Mascot Search Results FAQ

Mascot Search Results FAQ Mascot Search Results FAQ 1 We had a presentation with this same title at our 2005 user meeting. So much has changed in the last 6 years that it seemed like a good idea to re-visit the topic. Just about

More information

The Open2Dprot Proteomics Project for n-dimensional Protein Expression Data Analysis

The Open2Dprot Proteomics Project for n-dimensional Protein Expression Data Analysis The Open2Dprot Proteomics Project for n-dimensional Protein Expression Data Analysis http://open2dprot.sourceforge.net/ Revised 2-05-2006 * (cf. 2D-LC) Introduction There is a need for integrated proteomics

More information

MASCOT Search Results Interpretation

MASCOT Search Results Interpretation The Mascot protein identification program (Matrix Science, Ltd.) uses statistical methods to assess the validity of a match. MS/MS data is not ideal. That is, there are unassignable peaks (noise) and usually

More information

Quan%ta%ve proteomics. Maarten Altelaar, 2014

Quan%ta%ve proteomics. Maarten Altelaar, 2014 Quan%ta%ve proteomics Maarten Altelaar, 2014 Proteomics Altelaar et al. Nat Rev Gen 14, 2013, 35-48 Quan%ta%ve proteomics Quan%ta%ve proteomics Control Diseased, s%mulated, Knock down, etc. How quan%ta%ve

More information

Absolute quantification of low abundance proteins by shotgun proteomics

Absolute quantification of low abundance proteins by shotgun proteomics Absolute quantification of low abundance proteins by shotgun proteomics Dr. Stefanie Wienkoop www.proteomefactory.com In cooperation with: Max-Planck-Institut für Molekulare Pflanzenphysiologie Stable

More information

Integrating Bioinformatics, Medical Sciences and Drug Discovery

Integrating Bioinformatics, Medical Sciences and Drug Discovery Integrating Bioinformatics, Medical Sciences and Drug Discovery M. Madan Babu Centre for Biotechnology, Anna University, Chennai - 600025 phone: 44-4332179 :: email: [email protected] Bioinformatics

More information

Un (bref) aperçu des méthodes et outils de fouilles et de visualisation de données «omics»

Un (bref) aperçu des méthodes et outils de fouilles et de visualisation de données «omics» Un (bref) aperçu des méthodes et outils de fouilles et de visualisation de données «omics» Workshop «Protéomique & Maladies rares» 25 th September 2012, Paris [email protected] CEA Grenoble irtsv

More information

Mass Spectrometry Based Proteomics

Mass Spectrometry Based Proteomics Mass Spectrometry Based Proteomics Proteomics Shared Research Oregon Health & Science University Portland, Oregon This document is designed to give a brief overview of Mass Spectrometry Based Proteomics

More information

HRMS in Clinical Research: from Targeted Quantification to Metabolomics

HRMS in Clinical Research: from Targeted Quantification to Metabolomics A sponsored whitepaper. HRMS in Clinical Research: from Targeted Quantification to Metabolomics By: Bertrand Rochat Ph. D., Research Project Leader, Faculté de Biologie et de Médecine of the Centre Hospitalier

More information

Mass Spectra Alignments and their Significance

Mass Spectra Alignments and their Significance Mass Spectra Alignments and their Significance Sebastian Böcker 1, Hans-Michael altenbach 2 1 Technische Fakultät, Universität Bielefeld 2 NRW Int l Graduate School in Bioinformatics and Genome Research,

More information

Computational analysis of unassigned high-quality MS/MS spectra in proteomic data sets

Computational analysis of unassigned high-quality MS/MS spectra in proteomic data sets 2712 DOI 10.1002/pmic.200900473 Proteomics 2010, 10, 2712 2718 TECHNICAL BRIEF Computational analysis of unassigned high-quality MS/MS spectra in proteomic data sets Kang Ning 1, Damian Fermin 1 and Alexey

More information

Introduction to Proteomics

Introduction to Proteomics Introduction to Proteomics Why Proteomics? Same Genome Different Proteome Black Swallowtail - larvae and butterfly Biological Complexity Yeast - a simple proteome 6,113 proteins = 344,855 tryptic peptides

More information

Biological Sequence Data Formats

Biological Sequence Data Formats Biological Sequence Data Formats Here we present three standard formats in which biological sequence data (DNA, RNA and protein) can be stored and presented. Raw Sequence: Data without description. FASTA

More information

FACULTY OF MEDICAL SCIENCE

FACULTY OF MEDICAL SCIENCE Doctor of Philosophy in Biochemistry FACULTY OF MEDICAL SCIENCE Naresuan University 73 Doctor of Philosophy in Biochemistry The Biochemistry Department at Naresuan University is a leader in lower northern

