Next Generation Sequencing Data Visualization

Size: px
Start display at page:

Download "Next Generation Sequencing Data Visualization"

Transcription

1 Next Generation Sequencing Data Visualization GBrowse2 from GMOD Andreas Gisel Institute for Biomedical Technologies CNR Bari - Italy

2 GMOD is the Generic Model Organism Database project GMOD is a collection of interconnected applications and databases that biologists use as repositories and as tools. That connectivity is really the key here. There's no lack of tools, but many of these tools will be little used since the typical prospective user may not have the resources or expertise required to install the tool and connect it, in some way, to the data in hand.

3 The tutorial will show: how to display a reference sequence with feature in GBrowse2 how to display Next Generation Sequencing (NGS) mapping data. We will use Escherichia coli str. K-12 substr. DH10B, complete genome - NC_ (ref1.fa) and Illumina pair-end reads1.fa and reads2.fa

4 GBrowse2

5 GBrowse2

6 GBrowse2 /etc/gbrowse2/

7 GBrowse2 /var/lib/gbrowse2/databases Text

8 GBrowse2 Set-up the gbrowser for E.coli data We have: Reference sequence data in FASTA Annotation for the reference sequence in GFF

9 GBrowse2 Set-up the gbrowser for E.coli data We have: Reference sequence data in FASTA Annotation for the reference sequence in GFF We need: E. coli configuration file Add E.coli informatio to the general GBrowse.conf file Add data to the coresponding database

10 Annotation Data Formats EMBL annotation files GeneBank annotation files GFF files

11 GeneBank format LOCUS HQ bp DNA circular PLN 22-DEC-2010 DEFINITION Prunus persica chloroplast, complete genome. ACCESSION HQ VERSION HQ GI: KEYWORDS. SOURCE chloroplast Prunus persica (peach) ORGANISM Prunus persica Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus. REFERENCE 1 (bases 1 to ) AUTHORS Jansen,R.K., Saski,C., Lee,S.B., Hansen,A.K. and Daniell,H. TITLE Complete Plastid Genome Sequences of Three Rosids (Castanea, Prunus, Theobroma): Evidence for At Least Two Independent Transfers of rpl22 to the Nucleus JOURNAL Mol. Biol. Evol. 28 (1), (2011) PUBMED REFERENCE 2 (bases 1 to ) AUTHORS Jansen,R.K., Saski,C., Lee,S.-B., Hansen,A.K. and Daniell,H. TITLE JOURNAL Direct Submission Submitted (28-SEP-2010) Integrative Biology, University of Texas at Austin, 1 University Station C0930, Austin, TX 78712, USA

12 GeneBank format FEATURES Location/Qualifiers source /organism="prunus persica" /organelle="plastid:chloroplast" /mol_type="genomic DNA" /db_xref="taxon:3760" gene complement(join( , )) /gene="rps12" /trans_splicing CDS complement(join( , , )) /gene="rps12" /trans_splicing /codon_start=1 /transl_table=11 /product="ribosomal protein S12" /protein_id="ado " /db_xref="gi: " /translation="mptikqlirntrqpirnvtkspalggcpqrrgtctrvytitpkk PNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTL DAVGVKDRQQGRSKYGVKKPK"

13 GeneBank format ORIGIN 1 tgggcgaacg acgggaattg aacccgcgca tggtggattc acaatccact gccttgatcc 61 acttggctac atccgcccct tatactatta caaatattta caccatttat cattacttgt 121 aagataaaat acaacataaa ataaactgaa acttttaata ttttaattaa attttgtagt 181 aaattaacta aaaaaaaata tagaacaaaa caatatagta aagttaagta gtaaataaaa 241 aaaatactaa atagtaaagg agcaataaca aacctcttga tataacaaga aatttattat 301 tgctccttta ctttcaagaa ctcctatata ctaagaccaa agtcttatcc atttatagat 361 ggaacttcaa cagcagctag atctagaggg aaattatggg cattacgttc atgcataact 421 tccataccaa ggttagcgcg gttaataata tcagcccaag tattaattac acgaccctga 481 ctatcaacta cagattgatt gaaattaaaa ccatttaagt tgaaagccat agtgctgata 541 cctaaagcgg taaaccagat acctactaca ggccaagcag ctaggaagaa atgtaaagaa 601 cgagaattgt tgaaactagc atattggaag atcaatcggc caaaataacc atgagcggct 661 acgatattat aggtttcttc ctcttgaccg aatctgtaac cttcattagc agattcattt 721 tctgtggttt ccctgatcaa actagaggtt accaaggacc catgcatagc actgaatagg 781 gagccgccga atacaccagc tacgcctaac atgtgaaatg ggtgcataag gatgttgtgc 841 tcggcttgga atacaatcat gaagttgaaa gtaccggaga ttcctagggg cataccgtca 901 gaaaagcttc cttgaccaat tggatatatc aagaaaacag cagtagcagc tgcaacagga 961 gctgaatatg caacagcaat ccaagggcgc atacccagac ggaaactaag ttcccactca 1021 cgacccatgt agcaagctac accaagtaag aagtgtagaa caattagttc ataaggacca 1081 ccgttgtata accattcatc aacggaagcc gcttcccata tcgggtaaaa gtgcaaacct 1141 atagctgcag aggtaggaat aatggcacca gaaataatat tgtttccata aagtaaagat 1201 ccagaaacag gttcacgaat accatcaata tctactggag gtgcagcaat gaaagcaata

