Next Generation Sequencing Data Visualization
|
|
|
- Angela Norman
- 10 years ago
- Views:
Transcription
1 Next Generation Sequencing Data Visualization GBrowse2 from GMOD Andreas Gisel Institute for Biomedical Technologies CNR Bari - Italy
2 GMOD is the Generic Model Organism Database project GMOD is a collection of interconnected applications and databases that biologists use as repositories and as tools. That connectivity is really the key here. There's no lack of tools, but many of these tools will be little used since the typical prospective user may not have the resources or expertise required to install the tool and connect it, in some way, to the data in hand.
3 The tutorial will show: how to display a reference sequence with feature in GBrowse2 how to display Next Generation Sequencing (NGS) mapping data. We will use Escherichia coli str. K-12 substr. DH10B, complete genome - NC_ (ref1.fa) and Illumina pair-end reads1.fa and reads2.fa
4 GBrowse2
5 GBrowse2
6 GBrowse2 /etc/gbrowse2/
7 GBrowse2 /var/lib/gbrowse2/databases Text
8 GBrowse2 Set-up the gbrowser for E.coli data We have: Reference sequence data in FASTA Annotation for the reference sequence in GFF
9 GBrowse2 Set-up the gbrowser for E.coli data We have: Reference sequence data in FASTA Annotation for the reference sequence in GFF We need: E. coli configuration file Add E.coli informatio to the general GBrowse.conf file Add data to the coresponding database
10 Annotation Data Formats EMBL annotation files GeneBank annotation files GFF files
11 GeneBank format LOCUS HQ bp DNA circular PLN 22-DEC-2010 DEFINITION Prunus persica chloroplast, complete genome. ACCESSION HQ VERSION HQ GI: KEYWORDS. SOURCE chloroplast Prunus persica (peach) ORGANISM Prunus persica Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus. REFERENCE 1 (bases 1 to ) AUTHORS Jansen,R.K., Saski,C., Lee,S.B., Hansen,A.K. and Daniell,H. TITLE Complete Plastid Genome Sequences of Three Rosids (Castanea, Prunus, Theobroma): Evidence for At Least Two Independent Transfers of rpl22 to the Nucleus JOURNAL Mol. Biol. Evol. 28 (1), (2011) PUBMED REFERENCE 2 (bases 1 to ) AUTHORS Jansen,R.K., Saski,C., Lee,S.-B., Hansen,A.K. and Daniell,H. TITLE JOURNAL Direct Submission Submitted (28-SEP-2010) Integrative Biology, University of Texas at Austin, 1 University Station C0930, Austin, TX 78712, USA
12 GeneBank format FEATURES Location/Qualifiers source /organism="prunus persica" /organelle="plastid:chloroplast" /mol_type="genomic DNA" /db_xref="taxon:3760" gene complement(join( , )) /gene="rps12" /trans_splicing CDS complement(join( , , )) /gene="rps12" /trans_splicing /codon_start=1 /transl_table=11 /product="ribosomal protein S12" /protein_id="ado " /db_xref="gi: " /translation="mptikqlirntrqpirnvtkspalggcpqrrgtctrvytitpkk PNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTL DAVGVKDRQQGRSKYGVKKPK"
13 GeneBank format ORIGIN 1 tgggcgaacg acgggaattg aacccgcgca tggtggattc acaatccact gccttgatcc 61 acttggctac atccgcccct tatactatta caaatattta caccatttat cattacttgt 121 aagataaaat acaacataaa ataaactgaa acttttaata ttttaattaa attttgtagt 181 aaattaacta aaaaaaaata tagaacaaaa caatatagta aagttaagta gtaaataaaa 241 aaaatactaa atagtaaagg agcaataaca aacctcttga tataacaaga aatttattat 301 tgctccttta ctttcaagaa ctcctatata ctaagaccaa agtcttatcc atttatagat 361 ggaacttcaa cagcagctag atctagaggg aaattatggg cattacgttc atgcataact 421 tccataccaa ggttagcgcg gttaataata tcagcccaag tattaattac acgaccctga 481 ctatcaacta cagattgatt gaaattaaaa ccatttaagt tgaaagccat agtgctgata 541 cctaaagcgg taaaccagat acctactaca ggccaagcag ctaggaagaa atgtaaagaa 601 cgagaattgt tgaaactagc atattggaag atcaatcggc caaaataacc atgagcggct 661 acgatattat aggtttcttc ctcttgaccg aatctgtaac cttcattagc agattcattt 721 tctgtggttt ccctgatcaa actagaggtt accaaggacc catgcatagc actgaatagg 781 gagccgccga atacaccagc tacgcctaac atgtgaaatg ggtgcataag gatgttgtgc 841 tcggcttgga atacaatcat gaagttgaaa gtaccggaga ttcctagggg cataccgtca 901 gaaaagcttc cttgaccaat tggatatatc aagaaaacag cagtagcagc tgcaacagga 961 gctgaatatg caacagcaat ccaagggcgc atacccagac ggaaactaag ttcccactca 1021 cgacccatgt agcaagctac accaagtaag aagtgtagaa caattagttc ataaggacca 1081 ccgttgtata accattcatc aacggaagcc gcttcccata tcgggtaaaa gtgcaaacct 1141 atagctgcag aggtaggaat aatggcacca gaaataatat tgtttccata aagtaaagat 1201 ccagaaacag gttcacgaat accatcaata tctactggag gtgcagcaat gaaagcaata
