Databases indexation

Size: px
Start display at page:

Download "Databases indexation"

Transcription

1 Databases indexation Laurent Falquet, Basel October, 2006 Swiss Institute of Bioinformatics Swiss EMBnet node Overview Data access concept sequential direct Indexing EMBOSS Fetch Other BLAST Why indexing? formatdb Parsing output Excel import/export Tab delimited Coma delimited

2 Why indexing? Human tendency to classify and group Examples: Dictionnary Book Library DVD chapters ipod play lists Advantages: Fast access Easy data finding Disadvantages: Time to prepare indices Data access: sequential vs direct Sequential access Direct access Vary from very short to very long Very small variations track sector head

3 Similar concept for databases Flat files = sequential Indexing = simulated direct >seq1 cgatgtcatgtg >seq2 cgatcgtagctgtagctgtag >seq3 catgtgcatgcgacgt ID seq1 seq2 seq3 Position (byte) Length (byte) Tools EMBOSS dbxflat dbxfasta dbiblast seqret seqretsplit entret Other examples SRS (icarus language) indexer & fetch (warning local SIB tool) Relational (MySQL, Oracle ) Web (Google!!)

4 EMBOSS how to index? Where is your file? What is the format? Where should be the indices? Where is the emboss.default file? (.embossrc) Other EMBOSS tools textsearch Whichdb More details EMBOSS example Input file and directory ~/embossidx/ecoli.dat cd embossidx Index creation dbxflat -idformat swiss -dbname ecoli -filenames '*.dat' -dbresource swiss -directory. -release 1.0 -date 26/09/06 -fields id,acc Generates 5 files (default) ECOLI.ent ECOLI.pxac ECOLI.pxid ECOLI.xac ECOLI.xid Don t forget to modify ~/.embossrc

5 .embossrc setemboss_filter 1 # Ecoli DB ecoli[ type: P comment:"e.coli proteome" method: emboss format:swiss dir:"{path}/embossidx" file:"ecoli.dat" release:"1.0" indexdir:"{path}/embossidx" ] Example of queries seqret ecoli:thio_ecoli seqret ecoli:p00274 entret ecoli:thio_ecoli and even seqret ecoli:*_ecoli Where {path} is the path to your home directory Indexer & fetch Warning this is a local SIB tool!! Input file and directory ~/embossidx/ecoli.dat cd embossidx Index creation indexer -h '^ID' -t '^//' -i -p '^ID\s+(\S+)' ECOLI.dat ecoli.idx Generates 1 file ecoli.idx Don t forget to modify config file

6 Config file: fetch.conf fetch.conf #dbkey formatindexfiledatafile ecolisp ~/embossidx/ecoli.idx~/embossidx/ecoli.dat Example of queries fetch -c fetch.conf ecoli:thio_ecoli fetch -c fetch.conf -f ecoli:thio_ecoli[20..50] BLAST Maintained at NCBI Source distributed freely with several accessory tools ftp://ftp.ncbi.nlm.nih.gov/too lbox/ncbi_tools/ncbi.tar.gz May require compilation to install on your local computer blastall contains blastp blastn blastx tblastn tblastx Other tools blastpgp megablast formatdb

7 Available Blast programs Program Query Database blastp VS blastn nucleotide VS nucleotide blastx nucleotide VS tblastn nucleotide VS tblastx nucleotide nucleotide VS What makes BLAST so fast? Indexing all words of 3 aa or 11 bp in the sequence database Searching the query for all words of a score > T Search the indexed database for all perfect matches Try to align matches that are on the same diagonal

8 Indexing for Blast (1) A substitution matrix is used to compute the word scores Query REL LKP score > T AAA AAA AAC AAC AAD AAD... YYY YYY List of all possible words with 3 amino acid residues (8000) score < T LKP LKP ACT ACT TVF TVF List of words matching the query with a score > T Indexing for Blast (2) Database sequences ACT ACT ACT ACT TVF TVF Search for exact matches TVF TVF List of words matching the query with a score > T List List of of sequences sequences containing containing words words similar similar to to the the query query (hits) (hits)

9 Indexing for Blast (3) Database sequence Query A Ungapped extension if: 2 "Hits" are on the same diagonal but at a distance less than A Database sequence Query A Extension using dynamic programming limited to a restricted region limited through a score drop-off threshold BLAST indexing with formatdb Formatdb mydb.seq must contain sequences in FASTA format formatdb -i mydb.seq -p T -n mydb Generates 3 files mydb.psq mydb.pin mydb.phr Then start a Blast: blastall -p blastp -d mydb -i myseq (-optional parameters)