14 GFF format ##gff-version 3 # sequence-region HQ # conversion-by bp_genbank2gff3.pl # organism Prunus persica # date 22-DEC-2010 # Note Prunus persica chloroplast, complete genome. # working on region:hq336405, Prunus persica, 22-DEC-2010, Prunus persica chloroplast, complete genome. # Possible gene unflattening error withhq336405: consult STDERR HQ336405!GenBank! region! 1! !.! +!.! ID=HQ336405;Dbxref=taxon:3760;Note=Prunus persica chloroplast complete genome;date=22-dec-2010;mol_type=genomic DNA;organelle=plastid:chloroplast;organism=Prunus persica HQ336405!GenBank! CDS!99804! 99829!.! -!.! ID=rps12;Dbxref=GI: ;codon_start=1;gene=rps12;product=ribosomal protein S12;protein_id=ADO ;trans_splicing=_no_value;transl_table=11;translation=length.123 HQ336405!GenBank! CDS!100366! !.! -!.! ID=rps12;Dbxref=GI: ;codon_start=1;gene=rps12;product=ribosomal protein S12;protein_id=ADO ;trans_splicing=_no_value;transl_table=11;translation=length.123 HQ336405!GenBank! CDS!71346! 71459!.! -!.! ID=rps12;Dbxref=GI: ;codon_start=1;gene=rps12;product=ribosomal protein S12;protein_id=ADO ;trans_splicing=_no_value;transl_table=11;translation=length.123 HQ336405!GenBank! gene!99804! !.! -!. ID=rps12;gene=rps12;trans_splicing=_no_value HQ336405!GenBank! gene!71346! 71459!.! -!. ID=rps12;gene=rps12;trans_splicing=_no_value HQ336405!GenBank! gene!3! 77!.! -!.! ID=trnH-GUG;gene=trnH-GUG HQ336405!GenBank! trna!3! 77!.! -!.! ID=trnH-GUG.r01;Parent=trnH GUG;Note=anticodon:GUG;gene=trnH-GUG;product=tRNA-His

15 GBrowse2 Create and configure the tracks visualizing the date of E.coli [GENERAL] description = Escherichia coli str. K-12 substr. DH10B database = annotations initial landmark = NC_ : # bring in the special Submitter plugin for the rubber-band select menu plugins = FastaDumper RestrictionAnnotator SequenceDumper TrackDumper Submitter S autocomplete = 1 default tracks = Genes ORFs trnas CDS Transp Centro:overview GC:region # examples to show in the introduction examples = NC_ : # "automatic" classes to try when an unqualified identifier is given automatic classes = Symbol Gene Clone

16 GBrowse2 Create and configure the tracks visualizing the date of E.coli ################################# # database definitions ################################# [scaffolds:database] db_adaptor = Bio::DB::SeqFeature::Store db_args = -adaptor memory -dir /var/lib/gbrowse2/databases/ecoli_seq search options = default +autocomplete [annotations:database] db_adaptor = Bio::DB::SeqFeature::Store db_args = -adaptor memory -dir /var/lib/gbrowse2/databases/ecoli_annotations search options = default +autocomplete

17 GBrowse2 Create and configure the tracks visualizing the date of E.coli # Default glyph settings [TRACK DEFAULTS] glyph = generic database = annotations height = 8 bgcolor = cyan fgcolor = black label density = 25 bump density = 100 show summary = # go into summary mode when zoomed out to 100k # default pop-up balloon balloon hover = <b>$name</b> is a $type spanning $ref from $start to $end. Click for more details. [CDS] feature = gene glyph = cds description = 0 height = 26 sixframe = 1 label = sub {shift->name. " reading frame"} key = CDS balloon click width = 500 balloon hover width = 350 balloon hover = <b>$name</b> is a $type spanning $ref from $start to $end. Click to search Google for $name. balloon click = citation = This track shows CDS reading frames.

18 GBrowse2 Insert E.coli in the general GBrowse config file ############################################################################## # # DATASOURCE DEFINITIONS # One stanza for each configured data source # ############################################################################## [yeast] description = Yeast chromosomes 1+2 (basic) path = yeast_simple.conf [yeast_advanced] description = Yeast chromosomes 1+2 (advanced) path = yeast_chr1+2.conf [ecoli] description = Escherichia coli str. K-12 substr. DH10B path = ecoli.conf

19 GBrowse2 Add data to databases ################################# # database definitions ################################# [scaffolds:database] db_adaptor = Bio::DB::SeqFeature::Store db_args = -adaptor memory -dir /var/lib/gbrowse2/databases/ecoli_seq search options = default +autocomplete [annotations:database] db_adaptor = Bio::DB::SeqFeature::Store db_args = -adaptor memory -dir /var/lib/gbrowse2/databases/ecoli_annotations search options = default +autocomplete Create: /var/lib/gbrowse2/databases/ecoli_seq /var/lib/gbrowse2/databases/ecoli_annotations

20 GBrowse2 Add data to databases Move to: /var/lib/gbrowse2/databases/ecoli_seq - ref1.fa - chromosomes.gff3 /var/lib/gbrowse2/databases/ecoli_annotations - NC_ gff