14 GFF format ##gff-version 3 # sequence-region HQ # conversion-by bp_genbank2gff3.pl # organism Prunus persica # date 22-DEC-2010 # Note Prunus persica chloroplast, complete genome. # working on region:hq336405, Prunus persica, 22-DEC-2010, Prunus persica chloroplast, complete genome. # Possible gene unflattening error withhq336405: consult STDERR HQ336405!GenBank! region! 1! !.! +!.! ID=HQ336405;Dbxref=taxon:3760;Note=Prunus persica chloroplast complete genome;date=22-dec-2010;mol_type=genomic DNA;organelle=plastid:chloroplast;organism=Prunus persica HQ336405!GenBank! CDS!99804! 99829!.! -!.! ID=rps12;Dbxref=GI: ;codon_start=1;gene=rps12;product=ribosomal protein S12;protein_id=ADO ;trans_splicing=_no_value;transl_table=11;translation=length.123 HQ336405!GenBank! CDS!100366! !.! -!.! ID=rps12;Dbxref=GI: ;codon_start=1;gene=rps12;product=ribosomal protein S12;protein_id=ADO ;trans_splicing=_no_value;transl_table=11;translation=length.123 HQ336405!GenBank! CDS!71346! 71459!.! -!.! ID=rps12;Dbxref=GI: ;codon_start=1;gene=rps12;product=ribosomal protein S12;protein_id=ADO ;trans_splicing=_no_value;transl_table=11;translation=length.123 HQ336405!GenBank! gene!99804! !.! -!. ID=rps12;gene=rps12;trans_splicing=_no_value HQ336405!GenBank! gene!71346! 71459!.! -!. ID=rps12;gene=rps12;trans_splicing=_no_value HQ336405!GenBank! gene!3! 77!.! -!.! ID=trnH-GUG;gene=trnH-GUG HQ336405!GenBank! trna!3! 77!.! -!.! ID=trnH-GUG.r01;Parent=trnH GUG;Note=anticodon:GUG;gene=trnH-GUG;product=tRNA-His
15 GBrowse2 Create and configure the tracks visualizing the date of E.coli [GENERAL] description = Escherichia coli str. K-12 substr. DH10B database = annotations initial landmark = NC_ : # bring in the special Submitter plugin for the rubber-band select menu plugins = FastaDumper RestrictionAnnotator SequenceDumper TrackDumper Submitter S autocomplete = 1 default tracks = Genes ORFs trnas CDS Transp Centro:overview GC:region # examples to show in the introduction examples = NC_ : # "automatic" classes to try when an unqualified identifier is given automatic classes = Symbol Gene Clone
16 GBrowse2 Create and configure the tracks visualizing the date of E.coli ################################# # database definitions ################################# [scaffolds:database] db_adaptor = Bio::DB::SeqFeature::Store db_args = -adaptor memory -dir /var/lib/gbrowse2/databases/ecoli_seq search options = default +autocomplete [annotations:database] db_adaptor = Bio::DB::SeqFeature::Store db_args = -adaptor memory -dir /var/lib/gbrowse2/databases/ecoli_annotations search options = default +autocomplete
17 GBrowse2 Create and configure the tracks visualizing the date of E.coli # Default glyph settings [TRACK DEFAULTS] glyph = generic database = annotations height = 8 bgcolor = cyan fgcolor = black label density = 25 bump density = 100 show summary = # go into summary mode when zoomed out to 100k # default pop-up balloon balloon hover = <b>$name</b> is a $type spanning $ref from $start to $end. Click for more details. [CDS] feature = gene glyph = cds description = 0 height = 26 sixframe = 1 label = sub {shift->name. " reading frame"} key = CDS balloon click width = 500 balloon hover width = 350 balloon hover = <b>$name</b> is a $type spanning $ref from $start to $end. Click to search Google for $name. balloon click = citation = This track shows CDS reading frames.