More information

CALIFORNIA STATE UNIVERSITY CHANNEL ISLANDS

CALIFORNIA STATE UNIVERSITY CHANNEL ISLANDS CALIFORNIA STATE UNIVERSITY CHANNEL ISLANDS PROGRAM MODIFICATION DATE: 12.06.06 PROGRAM AREA: BIOLOGY AND BUSINESS AND ECONOMICS SEMESTER /YEAR FIRST EFFECTED: FALL 2007 Please use the following format

More information

Ph.D. in Bioinformatics and Computational Biology Degree Requirements

Ph.D. in Bioinformatics and Computational Biology Degree Requirements Ph.D. in Bioinformatics and Computational Biology Degree Requirements Credits Students pursuing the doctoral degree in BCB must complete a minimum of 90 credits of relevant work beyond the bachelor s degree;

More information

A leader in the development and application of information technology to prevent and treat disease.

A leader in the development and application of information technology to prevent and treat disease. A leader in the development and application of information technology to prevent and treat disease. About MOLECULAR HEALTH Molecular Health was founded in 2004 with the vision of changing healthcare. Today

More information

MS Amanda Standalone User Manual

MS Amanda Standalone User Manual MS Amanda Standalone User Manual February 2014 Viktoria Dorfer, Peter Pichler, Stephan Winkler, and Karl Mechtler 1. Installation of MS Amanda Standalone In order to install MS Amanda Standalone please

More information

Accurate Mass Screening Workflows for the Analysis of Novel Psychoactive Substances

Accurate Mass Screening Workflows for the Analysis of Novel Psychoactive Substances Accurate Mass Screening Workflows for the Analysis of Novel Psychoactive Substances TripleTOF 5600 + LC/MS/MS System with MasterView Software Adrian M. Taylor AB Sciex Concord, Ontario (Canada) Overview

More information

Workshop IIc. Manual interpretation of MS/MS spectra. Ebbing de Jong. Center for Mass Spectrometry and Proteomics Phone (612)625-2280 (612)625-2279

Workshop IIc. Manual interpretation of MS/MS spectra. Ebbing de Jong. Center for Mass Spectrometry and Proteomics Phone (612)625-2280 (612)625-2279 Workshop IIc Manual interpretation of MS/MS spectra Ebbing de Jong Why MS/MS spectra? The information contained in an MS spectrum (m/z, isotope spacing and therefore z ) is not enough to tell us the amino

More information

Building innovative drug discovery alliances. Evotec Munich. Quantitative Proteomics to Support the Discovery & Development of Targeted Drugs

Building innovative drug discovery alliances. Evotec Munich. Quantitative Proteomics to Support the Discovery & Development of Targeted Drugs Building innovative drug discovery alliances Evotec Munich Quantitative Proteomics to Support the Discovery & Development of Targeted Drugs Evotec AG, Evotec Munich, June 2013 About Evotec Munich A leader

More information

Proteomics in Practice

Proteomics in Practice Reiner Westermeier, Torn Naven Hans-Rudolf Höpker Proteomics in Practice A Guide to Successful Experimental Design 2008 Wiley-VCH Verlag- Weinheim 978-3-527-31941-1 Preface Foreword XI XIII Abbreviations,

More information

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the

More information

SimGlycan Software*: A New Predictive Carbohydrate Analysis Tool for MS/MS Data

SimGlycan Software*: A New Predictive Carbohydrate Analysis Tool for MS/MS Data SimGlycan Software*: A New Predictive Carbohydrate Analysis Tool for MS/MS Data Automated Data Interpretation for Glycan Characterization Jenny Albanese 1, Matthias Glueckmann 2 and Christof Lenz 2 1 AB

More information

using ms based proteomics

using ms based proteomics quantification using ms based proteomics lennart martens Computational Omics and Systems Biology Group Department of Medical Protein Research, VIB Department of Biochemistry, Ghent University Ghent, Belgium

More information

Tutorial for proteome data analysis using the Perseus software platform

Tutorial for proteome data analysis using the Perseus software platform Tutorial for proteome data analysis using the Perseus software platform Laboratory of Mass Spectrometry, LNBio, CNPEM Tutorial version 1.0, January 2014. Note: This tutorial was written based on the information

More information

High-throughput Data Analysis of Proteomic Mass Spectra on the SwissBioGrid

High-throughput Data Analysis of Proteomic Mass Spectra on the SwissBioGrid High-throughput Data Analysis of Proteomic Mass Spectra on the SwissBioGrid Andreas Quandt 1, Sergio Maffioletti 2, Cesare Pautasso 3, Heinz Stockinger 1, Frederique Lisacek 1, Peter Kunszt 2 1) Swiss

More information

Database Searching Tutorial/Exercises Jimmy Eng

Database Searching Tutorial/Exercises Jimmy Eng Database Searching Tutorial/Exercises Jimmy Eng Use the PETUNIA interface to run a search and generate a pepxml file that is analyzed through the PepXML Viewer. This tutorial will walk you through the