10 Blast local vs remote blastall Executed locally Slow No need to transfert db blastall.remote Executed remotely Fast Requires special priviledges and db transfert Using BioPerl (remoteblast.pm) Blast at NCBI No user db See Multiple Blasts? 1 seq vs db seq 1 FASTA seq as input db seq vs db seq Several single FASTA seq files as input or 1 Multiple FASTA seq file as input Possibility to export results as XML Use Perl to automatize the queries and parse the output

11 Parsing Blast output BLASTP [Oct ] Reference:Altschul,Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller,and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: anew generation of databasesearch programs", Nucleic Acids Res.25: Query= ACCA_BACSU O34847 Acetyl-coenzyme A carboxylasecarboxyl transferase subunitalpha (EC ). (325 letters) Database:ecoli_blast 4339 sequences; 1,373,039 totalletters Searching...done Score E Sequences producingsignificantalignments: (bits) Value ACCA_ECOLI P30867 Acetyl-coenzyme A carboxylasecarboxyltransfe e-72 Parsing Blast output (2) >ACCA_ECOLI P30867 Acetyl-coenzyme A carboxylasecarboxyl transferase subunitalpha (EC ). Length = 318 Score = 266 bits(681), Expect=1e-72 Identities= 143/312 (45%), Positives = 188/312 (60 %), Gaps = 3/312 (0%) Query:5 LEFEKPVIELQTKIAELKKFTQDS---DMDLSAEIERLEDRLAKLQDDIYKNLKPWDRVQ 61 L+FE+P+ EL+ KI L ++ D+++ E+ RL ++ +L I+ +L W Q Sbjct:5 LDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGA WQIAQ 64 Query:62 IARLADRPTTLDYIEHLFTDFFECHGDRAYGDDEAIVGGIAKFHGLPVTVIGHQRGKDTK 121 +AR RP TLDY+ F+F E GDRAY DD+AIVGGIA+ G PV +IGHQ+G++TK Sbjct:65 LARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPV MIIGHQKGRETK 124 Query:122 ENLVRNFGMPHPEGYRKALRLMKQADKFNRPIICFIDTKGAYPGRAAEERGQSEAIAKNL 181 E + RNFGMP PEGYRKALRLM+ A++F PII FIDT GAYPG AEERGQSEAIA+NL Sbjct:125 EKIRRNFGMPAPEGYRKALRLM Q MAERFKMPIITFIDTPGAYPGVGAEERGQSEAIARNL 184 Query:182 FEMAGLRVPXXXXXXXXXXXXXXXXXXXXXXXHMLENSTYSVISPEGAAALLWKDSSLAK 241 EM+ L VP +ML+ STYSVISPEG A++L WK + A Sbjct:185 REMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSADKAP 244 Query:242 KAAETMKITAPDLKELGIIDHMIKEVKGGAHHDVKLQASYMDXXXXXXXXXXXXXXXXXX 301 AAE M I AP LKEL +ID +I E GGAH + + A+ + Sbjct:245 LAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLADLDVLSTEDL 304 Query:302 VQQRYEKYKAIG 313 +RY++ + G Sbjct:305 KNRRYQRLMSYG 316

12 Parsing Blast output (3) With BioPerl: #!/usr/local/bin/perl use Bio::SearchIO; my $blast_report= new Bio::SearchIO ('-format'=>'blast', '-file' => $ARGV[0]); print "Query name:\tquery description:\thitname:\thitdescription:\te-value\tscore\n"; while( my $result=$blast_report->next_result){ print $result->query_name(),"\t",$result->query_description(),"\n"; while( my $hit= $result->next_hit()){ print "\t\t",$hit->name(),"\t",$hit->description(); while( my $hsp = $hit->next_hsp()){ print "\t",$hsp->evalue(),"\t", $hsp->score(); } print "\n"; } } exit0; MS-Excel import/export Excel can import Tab delimited Coma delimited Excel can export Tab delimited Space delimited AC/ID desc score e-value THIO_ECOLI thioredoxin Escherichia coli e-5 THIO_HUMAN thioredoxin Homo sapiens

13 MS-Excel import/export Tab delimited file: \t delimits the columns \n delimits the lines Optional first line contains columns title Example: AC/ID\tdesc\tscore\te-value\n THIO_ECOLI\tthioredoxin Escherichia coli\t234\t2.1e-5\n THIO_HU MAN\tthioredoxin Homo sapiens\t120\t0.001\n MS-Excel import/export Coma delimited file:, delimits the columns, each value is surrounded by \n delimits the lines Optional first line contains columns title Example: AC/ID, desc, score, e-value \n THIO_ECOLI, thioredoxin Escherichia coli, 234, 2.1e-5 \n THIO_HU M A N, thioredoxin Homo sapiens, 120, \n