21 GBrowse2

22 Create mapping data Map with bowtie: index: bowtie-build -f ref1.fa ref1 map: bowtie -n 1 -l 30 -I 0 -X un unmapped -p 2 -S ref/ ref1-1 illumina/reads1.fq -2 illumina/reads2.fq > pair.sam SAM to BAM: index: samtools faidx ref1.fa SAM to BAM: samtools import ref1.fa.fai pair.sam pair.bam sort BAM: samtools sort pair.bam pair_sorted index BAM: samtools index pair_sorted.bam

23 Modify the ecoli.conf Add database: [ecolisam:database] db_adaptor = Bio::DB::Sam db_args = -fasta /var/lib/gbrowse2/databases/ecolisam/ref1.fa -bam /var/lib/gbrowse2/databases/ecolisam/pair_sorted.bam search options = none Add tracks: [CoverageXyplot] feature = coverage glyph = wiggle_xyplot database = ecolisam height = 50 fgcolor = black bicolor_pivot = 20 pos_color = blue neg_color = red key = Coverage (xyplot) category = Reads label = 0 # Labels on wiggle tracks are redundant.

24 Create mapping database create directory ecolisam in /var/lib/gbrowse2/databases copy pair_sorted.bam and pair_sorted.bam.bai to ecolisam and set the right privileges to ecolisam so that the browser can access them

25 E.coli GBrowse

Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011

Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011 Sequence Formats and Sequence Database Searches Gloria Rendon SC11 Education June, 2011 Sequence A is the primary structure of a biological molecule. It is a chain of residues that form a precise linear

More information

UGENE Quick Start Guide

UGENE Quick Start Guide Quick Start Guide This document contains a quick introduction to UGENE. For more detailed information, you can find the UGENE User Manual and other special manuals in project website: http://ugene.unipro.ru.

More information

GenBank, Entrez, & FASTA

GenBank, Entrez, & FASTA GenBank, Entrez, & FASTA Nucleotide Sequence Databases First generation GenBank is a representative example started as sort of a museum to preserve knowledge of a sequence from first discovery great repositories,

More information

Tutorial for Windows and Macintosh. Preparing Your Data for NGS Alignment

Tutorial for Windows and Macintosh. Preparing Your Data for NGS Alignment Tutorial for Windows and Macintosh Preparing Your Data for NGS Alignment 2015 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) 1.734.769.7249

More information

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the

More information

Tutorial. Reference Genome Tracks. Sample to Insight. November 27, 2015

Tutorial. Reference Genome Tracks. Sample to Insight. November 27, 2015 Reference Genome Tracks November 27, 2015 Sample to Insight CLC bio, a QIAGEN Company Silkeborgvej 2 Prismet 8000 Aarhus C Denmark Telephone: +45 70 22 32 44 www.clcbio.com [email protected] Reference

More information

Bioinformatics Resources at a Glance

Bioinformatics Resources at a Glance Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences

More information

Data formats and file conversions

Data formats and file conversions Building Excellence in Genomics and Computational Bioscience s Richard Leggett (TGAC) John Walshaw (IFR) Common file formats FASTQ FASTA BAM SAM Raw sequence Alignments MSF EMBL UniProt BED WIG Databases

More information

Databases and mapping BWA. Samtools

Databases and mapping BWA. Samtools Databases and mapping BWA Samtools FASTQ, SFF, bax.h5 ACE, FASTG FASTA BAM/SAM GFF, BED GenBank/Embl/DDJB many more File formats FASTQ Output format from Illumina and IonTorrent sequencers. Quality scores:

More information

SeattleSNPs Interactive Tutorial: Web Tools for Site Selection, Linkage Disequilibrium and Haplotype Analysis

SeattleSNPs Interactive Tutorial: Web Tools for Site Selection, Linkage Disequilibrium and Haplotype Analysis SeattleSNPs Interactive Tutorial: Web Tools for Site Selection, Linkage Disequilibrium and Haplotype Analysis Goal: This tutorial introduces several websites and tools useful for determining linkage disequilibrium

More information

Microsoft Visual Studio Integration Guide

Microsoft Visual Studio Integration Guide Microsoft Visual Studio Integration Guide MKS provides a number of integrations for Integrated Development Environments (IDEs). IDE integrations allow you to access MKS Integrity s workflow and configuration

More information

Version 5.0 Release Notes

Version 5.0 Release Notes Version 5.0 Release Notes 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) +1.734.769.7249 (elsewhere) +1.734.769.7074 (fax) www.genecodes.com

More information

Analysis of ChIP-seq data in Galaxy

Analysis of ChIP-seq data in Galaxy Analysis of ChIP-seq data in Galaxy November, 2012 Local copy: https://galaxy.wi.mit.edu/ Joint project between BaRC and IT Main site: http://main.g2.bx.psu.edu/ 1 Font Conventions Bold and blue refers

More information

IGV User Guide. User Interface Main Window. This guide describes the Integrative Genomics Viewer (IGV).