18 GBrowse2 Insert E.coli in the general GBrowse config file ############################################################################## # # DATASOURCE DEFINITIONS # One stanza for each configured data source # ############################################################################## [yeast] description = Yeast chromosomes 1+2 (basic) path = yeast_simple.conf [yeast_advanced] description = Yeast chromosomes 1+2 (advanced) path = yeast_chr1+2.conf [ecoli] description = Escherichia coli str. K-12 substr. DH10B path = ecoli.conf
19 GBrowse2 Add data to databases ################################# # database definitions ################################# [scaffolds:database] db_adaptor = Bio::DB::SeqFeature::Store db_args = -adaptor memory -dir /var/lib/gbrowse2/databases/ecoli_seq search options = default +autocomplete [annotations:database] db_adaptor = Bio::DB::SeqFeature::Store db_args = -adaptor memory -dir /var/lib/gbrowse2/databases/ecoli_annotations search options = default +autocomplete Create: /var/lib/gbrowse2/databases/ecoli_seq /var/lib/gbrowse2/databases/ecoli_annotations
20 GBrowse2 Add data to databases Move to: /var/lib/gbrowse2/databases/ecoli_seq - ref1.fa - chromosomes.gff3 /var/lib/gbrowse2/databases/ecoli_annotations - NC_ gff
21 GBrowse2
22 Create mapping data Map with bowtie: index: bowtie-build -f ref1.fa ref1 map: bowtie -n 1 -l 30 -I 0 -X un unmapped -p 2 -S ref/ ref1-1 illumina/reads1.fq -2 illumina/reads2.fq > pair.sam SAM to BAM: index: samtools faidx ref1.fa SAM to BAM: samtools import ref1.fa.fai pair.sam pair.bam sort BAM: samtools sort pair.bam pair_sorted index BAM: samtools index pair_sorted.bam
23 Modify the ecoli.conf Add database: [ecolisam:database] db_adaptor = Bio::DB::Sam db_args = -fasta /var/lib/gbrowse2/databases/ecolisam/ref1.fa -bam /var/lib/gbrowse2/databases/ecolisam/pair_sorted.bam search options = none Add tracks: [CoverageXyplot] feature = coverage glyph = wiggle_xyplot database = ecolisam height = 50 fgcolor = black bicolor_pivot = 20 pos_color = blue neg_color = red key = Coverage (xyplot) category = Reads label = 0 # Labels on wiggle tracks are redundant.
24 Create mapping database create directory ecolisam in /var/lib/gbrowse2/databases copy pair_sorted.bam and pair_sorted.bam.bai to ecolisam and set the right privileges to ecolisam so that the browser can access them
25 E.coli GBrowse
Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011
Sequence Formats and Sequence Database Searches Gloria Rendon SC11 Education June, 2011 Sequence A is the primary structure of a biological molecule. It is a chain of residues that form a precise linear
UGENE Quick Start Guide
Quick Start Guide This document contains a quick introduction to UGENE. For more detailed information, you can find the UGENE User Manual and other special manuals in project website: http://ugene.unipro.ru.
GenBank, Entrez, & FASTA
GenBank, Entrez, & FASTA Nucleotide Sequence Databases First generation GenBank is a representative example started as sort of a museum to preserve knowledge of a sequence from first discovery great repositories,
Tutorial for Windows and Macintosh. Preparing Your Data for NGS Alignment
Tutorial for Windows and Macintosh Preparing Your Data for NGS Alignment 2015 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) 1.734.769.7249
RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison
RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the
Tutorial. Reference Genome Tracks. Sample to Insight. November 27, 2015
Reference Genome Tracks November 27, 2015 Sample to Insight CLC bio, a QIAGEN Company Silkeborgvej 2 Prismet 8000 Aarhus C Denmark Telephone: +45 70 22 32 44 www.clcbio.com [email protected] Reference
Bioinformatics Resources at a Glance
Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences
Data formats and file conversions
Building Excellence in Genomics and Computational Bioscience s Richard Leggett (TGAC) John Walshaw (IFR) Common file formats FASTQ FASTA BAM SAM Raw sequence Alignments MSF EMBL UniProt BED WIG Databases
Databases and mapping BWA. Samtools
Databases and mapping BWA Samtools FASTQ, SFF, bax.h5 ACE, FASTG FASTA BAM/SAM GFF, BED GenBank/Embl/DDJB many more File formats FASTQ Output format from Illumina and IonTorrent sequencers. Quality scores:
SeattleSNPs Interactive Tutorial: Web Tools for Site Selection, Linkage Disequilibrium and Haplotype Analysis
SeattleSNPs Interactive Tutorial: Web Tools for Site Selection, Linkage Disequilibrium and Haplotype Analysis Goal: This tutorial introduces several websites and tools useful for determining linkage disequilibrium
Microsoft Visual Studio Integration Guide
Microsoft Visual Studio Integration Guide MKS provides a number of integrations for Integrated Development Environments (IDEs). IDE integrations allow you to access MKS Integrity s workflow and configuration
Version 5.0 Release Notes
Version 5.0 Release Notes 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) +1.734.769.7249 (elsewhere) +1.734.769.7074 (fax) www.genecodes.com
Analysis of ChIP-seq data in Galaxy
Analysis of ChIP-seq data in Galaxy November, 2012 Local copy: https://galaxy.wi.mit.edu/ Joint project between BaRC and IT Main site: http://main.g2.bx.psu.edu/ 1 Font Conventions Bold and blue refers
IGV User Guide. User Interface Main Window. This guide describes the Integrative Genomics Viewer (IGV).
