Data formats and file conversions
|
|
|
- Chester Dixon
- 10 years ago
- Views:
Transcription
1 Building Excellence in Genomics and Computational Bioscience s Richard Leggett (TGAC) John Walshaw (IFR)
2 Common file formats FASTQ FASTA BAM SAM Raw sequence Alignments MSF EMBL UniProt BED WIG Databases Annotation GenBank VCF GFF
3 FASTQ files e.g. Illumina read files 4 lines per read Stores sequence and quality information Read ID Sequence 1:N:0:GCCAA ACNATTAACAACCTTGGTGTTCAGCATGAGAACTTATCTGCAGCTGAGTCTCGTATCCGTGACG + 1:N:0:GCCAA CTNGAATGCAGGTAGAATACATCTCCCGGATAAGCCTCGCGGCCCCCGGGGCGGGGGGGGAGAG + 1:N:0:GCCAA GGNAAATACGAAAGATAAGCTACGCAAGAAACGAAGGATTACTGCGAAAGGCTGCGATGCGGCA
4 FASTQ files Sanger format quality scores 0-93 Encoded with ASCII characters Older versions of Illumina software slightly different
5 FASTQ files Q score relates to probability, p, that base is incorrect: What this means
6 FASTA files e.g. assembler contigs Stores ID and sequence data only Sequence data can cover multiple lines Sequence ID Sequence >contig1 ACNATTAACAACCTTGGTGTTCAGCATGAGAACTTATCTGCAGCTGAGTCTCGTATCCGTGACG CTGAGTCTCGTATCCGTGACGGTTAGGGCGATTAGCATAGA >contig2 TGACTAGCGGATTCGATTCGGAGGCTTATGGGCATTCCAGATGCAGCTAGCAGATGACATAGAT GGGCATT >contig3 CCCCCCTGACTAGCGGATTCGGTTCAGCATGAGTACGAATTCGGAGGCTTATGGGCATTCCAGA AGCGTGCAGCTAGCAGATGAAGCGCATAGATGGGCTATTGTTCAGCATGAGCTGATCAACTACG TACGGGACTGAGATGCCATGCAGTTGG >contig4 TGACTAGCTAGTGGATTGACGAC
7 Manipulating FASTA and FASTQ files Numerous options: FASTX toolkit conversion, quality statistics, clipping, renaming, trimming, reverse compliment, formatting & more. NGSUtils suite of utils for working with NGS datasets. EMBOSS sequence analysis package mature package which can do a lot. Many other programs/scripts or collections of scripts are available for common tasks Google can help find them! Simple manipulations possible even with one-line commands in UNIX/Linux shells see Introduction to Linux session!
8 FASTQ to FASTA conversion Using FASTX Toolkit $ fastq_to_fasta h usage: fastq_to_fasta [-h] [-r] [-n] [-v] [-z] [-i INFILE] [-o OUTFILE] version [-h] [-r] [-n] [-v] = This helpful help screen. = Rename sequence identifiers to numbers. = keep sequences with unknown (N) nucleotides. Default is to discard such sequences. = Verbose - report number of sequences. If [-o] is specified, report will be printed to STDOUT. If [-o] is not specified (and output goes to STDOUT), report will be printed to STDERR. = Compress output with GZIP. [-z] [-i INFILE] = FASTA/Q input file. default is STDIN. [-o OUTFILE] = FASTA output file. default is STDOUT. $ fastq_to_fasta Q 33 i file.fastq o file.fasta
9 Interleaving FASTQ files No one killer app: shufflesequences_fastq.pl comes with Velvet in the contrib directory. Interleave_fastq.py Example with shufflesequences: shufflesequences_fastq.pl file_r1.fastq file_r2.fastq file_r1r2.fastq Don t often need to go back, but popgentools has a script called split-interleaved-fastq.pl.
10 Splitting FASTA/Q files into chunks For example, to spread alignment load. For FASTA files: Using fastasplit (Exonerate) fastasplit f in.fasta o outdir -c 100 For FASTQ files: As long as not multi-line FASTQ, can use Linux split command: split -l 1000 in.fastq outprefix_ Using NGSUtils: fastqutils split in.fastq outprefix_ 100
11 Exercise: FASTQ/FASTA 1. Convert the file example.fastq in the Documents directory into a FASTA file. 2. Interleave the two LIB6574 files inside Documents/reads to make a single FASTQ file. 3. Split the file exreads.fastq in the Documents directory into 5 (approximately) chunks. 4. Split the file example.fastq in the Documents directory into 3 (approxiamtely) chunks.