IGV User Guide. User Interface Main Window. This guide describes the Integrative Genomics Viewer (IGV). IGV User Guide This guide describes the Integrative Genomics Viewer (IGV). To start IGV, go to the IGV downloads page: http://www.broadinstitute.org/igv/download. Look at a printer-friendly HTML version

More information

Lecture Outline. Introduction to Databases. Introduction. Data Formats Sample databases How to text search databases. Shifra Ben-Dor Irit Orr

Lecture Outline. Introduction to Databases. Introduction. Data Formats Sample databases How to text search databases. Shifra Ben-Dor Irit Orr Introduction to Databases Shifra Ben-Dor Irit Orr Lecture Outline Introduction Data and Database types Database components Data Formats Sample databases How to text search databases What units of information

More information

CLC Sequence Viewer USER MANUAL

CLC Sequence Viewer USER MANUAL CLC Sequence Viewer USER MANUAL Manual for CLC Sequence Viewer 7.6.1 Windows, Mac OS X and Linux September 3, 2015 This software is for research purposes only. QIAGEN Aarhus A/S Silkeborgvej 2 Prismet

More information

Data Visualization. Prepared by Francisco Olivera, Ph.D., Srikanth Koka Department of Civil Engineering Texas A&M University February 2004

Data Visualization. Prepared by Francisco Olivera, Ph.D., Srikanth Koka Department of Civil Engineering Texas A&M University February 2004 Data Visualization Prepared by Francisco Olivera, Ph.D., Srikanth Koka Department of Civil Engineering Texas A&M University February 2004 Contents Brief Overview of ArcMap Goals of the Exercise Computer

More information

Fast. Integrated Genome Browser & DAS. Easy. Flexible. Free. bioviz.org/igb

Fast. Integrated Genome Browser & DAS. Easy. Flexible. Free. bioviz.org/igb bioviz.org/igb Integrated Genome Browser & DAS Free tools for visualizing, sharing, and publishing genomes and genome-scale data. Easy Flexible Fast Free Funding: National Science Foundation Arabidopsis

More information

GenBank: A Database of Genetic Sequence Data

GenBank: A Database of Genetic Sequence Data GenBank: A Database of Genetic Sequence Data Computer Science 105 Boston University David G. Sullivan, Ph.D. An Explosion of Scientific Data Scientists are generating ever increasing amounts of data. Relevant

More information

JOOMLA 2.5 MANUAL WEBSITEDESIGN.CO.ZA

JOOMLA 2.5 MANUAL WEBSITEDESIGN.CO.ZA JOOMLA 2.5 MANUAL WEBSITEDESIGN.CO.ZA All information presented in the document has been acquired from http://docs.joomla.org to assist you with your website 1 JOOMLA 2.5 MANUAL WEBSITEDESIGN.CO.ZA BACK

More information

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want 1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very

More information

Analysis of NGS Data

Analysis of NGS Data Analysis of NGS Data Introduction and Basics Folie: 1 Overview of Analysis Workflow Images Basecalling Sequences denovo - Sequencing Assembly Annotation Resequencing Alignments Comparison to reference

More information

Module 1. Sequence Formats and Retrieval. Charles Steward

Module 1. Sequence Formats and Retrieval. Charles Steward The Open Door Workshop Module 1 Sequence Formats and Retrieval Charles Steward 1 Aims Acquaint you with different file formats and associated annotations. Introduce different nucleotide and protein databases.

More information

Exercise with Gene Ontology - Cytoscape - BiNGO

Exercise with Gene Ontology - Cytoscape - BiNGO Exercise with Gene Ontology - Cytoscape - BiNGO This practical has material extracted from http://www.cbs.dtu.dk/chipcourse/exercises/ex_go/goexercise11.php In this exercise we will analyze microarray

More information

Comparing Methods for Identifying Transcription Factor Target Genes

Comparing Methods for Identifying Transcription Factor Target Genes Comparing Methods for Identifying Transcription Factor Target Genes Alena van Bömmel (R 3.3.73) Matthew Huska (R 3.3.18) Max Planck Institute for Molecular Genetics Folie 1 Transcriptional Regulation TF

More information

Fireworks 3 Animation and Rollovers

Fireworks 3 Animation and Rollovers Fireworks 3 Animation and Rollovers What is Fireworks Fireworks is Web graphics program designed by Macromedia. It enables users to create any sort of graphics as well as to import GIF, JPEG, PNG photos

More information

Food and Drug Administration

Food and Drug Administration Food and Drug Administration FDA Electronic Submissions Gateway Tutorial WebTrader Hosted Solution (WTHS): Making Electronic Submissions Document Version Date: 04/28/2014 Page 1 of 9 1. OVERVIEW Organizations

More information

Hadoopizer : a cloud environment for bioinformatics data analysis

Hadoopizer : a cloud environment for bioinformatics data analysis Hadoopizer : a cloud environment for bioinformatics data analysis Anthony Bretaudeau (1), Olivier Sallou (2), Olivier Collin (3) (1) [email protected], INRIA/Irisa, Campus de Beaulieu, 35042,

More information

How to install and use the File Sharing Outlook Plugin

How to install and use the File Sharing Outlook Plugin How to install and use the File Sharing Outlook Plugin Thank you for purchasing Green House Data File Sharing. This guide will show you how to install and configure the Outlook Plugin on your desktop.