IGV User Guide This guide describes the Integrative Genomics Viewer (IGV). To start IGV, go to the IGV downloads page: http://www.broadinstitute.org/igv/download. Look at a printer-friendly HTML version
Lecture Outline. Introduction to Databases. Introduction. Data Formats Sample databases How to text search databases. Shifra Ben-Dor Irit Orr
Introduction to Databases Shifra Ben-Dor Irit Orr Lecture Outline Introduction Data and Database types Database components Data Formats Sample databases How to text search databases What units of information
CLC Sequence Viewer USER MANUAL
CLC Sequence Viewer USER MANUAL Manual for CLC Sequence Viewer 7.6.1 Windows, Mac OS X and Linux September 3, 2015 This software is for research purposes only. QIAGEN Aarhus A/S Silkeborgvej 2 Prismet
Data Visualization. Prepared by Francisco Olivera, Ph.D., Srikanth Koka Department of Civil Engineering Texas A&M University February 2004
Data Visualization Prepared by Francisco Olivera, Ph.D., Srikanth Koka Department of Civil Engineering Texas A&M University February 2004 Contents Brief Overview of ArcMap Goals of the Exercise Computer
Fast. Integrated Genome Browser & DAS. Easy. Flexible. Free. bioviz.org/igb
bioviz.org/igb Integrated Genome Browser & DAS Free tools for visualizing, sharing, and publishing genomes and genome-scale data. Easy Flexible Fast Free Funding: National Science Foundation Arabidopsis
GenBank: A Database of Genetic Sequence Data
GenBank: A Database of Genetic Sequence Data Computer Science 105 Boston University David G. Sullivan, Ph.D. An Explosion of Scientific Data Scientists are generating ever increasing amounts of data. Relevant
JOOMLA 2.5 MANUAL WEBSITEDESIGN.CO.ZA
JOOMLA 2.5 MANUAL WEBSITEDESIGN.CO.ZA All information presented in the document has been acquired from http://docs.joomla.org to assist you with your website 1 JOOMLA 2.5 MANUAL WEBSITEDESIGN.CO.ZA BACK
When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want
1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very
Analysis of NGS Data
Analysis of NGS Data Introduction and Basics Folie: 1 Overview of Analysis Workflow Images Basecalling Sequences denovo - Sequencing Assembly Annotation Resequencing Alignments Comparison to reference
Module 1. Sequence Formats and Retrieval. Charles Steward
The Open Door Workshop Module 1 Sequence Formats and Retrieval Charles Steward 1 Aims Acquaint you with different file formats and associated annotations. Introduce different nucleotide and protein databases.