Similarity Searches on Sequence Databases: BLAST, FASTA. Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Basel, October 2003

Similarity Searches on Sequence Databases: BLAST, FASTA. Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Basel, October 2003 Similarity Searches on Sequence Databases: BLAST, FASTA Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Basel, October 2003 Outline Importance of Similarity Heuristic Sequence Alignment:

More information

Algorithms in Bioinformatics I, WS06/07, C.Dieterich 47. This lecture is based on the following, which are all recommended reading:

Algorithms in Bioinformatics I, WS06/07, C.Dieterich 47. This lecture is based on the following, which are all recommended reading: Algorithms in Bioinformatics I, WS06/07, C.Dieterich 47 5 BLAST and FASTA This lecture is based on the following, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid and Sensitive Protein

More information

BLAST. Anders Gorm Pedersen & Rasmus Wernersson

BLAST. Anders Gorm Pedersen & Rasmus Wernersson BLAST Anders Gorm Pedersen & Rasmus Wernersson Database searching Using pairwise alignments to search databases for similar sequences Query sequence Database Database searching Most common use of pairwise

More information

Pairwise Sequence Alignment

Pairwise Sequence Alignment Pairwise Sequence Alignment [email protected] SS 2013 Outline Pairwise sequence alignment global - Needleman Wunsch Gotoh algorithm local - Smith Waterman algorithm BLAST - heuristics What

More information

A Tutorial in Genetic Sequence Classification Tools and Techniques

A Tutorial in Genetic Sequence Classification Tools and Techniques A Tutorial in Genetic Sequence Classification Tools and Techniques Jake Drew Data Mining CSE 8331 Southern Methodist University [email protected] www.jakemdrew.com Sequence Characters IUPAC nucleotide

More information

Apply PERL to BioInformatics (II)

Apply PERL to BioInformatics (II) Apply PERL to BioInformatics (II) Lecture Note for Computational Biology 1 (LSM 5191) Jiren Wang http://www.bii.a-star.edu.sg/~jiren BioInformatics Institute Singapore Outline Some examples for manipulating

More information

Bioinformatics Resources at a Glance

Bioinformatics Resources at a Glance Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences

More information

Rapid alignment methods: FASTA and BLAST. p The biological problem p Search strategies p FASTA p BLAST

Rapid alignment methods: FASTA and BLAST. p The biological problem p Search strategies p FASTA p BLAST Rapid alignment methods: FASTA and BLAST p The biological problem p Search strategies p FASTA p BLAST 257 BLAST: Basic Local Alignment Search Tool p BLAST (Altschul et al., 1990) and its variants are some

More information

Design Style of BLAST and FASTA and Their Importance in Human Genome.

Design Style of BLAST and FASTA and Their Importance in Human Genome. Design Style of BLAST and FASTA and Their Importance in Human Genome. Saba Khalid 1 and Najam-ul-haq 2 SZABIST Karachi, Pakistan Abstract: This subjected study will discuss the concept of BLAST and FASTA.BLAST

More information

Molecular Databases and Tools

Molecular Databases and Tools NWeHealth, The University of Manchester Molecular Databases and Tools Afternoon Session: NCBI/EBI resources, pairwise alignment, BLAST, multiple sequence alignment and primer finding. Dr. Georgina Moulton

More information

Biological Databases and Protein Sequence Analysis

Biological Databases and Protein Sequence Analysis Biological Databases and Protein Sequence Analysis Introduction M. Madan Babu, Center for Biotechnology, Anna University, Chennai 25, India Bioinformatics is the application of Information technology to

More information

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the

More information

CD-HIT User s Guide. Last updated: April 5, 2010. http://cd-hit.org http://bioinformatics.org/cd-hit/

CD-HIT User s Guide. Last updated: April 5, 2010. http://cd-hit.org http://bioinformatics.org/cd-hit/ CD-HIT User s Guide Last updated: April 5, 2010 http://cd-hit.org http://bioinformatics.org/cd-hit/ Program developed by Weizhong Li s lab at UCSD http://weizhong-lab.ucsd.edu [email protected] 1. Introduction

More information

Efficient Parallel Execution of Sequence Similarity Analysis Via Dynamic Load Balancing

Efficient Parallel Execution of Sequence Similarity Analysis Via Dynamic Load Balancing Efficient Parallel Execution of Sequence Similarity Analysis Via Dynamic Load Balancing James D. Jackson Philip J. Hatcher Department of Computer Science Kingsbury Hall University of New Hampshire Durham,

More information

BIOINFORMATICS TUTORIAL

BIOINFORMATICS TUTORIAL Bio 242 BIOINFORMATICS TUTORIAL Bio 242 α Amylase Lab Sequence Sequence Searches: BLAST Sequence Alignment: Clustal Omega 3d Structure & 3d Alignments DO NOT REMOVE FROM LAB. DO NOT WRITE IN THIS DOCUMENT.