More information

Chapter 2. imapper: A web server for the automated analysis and mapping of insertional mutagenesis sequence data against Ensembl genomes

Chapter 2. imapper: A web server for the automated analysis and mapping of insertional mutagenesis sequence data against Ensembl genomes Chapter 2. imapper: A web server for the automated analysis and mapping of insertional mutagenesis sequence data against Ensembl genomes 2.1 Introduction Large-scale insertional mutagenesis screening in

More information

Basic processing of next-generation sequencing (NGS) data

Basic processing of next-generation sequencing (NGS) data Basic processing of next-generation sequencing (NGS) data Getting from raw sequence data to expression analysis! 1 Reminder: we are measuring expression of protein coding genes by transcript abundance

More information

-> Integration of MAPHiTS in Galaxy

-> Integration of MAPHiTS in Galaxy Enabling NGS Analysis with(out) the Infrastructure, 12:0512 Development of a workflow for SNPs detection in grapevine From Sets to Graphs: Towards a Realistic Enrichment Analy species: MAPHiTS -> Integration

More information

Tutorial for proteome data analysis using the Perseus software platform

Tutorial for proteome data analysis using the Perseus software platform Tutorial for proteome data analysis using the Perseus software platform Laboratory of Mass Spectrometry, LNBio, CNPEM Tutorial version 1.0, January 2014. Note: This tutorial was written based on the information

More information

Module 10: Bioinformatics

Module 10: Bioinformatics Module 10: Bioinformatics 1.) Goal: To understand the general approaches for basic in silico (computer) analysis of DNA- and protein sequences. We are going to discuss sequence formatting required prior

More information

Searching Nucleotide Databases

Searching Nucleotide Databases Searching Nucleotide Databases 1 When we search a nucleic acid databases, Mascot always performs a 6 frame translation on the fly. That is, 3 reading frames from the forward strand and 3 reading frames

More information

Unipro UGENE User Manual Version 1.12.3

Unipro UGENE User Manual Version 1.12.3 Unipro UGENE User Manual Version 1.12.3 April 01, 2014 Contents 1 About Unipro................................... 10 1.1 Contacts.......................................... 10 2 About UGENE..................................

More information

CDUfiles User Guide. Chapter 1: Accessing your data with CDUfiles. Sign In. CDUfiles User Guide Page 1. Here are the first steps to using CDUfiles.

CDUfiles User Guide. Chapter 1: Accessing your data with CDUfiles. Sign In. CDUfiles User Guide Page 1. Here are the first steps to using CDUfiles. CDUfiles User Guide Chapter 1: Accessing your data with CDUfiles Here are the first steps to using CDUfiles. Sign In Open your web browser and enter cdufiles.cdu.edu.au or Note: Use cdufiles.egnyte.com

More information

Quick and Easy Web Maps with Google Fusion Tables. SCO Technical Paper

Quick and Easy Web Maps with Google Fusion Tables. SCO Technical Paper Quick and Easy Web Maps with Google Fusion Tables SCO Technical Paper Version History Version Date Notes Author/Contact 1.0 July, 2011 Initial document created. Howard Veregin 1.1 Dec., 2011 Updated to

More information

Analysis and Integration of Big Data from Next-Generation Genomics, Epigenomics, and Transcriptomics

Analysis and Integration of Big Data from Next-Generation Genomics, Epigenomics, and Transcriptomics Analysis and Integration of Big Data from Next-Generation Genomics, Epigenomics, and Transcriptomics Christopher Benner, PhD Director, Integrative Genomics and Bioinformatics Core (IGC) idash Webinar,

More information

CRM Knowledge Base. Contents

CRM Knowledge Base. Contents Contents Overview:... 2 The Article Record:... 3 Searching for Articles... 3 Quick Search... 3 Article Groups... 5 Using Favorites... 5 Adding New Articles... 6 Maintaining Articles... 8 Groups... 9 Keywords...

More information

RAST Automated Analysis. What is RAST for?

RAST Automated Analysis. What is RAST for? RAST Automated Analysis Gordon D. Pusch Fellowship for Interpretation of Genomes What is RAST for? RAST is designed to rapidly call and annotate the genes of a complete or essentially complete prokaryotic

More information

Biology asks six kinds of questions

Biology asks six kinds of questions BIOINFO LANGUAGE: SEQUENCE FORMATS/CONVERSION ATGATGTCGATTTCGGCTTTTCCTTTAAGTGTA GGAATTGCGTTTGCTACGTTGAGTTACTTTTTA CTAAAGGTAAATGGATGTATTTATATGTGTATG TGTTTGGAAATAT Raphael D. Isokpehi, PhD, Cynthia Jeffries,

More information

Central Management Software CV3-M1024

Central Management Software CV3-M1024 Table of Contents Chapter 1. User Interface Overview...5 Chapter 2. Installation...6 2.1 Beginning Installation...6 2.2 Starting the CMS software...10 2.3 Starting it from the Start menu...10 2.4 Starting

More information

A Tutorial in Genetic Sequence Classification Tools and Techniques

A Tutorial in Genetic Sequence Classification Tools and Techniques A Tutorial in Genetic Sequence Classification Tools and Techniques Jake Drew Data Mining CSE 8331 Southern Methodist University [email protected] www.jakemdrew.com Sequence Characters IUPAC nucleotide

More information

Instruction for IE network monitor

Instruction for IE network monitor Instruction for IE network monitor This system features a built-in browser-based software that allows you to access your system remotely over your local area network (LAN) or over the Internet (WAN) using

More information

Biological Databases and Protein Sequence Analysis

Biological Databases and Protein Sequence Analysis Biological Databases and Protein Sequence Analysis Introduction M. Madan Babu, Center for Biotechnology, Anna University, Chennai 25, India Bioinformatics is the application of Information technology to

More information

Writing & Running Pipelines on the Open Grid Engine using QMake. Wibowo Arindrarto DTLS Focus Meeting 15.04.2014