Exercise with Gene Ontology - Cytoscape - BiNGO
Exercise with Gene Ontology - Cytoscape - BiNGO This practical has material extracted from http://www.cbs.dtu.dk/chipcourse/exercises/ex_go/goexercise11.php In this exercise we will analyze microarray
Comparing Methods for Identifying Transcription Factor Target Genes
Comparing Methods for Identifying Transcription Factor Target Genes Alena van Bömmel (R 3.3.73) Matthew Huska (R 3.3.18) Max Planck Institute for Molecular Genetics Folie 1 Transcriptional Regulation TF
Fireworks 3 Animation and Rollovers
Fireworks 3 Animation and Rollovers What is Fireworks Fireworks is Web graphics program designed by Macromedia. It enables users to create any sort of graphics as well as to import GIF, JPEG, PNG photos
Food and Drug Administration
Food and Drug Administration FDA Electronic Submissions Gateway Tutorial WebTrader Hosted Solution (WTHS): Making Electronic Submissions Document Version Date: 04/28/2014 Page 1 of 9 1. OVERVIEW Organizations
Hadoopizer : a cloud environment for bioinformatics data analysis
Hadoopizer : a cloud environment for bioinformatics data analysis Anthony Bretaudeau (1), Olivier Sallou (2), Olivier Collin (3) (1) [email protected], INRIA/Irisa, Campus de Beaulieu, 35042,
How to install and use the File Sharing Outlook Plugin
How to install and use the File Sharing Outlook Plugin Thank you for purchasing Green House Data File Sharing. This guide will show you how to install and configure the Outlook Plugin on your desktop.
Chapter 2. imapper: A web server for the automated analysis and mapping of insertional mutagenesis sequence data against Ensembl genomes
Chapter 2. imapper: A web server for the automated analysis and mapping of insertional mutagenesis sequence data against Ensembl genomes 2.1 Introduction Large-scale insertional mutagenesis screening in
Basic processing of next-generation sequencing (NGS) data
Basic processing of next-generation sequencing (NGS) data Getting from raw sequence data to expression analysis! 1 Reminder: we are measuring expression of protein coding genes by transcript abundance
-> Integration of MAPHiTS in Galaxy
Enabling NGS Analysis with(out) the Infrastructure, 12:0512 Development of a workflow for SNPs detection in grapevine From Sets to Graphs: Towards a Realistic Enrichment Analy species: MAPHiTS -> Integration
Tutorial for proteome data analysis using the Perseus software platform
Tutorial for proteome data analysis using the Perseus software platform Laboratory of Mass Spectrometry, LNBio, CNPEM Tutorial version 1.0, January 2014. Note: This tutorial was written based on the information
Module 10: Bioinformatics
Module 10: Bioinformatics 1.) Goal: To understand the general approaches for basic in silico (computer) analysis of DNA- and protein sequences. We are going to discuss sequence formatting required prior
Searching Nucleotide Databases
Searching Nucleotide Databases 1 When we search a nucleic acid databases, Mascot always performs a 6 frame translation on the fly. That is, 3 reading frames from the forward strand and 3 reading frames
Unipro UGENE User Manual Version 1.12.3
Unipro UGENE User Manual Version 1.12.3 April 01, 2014 Contents 1 About Unipro................................... 10 1.1 Contacts.......................................... 10 2 About UGENE..................................
CDUfiles User Guide. Chapter 1: Accessing your data with CDUfiles. Sign In. CDUfiles User Guide Page 1. Here are the first steps to using CDUfiles.
CDUfiles User Guide Chapter 1: Accessing your data with CDUfiles Here are the first steps to using CDUfiles. Sign In Open your web browser and enter cdufiles.cdu.edu.au or Note: Use cdufiles.egnyte.com
Quick and Easy Web Maps with Google Fusion Tables. SCO Technical Paper
Quick and Easy Web Maps with Google Fusion Tables SCO Technical Paper Version History Version Date Notes Author/Contact 1.0 July, 2011 Initial document created. Howard Veregin 1.1 Dec., 2011 Updated to
Analysis and Integration of Big Data from Next-Generation Genomics, Epigenomics, and Transcriptomics
Analysis and Integration of Big Data from Next-Generation Genomics, Epigenomics, and Transcriptomics Christopher Benner, PhD Director, Integrative Genomics and Bioinformatics Core (IGC) idash Webinar,
CRM Knowledge Base. Contents
Contents Overview:... 2 The Article Record:... 3 Searching for Articles... 3 Quick Search... 3 Article Groups... 5 Using Favorites... 5 Adding New Articles... 6 Maintaining Articles... 8 Groups... 9 Keywords...
RAST Automated Analysis. What is RAST for?