More information

Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011

Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011 Sequence Formats and Sequence Database Searches Gloria Rendon SC11 Education June, 2011 Sequence A is the primary structure of a biological molecule. It is a chain of residues that form a precise linear

More information

Bioinformatics Grid - Enabled Tools For Biologists.

Bioinformatics Grid - Enabled Tools For Biologists. Bioinformatics Grid - Enabled Tools For Biologists. What is Grid-Enabled Tools (GET)? As number of data from the genomics and proteomics experiment increases. Problems arise for the current sequence analysis

More information

Protein & DNA Sequence Analysis. Bobbie-Jo Webb-Robertson May 3, 2004

Protein & DNA Sequence Analysis. Bobbie-Jo Webb-Robertson May 3, 2004 Protein & DNA Sequence Analysis Bobbie-Jo Webb-Robertson May 3, 2004 Sequence Analysis Anything connected to identifying higher biological meaning out of raw sequence data. 2 Genomic & Proteomic Data Sequence

More information

Genome Explorer For Comparative Genome Analysis

Genome Explorer For Comparative Genome Analysis Genome Explorer For Comparative Genome Analysis Jenn Conn 1, Jo L. Dicks 1 and Ian N. Roberts 2 Abstract Genome Explorer brings together the tools required to build and compare phylogenies from both sequence

More information

SGI. High Throughput Computing (HTC) Wrapper Program for Bioinformatics on SGI ICE and SGI UV Systems. January, 2012. Abstract. Haruna Cofer*, PhD

SGI. High Throughput Computing (HTC) Wrapper Program for Bioinformatics on SGI ICE and SGI UV Systems. January, 2012. Abstract. Haruna Cofer*, PhD White Paper SGI High Throughput Computing (HTC) Wrapper Program for Bioinformatics on SGI ICE and SGI UV Systems Haruna Cofer*, PhD January, 2012 Abstract The SGI High Throughput Computing (HTC) Wrapper

More information

Welcome to the Plant Breeding and Genomics Webinar Series

Welcome to the Plant Breeding and Genomics Webinar Series Welcome to the Plant Breeding and Genomics Webinar Series Today s Presenter: Dr. Candice Hansey Presentation: http://www.extension.org/pages/ 60428 Host: Heather Merk Technical Production: John McQueen

More information

Integration of data management and analysis for genome research

Integration of data management and analysis for genome research Integration of data management and analysis for genome research Volker Brendel Deparment of Zoology & Genetics and Department of Statistics Iowa State University 2112 Molecular Biology Building Ames, Iowa

More information

GenBank: A Database of Genetic Sequence Data

GenBank: A Database of Genetic Sequence Data GenBank: A Database of Genetic Sequence Data Computer Science 105 Boston University David G. Sullivan, Ph.D. An Explosion of Scientific Data Scientists are generating ever increasing amounts of data. Relevant

More information

Getting started in Bio::Perl 1) Simple script to get a sequence by Id and write to specified format

Getting started in Bio::Perl 1) Simple script to get a sequence by Id and write to specified format BIOPERL TUTORIAL (ABREV.) Getting started in Bio::Perl 1) Simple script to get a sequence by Id and write to specified format use Bio::Perl; # this script will only work if you have an internet connection

More information

Bioinformática BLAST. Blast information guide. Buscas de sequências semelhantes. Search for Homologies BLAST

Bioinformática BLAST. Blast information guide. Buscas de sequências semelhantes. Search for Homologies BLAST BLAST Bioinformática Search for Homologies BLAST BLAST - Basic Local Alignment Search Tool http://blastncbinlmnihgov/blastcgi 1 2 Blast information guide Buscas de sequências semelhantes http://blastncbinlmnihgov/blastcgi?cmd=web&page_type=blastdocs

More information

This document presents the new features available in ngklast release 4.4 and KServer 4.2.

This document presents the new features available in ngklast release 4.4 and KServer 4.2. This document presents the new features available in ngklast release 4.4 and KServer 4.2. 1) KLAST search engine optimization ngklast comes with an updated release of the KLAST sequence comparison tool.