Writing & Running Pipelines on the Open Grid Engine using QMake. Wibowo Arindrarto DTLS Focus Meeting 15.04.2014 Writing & Running Pipelines on the Open Grid Engine using QMake Wibowo Arindrarto DTLS Focus Meeting 15.04.2014 Makefile (re)introduction Atomic recipes / rules that define full pipelines Initially written

More information

INTRODUCTION to ESRI ARCGIS For Visualization, CPSC 178

INTRODUCTION to ESRI ARCGIS For Visualization, CPSC 178 INTRODUCTION to ESRI ARCGIS For Visualization, CPSC 178 1) Navigate to the C:/temp folder 2) Make a directory using your initials. 3) Use your web browser to navigate to www.library.yale.edu/mapcoll/ and

More information

Introduction to NGS data analysis

Introduction to NGS data analysis Introduction to NGS data analysis Jeroen F. J. Laros Leiden Genome Technology Center Department of Human Genetics Center for Human and Clinical Genetics Sequencing Illumina platforms Characteristics: High

More information

IntelliSpace PACS 4.4. Image Enabled EMR Workflow and Enterprise Overview. Learning Objectives

IntelliSpace PACS 4.4. Image Enabled EMR Workflow and Enterprise Overview. Learning Objectives IntelliSpace PACS 4.4 Image Enabled EMR Workflow and Enterprise Overview Learning Objectives Use the Cerner EMR to view images and reports via IntelliSpace PACS: Image Launch Workflow (SUBI Image Viewer)

More information

Exercises for the UCSC Genome Browser Introduction

Exercises for the UCSC Genome Browser Introduction Exercises for the UCSC Genome Browser Introduction 1) Find out if the mouse Brca1 gene has non-synonymous SNPs, color them blue, and get external data about a codon-changing SNP. Skills: basic text search;

More information

WebCenter 14.0.1 Release notes

WebCenter 14.0.1 Release notes WebCenter 14.0.1 Release notes 1. Introduction This document gives a quick overview of the new features and changes in WebCenter 14.0.1. It only covers the changes since the latest release of WebCenter

More information

Content Management System QUICK START GUIDE

Content Management System QUICK START GUIDE Content Management System QUICK START GUIDE Revised 03/10/11 TABLE OF CONTENTS Pg. 1... Logging In Pg. 2... Navigating to your site folder Pg. 2... The Folder Tree, Site Structure and Wire Frames Explained.

More information

A Complete Example of Next- Gen DNA Sequencing Read Alignment. Presentation Title Goes Here

A Complete Example of Next- Gen DNA Sequencing Read Alignment. Presentation Title Goes Here A Complete Example of Next- Gen DNA Sequencing Read Alignment Presentation Title Goes Here 1 FASTQ Format: The de- facto file format for sharing sequence read data Sequence and a per- base quality score

More information

Visualisation tools for next-generation sequencing

Visualisation tools for next-generation sequencing Visualisation tools for next-generation sequencing Simon Anders EBI is an Outstation of the European Molecular Biology Laboratory. Outline Exploring and checking alignment with alignment viewers Using

More information

LifeScope Genomic Analysis Software 2.5

LifeScope Genomic Analysis Software 2.5 USER GUIDE LifeScope Genomic Analysis Software 2.5 Graphical User Interface DATA ANALYSIS METHODS AND INTERPRETATION Publication Part Number 4471877 Rev. A Revision Date November 2011 For Research Use

More information

Generative Drafting. Page 1 1997 2001 DASSAULT SYSTEMES. IBM Product Lifecycle Management Solutions / Dassault Systemes

Generative Drafting. Page 1 1997 2001 DASSAULT SYSTEMES. IBM Product Lifecycle Management Solutions / Dassault Systemes Generative Drafting Page 1 Tutorial Objectives Description This Tutorial is an introduction to Generative Drafting. Message To show how CATIA V5 allows the user to automatically generate associative drafting

More information

Data Visualization. Brief Overview of ArcMap

Data Visualization. Brief Overview of ArcMap Data Visualization Prepared by Francisco Olivera, Ph.D., P.E., Srikanth Koka and Lauren Walker Department of Civil Engineering September 13, 2006 Contents: Brief Overview of ArcMap Goals of the Exercise

More information

Easy Manage Helpdesk Guide version 5.4

Easy Manage Helpdesk Guide version 5.4 Easy Manage Helpdesk Guide version 5.4 Restricted Rights Legend COPYRIGHT Copyright 2011 by EZManage B.V. All rights reserved. No part of this publication or software may be reproduced, transmitted, stored

More information

Hierarchical Clustering Analysis

Hierarchical Clustering Analysis Hierarchical Clustering Analysis What is Hierarchical Clustering? Hierarchical clustering is used to group similar objects into clusters. In the beginning, each row and/or column is considered a cluster.