RAST Automated Analysis Gordon D. Pusch Fellowship for Interpretation of Genomes What is RAST for? RAST is designed to rapidly call and annotate the genes of a complete or essentially complete prokaryotic
Biology asks six kinds of questions
BIOINFO LANGUAGE: SEQUENCE FORMATS/CONVERSION ATGATGTCGATTTCGGCTTTTCCTTTAAGTGTA GGAATTGCGTTTGCTACGTTGAGTTACTTTTTA CTAAAGGTAAATGGATGTATTTATATGTGTATG TGTTTGGAAATAT Raphael D. Isokpehi, PhD, Cynthia Jeffries,
Central Management Software CV3-M1024
Table of Contents Chapter 1. User Interface Overview...5 Chapter 2. Installation...6 2.1 Beginning Installation...6 2.2 Starting the CMS software...10 2.3 Starting it from the Start menu...10 2.4 Starting
A Tutorial in Genetic Sequence Classification Tools and Techniques
A Tutorial in Genetic Sequence Classification Tools and Techniques Jake Drew Data Mining CSE 8331 Southern Methodist University [email protected] www.jakemdrew.com Sequence Characters IUPAC nucleotide
Instruction for IE network monitor
Instruction for IE network monitor This system features a built-in browser-based software that allows you to access your system remotely over your local area network (LAN) or over the Internet (WAN) using
Biological Databases and Protein Sequence Analysis
Biological Databases and Protein Sequence Analysis Introduction M. Madan Babu, Center for Biotechnology, Anna University, Chennai 25, India Bioinformatics is the application of Information technology to
Writing & Running Pipelines on the Open Grid Engine using QMake. Wibowo Arindrarto DTLS Focus Meeting 15.04.2014
Writing & Running Pipelines on the Open Grid Engine using QMake Wibowo Arindrarto DTLS Focus Meeting 15.04.2014 Makefile (re)introduction Atomic recipes / rules that define full pipelines Initially written
INTRODUCTION to ESRI ARCGIS For Visualization, CPSC 178
INTRODUCTION to ESRI ARCGIS For Visualization, CPSC 178 1) Navigate to the C:/temp folder 2) Make a directory using your initials. 3) Use your web browser to navigate to www.library.yale.edu/mapcoll/ and
Introduction to NGS data analysis
Introduction to NGS data analysis Jeroen F. J. Laros Leiden Genome Technology Center Department of Human Genetics Center for Human and Clinical Genetics Sequencing Illumina platforms Characteristics: High
IntelliSpace PACS 4.4. Image Enabled EMR Workflow and Enterprise Overview. Learning Objectives
IntelliSpace PACS 4.4 Image Enabled EMR Workflow and Enterprise Overview Learning Objectives Use the Cerner EMR to view images and reports via IntelliSpace PACS: Image Launch Workflow (SUBI Image Viewer)
Exercises for the UCSC Genome Browser Introduction
Exercises for the UCSC Genome Browser Introduction 1) Find out if the mouse Brca1 gene has non-synonymous SNPs, color them blue, and get external data about a codon-changing SNP. Skills: basic text search;
WebCenter 14.0.1 Release notes
WebCenter 14.0.1 Release notes 1. Introduction This document gives a quick overview of the new features and changes in WebCenter 14.0.1. It only covers the changes since the latest release of WebCenter
Content Management System QUICK START GUIDE
Content Management System QUICK START GUIDE Revised 03/10/11 TABLE OF CONTENTS Pg. 1... Logging In Pg. 2... Navigating to your site folder Pg. 2... The Folder Tree, Site Structure and Wire Frames Explained.
A Complete Example of Next- Gen DNA Sequencing Read Alignment. Presentation Title Goes Here
A Complete Example of Next- Gen DNA Sequencing Read Alignment Presentation Title Goes Here 1 FASTQ Format: The de- facto file format for sharing sequence read data Sequence and a per- base quality score
Visualisation tools for next-generation sequencing
Visualisation tools for next-generation sequencing Simon Anders EBI is an Outstation of the European Molecular Biology Laboratory. Outline Exploring and checking alignment with alignment viewers Using
LifeScope Genomic Analysis Software 2.5
USER GUIDE LifeScope Genomic Analysis Software 2.5 Graphical User Interface DATA ANALYSIS METHODS AND INTERPRETATION Publication Part Number 4471877 Rev. A Revision Date November 2011 For Research Use
Generative Drafting. Page 1 1997 2001 DASSAULT SYSTEMES. IBM Product Lifecycle Management Solutions / Dassault Systemes
Generative Drafting Page 1 Tutorial Objectives Description This Tutorial is an introduction to Generative Drafting. Message To show how CATIA V5 allows the user to automatically generate associative drafting
Data Visualization. Brief Overview of ArcMap
Data Visualization Prepared by Francisco Olivera, Ph.D., P.E., Srikanth Koka and Lauren Walker Department of Civil Engineering September 13, 2006 Contents: Brief Overview of ArcMap Goals of the Exercise
Easy Manage Helpdesk Guide version 5.4
Easy Manage Helpdesk Guide version 5.4 Restricted Rights Legend COPYRIGHT Copyright 2011 by EZManage B.V. All rights reserved. No part of this publication or software may be reproduced, transmitted, stored
Hierarchical Clustering Analysis
Hierarchical Clustering Analysis What is Hierarchical Clustering? Hierarchical clustering is used to group similar objects into clusters. In the beginning, each row and/or column is considered a cluster.