More information

Version 5.0 Release Notes

Version 5.0 Release Notes Version 5.0 Release Notes 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) +1.734.769.7249 (elsewhere) +1.734.769.7074 (fax) www.genecodes.com

More information

Geospiza s Finch-Server: A Complete Data Management System for DNA Sequencing

Geospiza s Finch-Server: A Complete Data Management System for DNA Sequencing KOO10 5/31/04 12:17 PM Page 131 10 Geospiza s Finch-Server: A Complete Data Management System for DNA Sequencing Sandra Porter, Joe Slagel, and Todd Smith Geospiza, Inc., Seattle, WA Introduction The increased

More information

At the end of this lesson, you will be able to create a Request Set to run all of your monthly statements and detail reports at one time.

At the end of this lesson, you will be able to create a Request Set to run all of your monthly statements and detail reports at one time. Request Set Creation You can use a Request Set to run all of your monthly reports at one time, such as your Department Statements, Project Statements and RIT Account Analysis reports. A Request Set allows

More information

Laboratorio di Bioinformatica

Laboratorio di Bioinformatica Laboratorio di Bioinformatica Lezione #2 Dr. Marco Fondi Contact: [email protected] www.unifi.it/dblemm/ tel. 0552288308 Dip.to di Biologia Evoluzionistica Laboratorio di Evoluzione Microbica e Molecolare,

More information

How To Use The Librepo Software On A Linux Computer (For Free)

How To Use The Librepo Software On A Linux Computer (For Free) An introduction to Linux for bioinformatics Paul Stothard March 11, 2014 Contents 1 Introduction 2 2 Getting started 3 2.1 Obtaining a Linux user account....................... 3 2.2 How to access your

More information

Biological Sequence Data Formats

Biological Sequence Data Formats Biological Sequence Data Formats Here we present three standard formats in which biological sequence data (DNA, RNA and protein) can be stored and presented. Raw Sequence: Data without description. FASTA

More information

Installation Guide for AmiRNA and WMD3 Release 3.1

Installation Guide for AmiRNA and WMD3 Release 3.1 Installation Guide for AmiRNA and WMD3 Release 3.1 by Joffrey Fitz and Stephan Ossowski 1 Introduction This document describes the installation process for WMD3/AmiRNA. WMD3 (Web Micro RNA Designer version

More information

Bio-Informatics Lectures. A Short Introduction

Bio-Informatics Lectures. A Short Introduction Bio-Informatics Lectures A Short Introduction The History of Bioinformatics Sanger Sequencing PCR in presence of fluorescent, chain-terminating dideoxynucleotides Massively Parallel Sequencing Massively

More information

(http://genomes.urv.es/caical) TUTORIAL. (July 2006)

(http://genomes.urv.es/caical) TUTORIAL. (July 2006) (http://genomes.urv.es/caical) TUTORIAL (July 2006) CAIcal manual 2 Table of contents Introduction... 3 Required inputs... 5 SECTION A Calculation of parameters... 8 SECTION B CAI calculation for FASTA

More information

Databases and mapping BWA. Samtools

Databases and mapping BWA. Samtools Databases and mapping BWA Samtools FASTQ, SFF, bax.h5 ACE, FASTG FASTA BAM/SAM GFF, BED GenBank/Embl/DDJB many more File formats FASTQ Output format from Illumina and IonTorrent sequencers. Quality scores:

More information

Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance?

Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance? Optimization 1 Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance? Where to begin? 2 Sequence Databases Swiss-prot MSDB, NCBI nr dbest Species specific ORFS

More information

org.rn.eg.db December 16, 2015 org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank accession numbers.

org.rn.eg.db December 16, 2015 org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank accession numbers. org.rn.eg.db December 16, 2015 org.rn.egaccnum Map Entrez Gene identifiers to GenBank Accession Numbers org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank

More information

SQL Server Instance-Level Benchmarks with DVDStore

SQL Server Instance-Level Benchmarks with DVDStore SQL Server Instance-Level Benchmarks with DVDStore Dell developed a synthetic benchmark tool back that can run benchmark tests against SQL Server, Oracle, MySQL, and PostgreSQL installations. It is open-sourced

More information

Sequence Database Administration

Sequence Database Administration Sequence Database Administration 1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases

More information

Introduction to Bioinformatics AS 250.265 Laboratory Assignment 6

Introduction to Bioinformatics AS 250.265 Laboratory Assignment 6 Introduction to Bioinformatics AS 250.265 Laboratory Assignment 6 In the last lab, you learned how to perform basic multiple sequence alignments. While useful in themselves for determining conserved residues