More information

Unipro UGENE Manual. Version 1.20.0

Unipro UGENE Manual. Version 1.20.0 Unipro UGENE Manual Version 1.20.0 December 16, 2015 Unipro UGENE Online User Manual About Unipro About UGENE Key Features User Interface High Performance Computing Cooperation Download and Installation

More information

Investigating World Development with a GIS

Investigating World Development with a GIS Investigating World Development with a GIS Economic and human development is not consistent across the world. Some countries have developed more quickly than others and we call these countries MEDCs (More

More information

Updated CellTracker software manual

Updated CellTracker software manual Updated CellTracker software manual Chengjin Du, Till Bretschneider The software is developed based on the former version of CellTracker (http://dbkgroup.org/celltracker/). All the menu and functions of

More information

NGS Data Analysis: An Intro to RNA-Seq

NGS Data Analysis: An Intro to RNA-Seq NGS Data Analysis: An Intro to RNA-Seq March 25th, 2014 GST Colloquim: March 25th, 2014 1 / 1 Workshop Design Basics of NGS Sample Prep RNA-Seq Analysis GST Colloquim: March 25th, 2014 2 / 1 Experimental

More information

Quick Guide. WebNow. Description. Logging on to WebNow. Document Management System

Quick Guide. WebNow. Description. Logging on to WebNow. Document Management System WebNow Description WebNow is an online, browser-based companion to the ImageNow document imaging, management and workflow software. WebNow shares some of the functionality of ImageNow searching, viewing,

More information

A Web Based Software for Synonymous Codon Usage Indices

A Web Based Software for Synonymous Codon Usage Indices International Journal of Information and Computation Technology. ISSN 0974-2239 Volume 3, Number 3 (2013), pp. 147-152 International Research Publications House http://www. irphouse.com /ijict.htm A Web

More information

Manual. Sealer Monitor Software. Version 0.10.7

Manual. Sealer Monitor Software. Version 0.10.7 Manual Sealer Monitor Software Version 0.10.7 Contents 1 Introduction & symbols 1 2 Installation 2 2.1 Requirements 2 2.2 Installation process 2 3 Menu & Tooblar 5 3.1 File menu 5 3.2 Print menu 6 3.3

More information

The Artemis Manual. Copyright 1999-2011 by Genome Research Limited

The Artemis Manual. Copyright 1999-2011 by Genome Research Limited The Artemis Manual Copyright 1999-2011 by Genome Research Limited This document describes release 13 of Artemis a DNA sequence viewer and sequence annotation tool. Artemis is free software; you can redistribute

More information

E. coli plasmid and gene profiling using Next Generation Sequencing

E. coli plasmid and gene profiling using Next Generation Sequencing E. coli plasmid and gene profiling using Next Generation Sequencing Jeroen F. J. Laros Leiden Genome Technology Center Department of Human Genetics Center for Human and Clinical Genetics Introduction General

More information

WebFOCUS BI Portal: S.I.M.P.L.E. as can be

WebFOCUS BI Portal: S.I.M.P.L.E. as can be WebFOCUS BI Portal: S.I.M.P.L.E. as can be Author: Matthew Lerner Company: Information Builders Presentation Abstract: This hands-on session will introduce attendees to the new WebFOCUS BI Portal. We will

More information

PubMed My NCBI: Saving Searches & Creating Email Alerts

PubMed My NCBI: Saving Searches & Creating Email Alerts PubMed My NCBI: Saving Searches & Creating Email Alerts My NCBI feature of PubMed allows you to: Save and rerun your search strategies Create an automatic e-mail notification of new articles Build a bibliography

More information

HOW TO MAKE YOUR WEBSITE

HOW TO MAKE YOUR WEBSITE HOW TO MAKE YOUR WEBSITE Use Netscape Composer to make your web page presentation of a 3D structure of your choosing. You will need to download a few template web pages from the biochemistry website, and

More information

WA2262 Applied Data Science and Big Data Analytics Boot Camp for Business Analysts. Classroom Setup Guide. Web Age Solutions Inc.

WA2262 Applied Data Science and Big Data Analytics Boot Camp for Business Analysts. Classroom Setup Guide. Web Age Solutions Inc. WA2262 Applied Data Science and Big Data Analytics Boot Camp for Business Analysts Classroom Setup Guide Web Age Solutions Inc. Copyright Web Age Solutions Inc. 1 Table of Contents Part 1 - Minimum Software

More information

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want 1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very

More information

DNA Sequence formats

DNA Sequence formats DNA Sequence formats [Plain] [EMBL] [FASTA] [GCG] [GenBank] [IG] [IUPAC] [How Genomatix represents sequence annotation] Plain sequence format A sequence in plain format may contain only IUPAC characters

More information

TUTORIAL 4 Building a Navigation Bar with Fireworks

TUTORIAL 4 Building a Navigation Bar with Fireworks TUTORIAL 4 Building a Navigation Bar with Fireworks This tutorial shows you how to build a Macromedia Fireworks MX 2004 navigation bar that you can use on multiple pages of your website. A navigation bar

More information

How To Use The Assembly Database In A Microarray (Perl) With A Microarcode) (Perperl 2) (For Macrogenome) (Genome 2)

How To Use The Assembly Database In A Microarray (Perl) With A Microarcode) (Perperl 2) (For Macrogenome) (Genome 2) The Ensembl Core databases and API Useful links Installation instructions: http://www.ensembl.org/info/docs/api/api_installation.html Schema description: http://www.ensembl.org/info/docs/api/core/core_schema.html

More information

Snagit 10. Getting Started Guide. March 2010. 2010 TechSmith Corporation. All rights reserved.