More information

OplAnalyzer: A Toolbox for MALDI-TOF Mass Spectrometry Data Analysis

OplAnalyzer: A Toolbox for MALDI-TOF Mass Spectrometry Data Analysis OplAnalyzer: A Toolbox for MALDI-TOF Mass Spectrometry Data Analysis Thang V. Pham and Connie R. Jimenez OncoProteomics Laboratory, Cancer Center Amsterdam, VU University Medical Center De Boelelaan 1117,

More information

Per Andrén Dept. of Pharmaceutical Biosciences Medical Mass Spectrometry, Uppsala University, Uppsala, Sweden

Per Andrén Dept. of Pharmaceutical Biosciences Medical Mass Spectrometry, Uppsala University, Uppsala, Sweden Lung Imaging in Inhaled Product Development Novartis, Horsham, UK, 2011-11-09 Mapping Drug Deposition using Imaging Mass Spectrometry Per Andrén Dept. of Pharmaceutical Biosciences Medical Mass Spectrometry,

More information

MS/MS analysis of Polyphenols

MS/MS analysis of Polyphenols Purdue-UAB Botanicals Center for Age-Related Disease MS/MS analysis of Polyphenols Jeevan Prasain Ph.D. Pharmacology & Toxicology UAB Polyphenols H Caffeic acid Phenolic acids and derivatives H EGC (Flavanol)

More information

Learning Objectives:

Learning Objectives: Proteomics Methodology for LC-MS/MS Data Analysis Methodology for LC-MS/MS Data Analysis Peptide mass spectrum data of individual protein obtained from LC-MS/MS has to be analyzed for identification of

More information

Development of computational methods for analysing proteomic data for genome annotation

Development of computational methods for analysing proteomic data for genome annotation Development of computational methods for analysing proteomic data for genome annotation University of Cambridge Darwin College A thesis submitted for the degree of Doctor of Philosophy Markus Brosch The

More information

Using NIST Search with Agilent MassHunter Qualitative Analysis Software James Little, Eastman Chemical Company Sept 20, 2012.

Using NIST Search with Agilent MassHunter Qualitative Analysis Software James Little, Eastman Chemical Company Sept 20, 2012. Using NIST Search with Agilent MassHunter Qualitative Analysis Software James Little, Eastman Chemical Company Sept 20, 2012 Introduction Screen captures in this document were taken from MassHunter B.05.00

More information

Sharing Data from Large-scale Biological Research Projects: A System of Tripartite Responsibility

Sharing Data from Large-scale Biological Research Projects: A System of Tripartite Responsibility Sharing Data from Large-scale Biological Research Projects: A System of Tripartite Responsibility Report of a meeting organized by the Wellcome Trust and held on 14 15 January 2003 at Fort Lauderdale,

More information

How Can Institutions Foster OMICS Research While Protecting Patients?

How Can Institutions Foster OMICS Research While Protecting Patients? IOM Workshop on the Review of Omics-Based Tests for Predicting Patient Outcomes in Clinical Trials How Can Institutions Foster OMICS Research While Protecting Patients? E. Albert Reece, MD, PhD, MBA Vice

More information

Integrated design of antibodies for systems biology using AbDesigner

Integrated design of antibodies for systems biology using AbDesigner Integrated design of antibodies for systems biology using AbDesigner Trairak Pisitkun, MD Chulalongkorn University Systems Biology (CUSB) Center Epithelial Systems Biology Laboratory (ESBL), National Heart,

More information

Bruker ToxScreener TM. Innovation with Integrity. A Comprehensive Screening Solution for Forensic Toxicology UHR-TOF MS

Bruker ToxScreener TM. Innovation with Integrity. A Comprehensive Screening Solution for Forensic Toxicology UHR-TOF MS Bruker ToxScreener TM A Comprehensive Screening Solution for Forensic Toxicology Innovation with Integrity UHR-TOF MS ToxScreener - Get the Complete Picture Forensic laboratories are frequently required

More information

University of Glasgow - Programme Structure Summary C1G5-5100 MSc Bioinformatics, Polyomics and Systems Biology

University of Glasgow - Programme Structure Summary C1G5-5100 MSc Bioinformatics, Polyomics and Systems Biology University of Glasgow - Programme Structure Summary C1G5-5100 MSc Bioinformatics, Polyomics and Systems Biology Programme Structure - the MSc outcome will require 180 credits total (full-time only) - 60

More information

Comparing Methods for Identifying Transcription Factor Target Genes

Comparing Methods for Identifying Transcription Factor Target Genes Comparing Methods for Identifying Transcription Factor Target Genes Alena van Bömmel (R 3.3.73) Matthew Huska (R 3.3.18) Max Planck Institute for Molecular Genetics Folie 1 Transcriptional Regulation TF

More information