More information

Linear Sequence Analysis. 3-D Structure Analysis

Linear Sequence Analysis. 3-D Structure Analysis Linear Sequence Analysis What can you learn from a (single) protein sequence? Calculate it s physical properties Molecular weight (MW), isoelectric point (pi), amino acid content, hydropathy (hydrophilic

More information

An agent-based layered middleware as tool integration

An agent-based layered middleware as tool integration An agent-based layered middleware as tool integration Flavio Corradini Leonardo Mariani Emanuela Merelli University of L Aquila University of Milano University of Camerino ITALY ITALY ITALY Helsinki FSE/ESEC

More information

Supervised DNA barcodes species classification: analysis, comparisons and results. Tutorial. Citations

Supervised DNA barcodes species classification: analysis, comparisons and results. Tutorial. Citations Supervised DNA barcodes species classification: analysis, comparisons and results Emanuel Weitschek, Giulia Fiscon, and Giovanni Felici Citations If you use this procedure please cite: Weitschek E, Fiscon

More information

Database manager does something that sounds trivial. It makes it easy to setup a new database for searching with Mascot. It also makes it easy to

Database manager does something that sounds trivial. It makes it easy to setup a new database for searching with Mascot. It also makes it easy to 1 Database manager does something that sounds trivial. It makes it easy to setup a new database for searching with Mascot. It also makes it easy to automate regular updates of these databases. 2 However,

More information

Analyzing A DNA Sequence Chromatogram

Analyzing A DNA Sequence Chromatogram LESSON 9 HANDOUT Analyzing A DNA Sequence Chromatogram Student Researcher Background: DNA Analysis and FinchTV DNA sequence data can be used to answer many types of questions. Because DNA sequences differ

More information

Skills Funding Agency

Skills Funding Agency Provider Data Self Assessment Toolkit (PDSAT) v15 User Guide Contents Introduction... 3 1 Before You Start... 4 1.1 Compatibility... 4 1.2 Extract PDSAT... 4 1.3 Trust Center... 4 2. Using PDSAT... 6 2.1

More information

William E Benjamin Jr, Owl Computer Consultancy, LLC

William E Benjamin Jr, Owl Computer Consultancy, LLC So, You ve Got Data Enterprise Wide (SAS, ACCESS, EXCEL, MySQL, Oracle, and Others); Well, Let SAS Enterprise Guide Software Point-n-Click Your Way to Using It. William E Benjamin Jr, Owl Computer Consultancy,

More information

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want 1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very

More information

Sequence Analysis 15: lecture 5. Substitution matrices Multiple sequence alignment

Sequence Analysis 15: lecture 5. Substitution matrices Multiple sequence alignment Sequence Analysis 15: lecture 5 Substitution matrices Multiple sequence alignment A teacher's dilemma To understand... Multiple sequence alignment Substitution matrices Phylogenetic trees You first need

More information

High Performance Computing with Sun Grid Engine on the HPSCC cluster. Fernando J. Pineda

High Performance Computing with Sun Grid Engine on the HPSCC cluster. Fernando J. Pineda High Performance Computing with Sun Grid Engine on the HPSCC cluster Fernando J. Pineda HPSCC High Performance Scientific Computing Center (HPSCC) " The Johns Hopkins Service Center in the Dept. of Biostatistics

More information

Oracle SOA Suite 11g Oracle SOA Suite 11g HL7 Inbound Example Functional ACK Addendum

Oracle SOA Suite 11g Oracle SOA Suite 11g HL7 Inbound Example Functional ACK Addendum Oracle SOA Suite 11g Oracle SOA Suite 11g HL7 Inbound Example Functional ACK Addendum [email protected] June 2010 Table of Contents Introduction... 1 Pre-requisites... 1 HL7 v2 Receiver Solution...

More information

Hadoop: A Framework for Data- Intensive Distributed Computing. CS561-Spring 2012 WPI, Mohamed Y. Eltabakh

Hadoop: A Framework for Data- Intensive Distributed Computing. CS561-Spring 2012 WPI, Mohamed Y. Eltabakh 1 Hadoop: A Framework for Data- Intensive Distributed Computing CS561-Spring 2012 WPI, Mohamed Y. Eltabakh 2 What is Hadoop? Hadoop is a software framework for distributed processing of large datasets

More information

OTN Developer Day: Oracle Big Data

OTN Developer Day: Oracle Big Data OTN Developer Day: Oracle Big Data Hands On Lab Manual Oracle Big Data Connectors: Introduction to Oracle R Connector for Hadoop ORACLE R CONNECTOR FOR HADOOP 2.0 HANDS-ON LAB Introduction to Oracle R

More information

Consensus alignment server for reliable comparative modeling with distant templates

Consensus alignment server for reliable comparative modeling with distant templates W50 W54 Nucleic Acids Research, 2004, Vol. 32, Web Server issue DOI: 10.1093/nar/gkh456 Consensus alignment server for reliable comparative modeling with distant templates Jahnavi C. Prasad 1, Sandor Vajda

More information

A basic create statement for a simple student table would look like the following.