Snagit 10. Getting Started Guide. March 2010. 2010 TechSmith Corporation. All rights reserved. Snagit 10 Getting Started Guide March 2010 2010 TechSmith Corporation. All rights reserved. Introduction If you have just a few minutes or want to know just the basics, this is the place to start. This

More information

Customizing Confirmation Text and Emails for Donation Forms

Customizing Confirmation Text and Emails for Donation Forms Customizing Confirmation Text and Emails for Donation Forms You have complete control over the look & feel and text used in your donation confirmation emails. Each form in Sphere generates its own confirmation

More information

GETTING STARTED WITH COVALENT BROWSER

GETTING STARTED WITH COVALENT BROWSER GETTING STARTED WITH COVALENT BROWSER Contents Getting Started with Covalent Browser... 1 What is the Browser Version?... 4 Logging in... 5 The URL address... 5 Home page... 5 Menu bar... 5 Go To button...

More information

The Artemis Manual. Copyright 1999-2014 by Genome Research Limited

The Artemis Manual. Copyright 1999-2014 by Genome Research Limited The Artemis Manual Copyright 1999-2014 by Genome Research Limited This document describes release 16 of Artemis a DNA sequence viewer and sequence annotation tool. Artemis is free software; you can redistribute

More information

Guide for Data Visualization and Analysis using ACSN

Guide for Data Visualization and Analysis using ACSN Guide for Data Visualization and Analysis using ACSN ACSN contains the NaviCell tool box, the intuitive and user- friendly environment for data visualization and analysis. The tool is accessible from the

More information

Next generation sequencing (NGS)

Next generation sequencing (NGS) Next generation sequencing (NGS) Vijayachitra Modhukur BIIT [email protected] 1 Bioinformatics course 11/13/12 Sequencing 2 Bioinformatics course 11/13/12 Microarrays vs NGS Sequences do not need to be known

More information

BioHPC Web Computing Resources at CBSU

BioHPC Web Computing Resources at CBSU BioHPC Web Computing Resources at CBSU 3CPG workshop Robert Bukowski Computational Biology Service Unit http://cbsu.tc.cornell.edu/lab/doc/biohpc_web_tutorial.pdf BioHPC infrastructure at CBSU BioHPC Web

More information

PTC Integrity Integration with Microsoft Visual Studio PTC Integrity 10.8

PTC Integrity Integration with Microsoft Visual Studio PTC Integrity 10.8 PTC Integrity Integration with Microsoft Visual Studio PTC Integrity 10.8 Copyright 2015 PTC Inc. and/or Its Subsidiary Companies. All Rights Reserved. User and training guides and related documentation

More information

Registering with Cisco UCM

Registering with Cisco UCM FLX VoIP Registering with Cisco UCM Date: May 15 th, 2012 This technical note gives a detailed description on how to register a Revolabs FLX conference phone with a Cisco Unified Communications Manager

More information

6. If you want to enter specific formats, click the Format Tab to auto format the information that is entered into the field.

6. If you want to enter specific formats, click the Format Tab to auto format the information that is entered into the field. Adobe Acrobat Professional X Part 3 - Creating Fillable Forms Preparing the Form Create the form in Word, including underlines, images and any other text you would like showing on the form. Convert the

More information

UNIVERSITY OF CALGARY Information Technologies WEBFORMS DRUPAL 7 WEB CONTENT MANAGEMENT

UNIVERSITY OF CALGARY Information Technologies WEBFORMS DRUPAL 7 WEB CONTENT MANAGEMENT UNIVERSITY OF CALGARY Information Technologies WEBFORMS DRUPAL 7 WEB CONTENT MANAGEMENT Table of Contents Creating a Webform First Steps... 1 Form Components... 2 Component Types.......4 Conditionals...

More information

STAAR Assessment Management System User s Guide. STAAR Grades 3 8 and End-of-Course Assessments

STAAR Assessment Management System User s Guide. STAAR Grades 3 8 and End-of-Course Assessments STAAR Assessment Management System User s Guide STAAR Grades 3 8 and End-of-Course Assessments March 2, 2016 Student Assessment Division Texas Education Agency 1701 N. Congress Avenue Austin, TX 78701-1494

More information

AutoDWG DWGSee DWG Viewer. DWGSee User Guide

AutoDWG DWGSee DWG Viewer. DWGSee User Guide DWGSee User Guide DWGSee is comprehensive software for viewing, printing, marking and sharing DWG files. It is fast, powerful and easy-to-use for every expert and beginners. Starting DWGSee After you install

More information

Banner Document Management Suite (BDMS) Web Access Help

Banner Document Management Suite (BDMS) Web Access Help May 10 th, 2011 Banner Document Management Suite (BDMS) Web Access Help Division of Information Technology AppXtender Web Access Help: For questions regarding AppXtender Web Access, please contact the

More information

OPENPROJECT. Setup Draft Notes. Draft Setup notes for Openproject

OPENPROJECT. Setup Draft Notes. Draft Setup notes for Openproject OPENPROJECT Setup Draft Notes Draft Setup notes for Openproject Contents Introduction... 2 Application Installation... 2 Configuring the Plugins... 2 Configure the Help link... 2 Configure the Costs Plugin...

More information

Hamline University Administrative Computing Page 1

Hamline University Administrative Computing Page 1 User Guide Banner Handout: BUSINESS OBJECTS ENTERPRISE (InfoView) Document: boxi31sp3-infoview.docx Created: 5/11/2011 1:24 PM by Chris Berry; Last Modified: 8/31/2011 1:53 PM Purpose:... 2 Introduction:...

More information