Unipro UGENE Manual. Version 1.20.0
Unipro UGENE Manual Version 1.20.0 December 16, 2015 Unipro UGENE Online User Manual About Unipro About UGENE Key Features User Interface High Performance Computing Cooperation Download and Installation
Investigating World Development with a GIS
Investigating World Development with a GIS Economic and human development is not consistent across the world. Some countries have developed more quickly than others and we call these countries MEDCs (More
Updated CellTracker software manual
Updated CellTracker software manual Chengjin Du, Till Bretschneider The software is developed based on the former version of CellTracker (http://dbkgroup.org/celltracker/). All the menu and functions of
NGS Data Analysis: An Intro to RNA-Seq
NGS Data Analysis: An Intro to RNA-Seq March 25th, 2014 GST Colloquim: March 25th, 2014 1 / 1 Workshop Design Basics of NGS Sample Prep RNA-Seq Analysis GST Colloquim: March 25th, 2014 2 / 1 Experimental
Quick Guide. WebNow. Description. Logging on to WebNow. Document Management System
WebNow Description WebNow is an online, browser-based companion to the ImageNow document imaging, management and workflow software. WebNow shares some of the functionality of ImageNow searching, viewing,
A Web Based Software for Synonymous Codon Usage Indices
International Journal of Information and Computation Technology. ISSN 0974-2239 Volume 3, Number 3 (2013), pp. 147-152 International Research Publications House http://www. irphouse.com /ijict.htm A Web
Manual. Sealer Monitor Software. Version 0.10.7
Manual Sealer Monitor Software Version 0.10.7 Contents 1 Introduction & symbols 1 2 Installation 2 2.1 Requirements 2 2.2 Installation process 2 3 Menu & Tooblar 5 3.1 File menu 5 3.2 Print menu 6 3.3
The Artemis Manual. Copyright 1999-2011 by Genome Research Limited
The Artemis Manual Copyright 1999-2011 by Genome Research Limited This document describes release 13 of Artemis a DNA sequence viewer and sequence annotation tool. Artemis is free software; you can redistribute
E. coli plasmid and gene profiling using Next Generation Sequencing
E. coli plasmid and gene profiling using Next Generation Sequencing Jeroen F. J. Laros Leiden Genome Technology Center Department of Human Genetics Center for Human and Clinical Genetics Introduction General
WebFOCUS BI Portal: S.I.M.P.L.E. as can be
WebFOCUS BI Portal: S.I.M.P.L.E. as can be Author: Matthew Lerner Company: Information Builders Presentation Abstract: This hands-on session will introduce attendees to the new WebFOCUS BI Portal. We will
PubMed My NCBI: Saving Searches & Creating Email Alerts
PubMed My NCBI: Saving Searches & Creating Email Alerts My NCBI feature of PubMed allows you to: Save and rerun your search strategies Create an automatic e-mail notification of new articles Build a bibliography
HOW TO MAKE YOUR WEBSITE
HOW TO MAKE YOUR WEBSITE Use Netscape Composer to make your web page presentation of a 3D structure of your choosing. You will need to download a few template web pages from the biochemistry website, and
WA2262 Applied Data Science and Big Data Analytics Boot Camp for Business Analysts. Classroom Setup Guide. Web Age Solutions Inc.
WA2262 Applied Data Science and Big Data Analytics Boot Camp for Business Analysts Classroom Setup Guide Web Age Solutions Inc. Copyright Web Age Solutions Inc. 1 Table of Contents Part 1 - Minimum Software
When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want
1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very
DNA Sequence formats
DNA Sequence formats [Plain] [EMBL] [FASTA] [GCG] [GenBank] [IG] [IUPAC] [How Genomatix represents sequence annotation] Plain sequence format A sequence in plain format may contain only IUPAC characters
TUTORIAL 4 Building a Navigation Bar with Fireworks
TUTORIAL 4 Building a Navigation Bar with Fireworks This tutorial shows you how to build a Macromedia Fireworks MX 2004 navigation bar that you can use on multiple pages of your website. A navigation bar
How To Use The Assembly Database In A Microarray (Perl) With A Microarcode) (Perperl 2) (For Macrogenome) (Genome 2)
The Ensembl Core databases and API Useful links Installation instructions: http://www.ensembl.org/info/docs/api/api_installation.html Schema description: http://www.ensembl.org/info/docs/api/core/core_schema.html
Snagit 10. Getting Started Guide. March 2010. 2010 TechSmith Corporation. All rights reserved.