A basic create statement for a simple student table would look like the following. Creating Tables A basic create statement for a simple student table would look like the following. create table Student (SID varchar(10), FirstName varchar(30), LastName varchar(30), EmailAddress varchar(30));

More information

Handling next generation sequence data

Handling next generation sequence data Handling next generation sequence data a pilot to run data analysis on the Dutch Life Sciences Grid Barbera van Schaik Bioinformatics Laboratory - KEBB Academic Medical Center Amsterdam Very short intro

More information

Step by Step Guide to Importing Genetic Data into JMP Genomics

Step by Step Guide to Importing Genetic Data into JMP Genomics Step by Step Guide to Importing Genetic Data into JMP Genomics Page 1 Introduction Data for genetic analyses can exist in a variety of formats. Before this data can be analyzed it must imported into one

More information

Module 1. Sequence Formats and Retrieval. Charles Steward

Module 1. Sequence Formats and Retrieval. Charles Steward The Open Door Workshop Module 1 Sequence Formats and Retrieval Charles Steward 1 Aims Acquaint you with different file formats and associated annotations. Introduce different nucleotide and protein databases.

More information

Discovering Bioinformatics

Discovering Bioinformatics Discovering Bioinformatics Sami Khuri Natascha Khuri Alexander Picker Aidan Budd Sophie Chabanis-Davidson Julia Willingale-Theune English version ELLS European Learning Laboratory for the Life Sciences

More information

000-420. IBM InfoSphere MDM Server v9.0. Version: Demo. Page <<1/11>>

000-420. IBM InfoSphere MDM Server v9.0. Version: Demo. Page <<1/11>> 000-420 IBM InfoSphere MDM Server v9.0 Version: Demo Page 1. As part of a maintenance team for an InfoSphere MDM Server implementation, you are investigating the "EndDate must be after StartDate"

More information

BUDAPEST: Bioinformatics Utility for Data Analysis of Proteomics using ESTs

BUDAPEST: Bioinformatics Utility for Data Analysis of Proteomics using ESTs BUDAPEST: Bioinformatics Utility for Data Analysis of Proteomics using ESTs Richard J. Edwards 2008. Contents 1. Introduction... 2 1.1. Version...2 1.2. Using this Manual...2 1.3. Why use BUDAPEST?...2

More information

ibolt V3.2 Release Notes

ibolt V3.2 Release Notes ibolt V3.2 Release Notes Welcome to ibolt V3.2, which has been designed to deliver an easy-touse, flexible, and cost-effective business integration solution. This document highlights the new and enhanced

More information

Call Recorder Quick CD Access System

Call Recorder Quick CD Access System Call Recorder Quick CD Access System V4.0 VC2010 Contents 1 Call Recorder Quick CD Access System... 3 1.1 Install the software...4 1.2 Start...4 1.3 View recordings on CD...5 1.4 Create an archive on Hard

More information

IceWarp to IceWarp Server Migration

IceWarp to IceWarp Server Migration IceWarp to IceWarp Server Migration Registered Trademarks iphone, ipad, Mac, OS X are trademarks of Apple Inc., registered in the U.S. and other countries. Microsoft, Windows, Outlook and Windows Phone

More information

Oracle Fusion Middleware

Oracle Fusion Middleware Oracle Fusion Middleware Oracle WebCenter Forms Recognition/Capture Integration Guide 11g Release 1 (11.1.1) E49971-01 November 2013 Oracle WebCenter Forms Recognition is a learning-based solution that

More information

GenBank, Entrez, & FASTA

GenBank, Entrez, & FASTA GenBank, Entrez, & FASTA Nucleotide Sequence Databases First generation GenBank is a representative example started as sort of a museum to preserve knowledge of a sequence from first discovery great repositories,

More information

Package hoarder. June 30, 2015

Package hoarder. June 30, 2015 Type Package Title Information Retrieval for Genetic Datasets Version 0.1 Date 2015-06-29 Author [aut, cre], Anu Sironen [aut] Package hoarder June 30, 2015 Maintainer Depends

More information

TRIM: Web Tool. Web Address The TRIM web tool can be accessed at:

TRIM: Web Tool. Web Address The TRIM web tool can be accessed at: TRIM: Web Tool Accessing TRIM Records through the Web The TRIM web tool is primarily aimed at providing access to records in the TRIM system. While it is possible to place records into TRIM or amend records

More information

EMBL-EBI Web Services

EMBL-EBI Web Services EMBL-EBI Web Services Rodrigo Lopez Head of the External Services Team SME Workshop Piemonte 2011 EBI is an Outstation of the European Molecular Biology Laboratory. Summary Introduction The JDispatcher

More information

TRIFORCE ANJP. THE POWER TO PROVE sm USER S GUIDE USER S GUIDE TRIFORCE ANJP VERSION 3.10

TRIFORCE ANJP. THE POWER TO PROVE sm USER S GUIDE USER S GUIDE TRIFORCE ANJP VERSION 3.10 TRIFORCE ANJP THE POWER TO PROVE sm USER S GUIDE USER S GUIDE TRIFORCE ANJP VERSION 3.10 TRIFORCE ANJP USER S GUIDE 2 Contents LET'S BEGIN... 5 SAY HELLO TO ANJP... 5 RUNNING ANJP... 6 Software Activation...

More information

Monitoring Replication

Monitoring Replication Monitoring Replication Article 1130112-02 Contents Summary... 3 Monitor Replicator Page... 3 Summary... 3 Status... 3 System Health... 4 Replicator Configuration... 5 Replicator Health... 6 Local Package

More information

Lecture Outline. Introduction to Databases. Introduction. Data Formats Sample databases How to text search databases. Shifra Ben-Dor Irit Orr

Lecture Outline. Introduction to Databases. Introduction. Data Formats Sample databases How to text search databases. Shifra Ben-Dor Irit Orr Introduction to Databases Shifra Ben-Dor Irit Orr Lecture Outline Introduction Data and Database types Database components Data Formats Sample databases How to text search databases What units of information

More information

MyOra 3.0. User Guide. SQL Tool for Oracle. Jayam Systems, LLC

MyOra 3.0. User Guide. SQL Tool for Oracle. Jayam Systems, LLC MyOra 3.0 SQL Tool for Oracle User Guide Jayam Systems, LLC Contents Features... 4 Connecting to the Database... 5 Login... 5 Login History... 6 Connection Indicator... 6 Closing the Connection... 7 SQL

More information

Snapshot Reports for 800xA User Guide

Snapshot Reports for 800xA User Guide Snapshot Reports for 800xA User Guide System Version 5.1 Power and productivity for a better world TM Snapshot Reports for 800xA User Guide System Version 5.1 NOTICE This document contains information

More information

3. About R2oDNA Designer

3. About R2oDNA Designer 3. About R2oDNA Designer Please read these publications for more details: Casini A, Christodoulou G, Freemont PS, Baldwin GS, Ellis T, MacDonald JT. R2oDNA Designer: Computational design of biologically-neutral

More information

Introduction to GCG and SeqLab

Introduction to GCG and SeqLab Oxford University Bioinformatics Centre Introduction to GCG and SeqLab 31 July 2001 Oxford University Bioinformatics Centre, 2001 Sir William Dunn School of Pathology South Parks Road Oxford, OX1 3RE Contents

More information

A Multiple DNA Sequence Translation Tool Incorporating Web Robot and Intelligent Recommendation Techniques

A Multiple DNA Sequence Translation Tool Incorporating Web Robot and Intelligent Recommendation Techniques Proceedings of the 2007 WSEAS International Conference on Computer Engineering and Applications, Gold Coast, Australia, January 17-19, 2007 402 A Multiple DNA Sequence Translation Tool Incorporating Web

More information

DB Administration COMOS. Platform DB Administration. Trademarks 1. Prerequisites. MS SQL Server 2005/2008 3. Oracle. Operating Manual 09/2011

DB Administration COMOS. Platform DB Administration. Trademarks 1. Prerequisites. MS SQL Server 2005/2008 3. Oracle. Operating Manual 09/2011 Trademarks 1 Prerequisites 2 COMOS Platform MS SQL Server 2005/2008 3 Oracle 4 Operating Manual 09/2011 A5E03638301-01 Legal information Legal information Warning notice system This manual contains notices

More information

Vaxign Reverse Vaccinology Software Demo Introduction Zhuoshuang Allen Xiang, Yongqun Oliver He

Vaxign Reverse Vaccinology Software Demo Introduction Zhuoshuang Allen Xiang, Yongqun Oliver He Vaxign Reverse Vaccinology Software Demo Introduction Zhuoshuang Allen Xiang, Yongqun Oliver He Unit for Laboratory Animal Medicine Department of Microbiology and Immunology Center for Computational Medicine

More information