Snagit 10 Getting Started Guide March 2010 2010 TechSmith Corporation. All rights reserved. Introduction If you have just a few minutes or want to know just the basics, this is the place to start. This
Customizing Confirmation Text and Emails for Donation Forms
Customizing Confirmation Text and Emails for Donation Forms You have complete control over the look & feel and text used in your donation confirmation emails. Each form in Sphere generates its own confirmation
GETTING STARTED WITH COVALENT BROWSER
GETTING STARTED WITH COVALENT BROWSER Contents Getting Started with Covalent Browser... 1 What is the Browser Version?... 4 Logging in... 5 The URL address... 5 Home page... 5 Menu bar... 5 Go To button...
The Artemis Manual. Copyright 1999-2014 by Genome Research Limited
The Artemis Manual Copyright 1999-2014 by Genome Research Limited This document describes release 16 of Artemis a DNA sequence viewer and sequence annotation tool. Artemis is free software; you can redistribute
Guide for Data Visualization and Analysis using ACSN
Guide for Data Visualization and Analysis using ACSN ACSN contains the NaviCell tool box, the intuitive and user- friendly environment for data visualization and analysis. The tool is accessible from the
Next generation sequencing (NGS)
Next generation sequencing (NGS) Vijayachitra Modhukur BIIT [email protected] 1 Bioinformatics course 11/13/12 Sequencing 2 Bioinformatics course 11/13/12 Microarrays vs NGS Sequences do not need to be known
BioHPC Web Computing Resources at CBSU
BioHPC Web Computing Resources at CBSU 3CPG workshop Robert Bukowski Computational Biology Service Unit http://cbsu.tc.cornell.edu/lab/doc/biohpc_web_tutorial.pdf BioHPC infrastructure at CBSU BioHPC Web
PTC Integrity Integration with Microsoft Visual Studio PTC Integrity 10.8
PTC Integrity Integration with Microsoft Visual Studio PTC Integrity 10.8 Copyright 2015 PTC Inc. and/or Its Subsidiary Companies. All Rights Reserved. User and training guides and related documentation
Registering with Cisco UCM
FLX VoIP Registering with Cisco UCM Date: May 15 th, 2012 This technical note gives a detailed description on how to register a Revolabs FLX conference phone with a Cisco Unified Communications Manager
6. If you want to enter specific formats, click the Format Tab to auto format the information that is entered into the field.
Adobe Acrobat Professional X Part 3 - Creating Fillable Forms Preparing the Form Create the form in Word, including underlines, images and any other text you would like showing on the form. Convert the
UNIVERSITY OF CALGARY Information Technologies WEBFORMS DRUPAL 7 WEB CONTENT MANAGEMENT
UNIVERSITY OF CALGARY Information Technologies WEBFORMS DRUPAL 7 WEB CONTENT MANAGEMENT Table of Contents Creating a Webform First Steps... 1 Form Components... 2 Component Types.......4 Conditionals...
STAAR Assessment Management System User s Guide. STAAR Grades 3 8 and End-of-Course Assessments
STAAR Assessment Management System User s Guide STAAR Grades 3 8 and End-of-Course Assessments March 2, 2016 Student Assessment Division Texas Education Agency 1701 N. Congress Avenue Austin, TX 78701-1494
AutoDWG DWGSee DWG Viewer. DWGSee User Guide
DWGSee User Guide DWGSee is comprehensive software for viewing, printing, marking and sharing DWG files. It is fast, powerful and easy-to-use for every expert and beginners. Starting DWGSee After you install
Banner Document Management Suite (BDMS) Web Access Help
May 10 th, 2011 Banner Document Management Suite (BDMS) Web Access Help Division of Information Technology AppXtender Web Access Help: For questions regarding AppXtender Web Access, please contact the
OPENPROJECT. Setup Draft Notes. Draft Setup notes for Openproject
OPENPROJECT Setup Draft Notes Draft Setup notes for Openproject Contents Introduction... 2 Application Installation... 2 Configuring the Plugins... 2 Configure the Help link... 2 Configure the Costs Plugin...
Hamline University Administrative Computing Page 1
User Guide Banner Handout: BUSINESS OBJECTS ENTERPRISE (InfoView) Document: boxi31sp3-infoview.docx Created: 5/11/2011 1:24 PM by Chris Berry; Last Modified: 8/31/2011 1:53 PM Purpose:... 2 Introduction:...