12 Sequence databases Primary nucleotide DBs have their own native formats ENA db: EMBL format NCBI Nucleotide db ( Genbank ): Genbank format DDBJ: DDBJ format very similar to Genbank Primary protein DBs likewise: UniProt Knowledgebase: Swiss-Prot format Essentially the same as EMBL format NCBI Protein db: Genbank format ( Genpept ) Most sequence DBs will also provide the data in FASTA format Other DBs (e.g. for a particular genome-sequencing project) might use their own or standard formats
13 Exercise: Sequence databases (1) We will query ENA for some entries representing (partial) gene sequences of Purple Osier Willow Obtain an entry in native ENA ( EMBL ) format And FASTA format And repeat the query in the NCBI Nucleotide DB to obtain the equivalent record in Genbank format In a different search, we will query the Sequence Read Archive (SRA) to obtain FASTA- and FASTQ-format data from the genome-sequencing project of the same Willow We will use the NCBI implementation of SRA (the ENA or DRA versions could be used for the same search) This sequencing project used 454 sequencing keeps the data sets (relatively) small This kind of data is made available in compressed files so we will uncompress and examine the files
14 Exercise: Sequence databases (2) Search ENA for: Salix purpurea Examine the hit-list of coding sequences Choose an entry representing a whole (not partial) gene Obtain native (EMBL) format and FASTA-format files of this Make a note of the Accession number of the record Extra exercise if you have time: Find, examine and download in Swiss-Prot format this UniProtKB entry Examine the EMBL-format record: Can you see cross-references to other databases? Any to the UniProt KnowledgeBase? Make a note of any cross-reference to UniProtKB which you see.
15 Exercise: Sequence databases (3) Change All Databases to Nucleotide and search for Salix purpurea To narrow down the hit list, click Advanced (under the search box) Restrict the search to: Organism = Salix purpurea Entries which do NOT have partial cds in any field How many of the hits appear to be proteincoding sequences? The entry equivalent to the one found in the ENA search should be in the list. What is its Accession number? Examine the record Click on Send to download the entry in Genbank format
16 Exercise: Sequence databases (4) Obtaining read data sets (FASTA and/or FASTQ) from SRA - change DB to search to SRA; search for Salix purpurea The hit list is a list of sequencing experiments Accession of an SRA experiment begins with SRX Among the hit list look for those annotated as random whole genome shotgun library Note that these are 454 (GS FLX) sequence reads each set is much smaller than the other (Illumina, GA II) Pick the smallest experiment (read set) (should take you here:
17 Exercise: Sequence databases (5) Each experiment is associated with one or more sequencing runs. This experiment has only one run. Click on the link (SRR070318) Click the Reads tab. Individual reads can be examined. But here we will download the set in bulk. Click on the Filtered Download button Select clipped and FASTA ; click Download This will deliver the whole set of reads (auto quality-clipped) in a single compressed (gzipped) file The Linux (Ubuntu) archive manager should automatically provide access to the contents of this compressed file It can be examined e.g. in a text editor Then repeat, but this time obtain the FASTQ-format file
18 Alignments SAM format Sequence Alignment/Map BAM format binary version of SAM (compressed, more efficient) Use SAMtools to process. Reference T G C T T A G T C C T T A G T C T A C T A G T Reads C T T A G T C C C T T G G T C T Insertion C T A A G C T A SNP? Error?
19 The SAM file Flags Pos CIGAR Read Optional fields Read1 0 TheRef M * 0 0 CTTAGTCC EEDDEEDE AS:i:8 XS:i:0 Read2 16 TheRef M * 0 0 CTTGGTCT FFEEDDEE AS:7 XS:i:0 Read3 0 TheRef M2I3M * 0 0 CTAAGCTA GGGHHHHH AS:i:5 XS:i:0 Read ID Ref ID MAPQ Mate Qualities Reference T G C T T A G T C C T T A G T C T A C T A G T Reads C T T A G T C C Insertion C T T G G T C T C T A A G C T A SNP? Error?
20 SAMtools SAMtools tools: view filter SAM or BAM sort sort according to position on reference index create fast look-up of BAM or SAM tview text viewer for alignments mpileup generate pileup (BCF) file, eg. for SNP calling merge merge sorted alignments rmdup remove potential PCR duplicates and more For more info:
21 Multiple Sequence Alignments Related but different aims, meanings and file formats Sequence read alignment ( assembly ) Multiple protein or nucleotide sequence alignment Each nucleotide position (column) represents multiple copies of the same base of an original sequence (e.g. genome sequence) Each position (column) represents a homologous nucleotide (or amino acid). Sequences are evolutionarily related (homologous) sequences, typically from different organisms, and/or multiple members of a gene family Gaps represent insertions/ deletions
22 Multiple Sequence Alignments Various file formats for MSA A multiple alignment can be represented in FASTA format MSA-dedicated formats are more richly annotated and more flexible for some purposes MSF Stockholm Selex and others Each nucleotide or amino acid, and indel, is represented explicitly C.f. SAM/BAM
23 Multiple Sequence Alignments MSF Stockholm
24 Automation saves effort and prevents errors Many (but not all) sequence formats are flatfiles they consist of plain-text characters It may be convenient to: Examine a file s contents, e.g. UNIX/Linux less Text editor, e.g. gedit Can be useful as a quick sanity check perform a single operation on a single sequence manually But if even a simple manual operation is to be repeated many times, errors are likely Manual operations likely to be infeasible for large sequence sets Or possible, but very timewasting If you find yourself doing something repetitive using interactive tools, ask yourself if there might be an easier way Often the answer is, there must be an easier way
25 Automation saves effort and prevents errors Repetitive chains of operations: Data set A, in file A1 reformat filea1 filea2 Input filea2 into tool X (output) filea3 Reformat filea3 filea4 Input filea4 into tooly -> (output) filea5 Next week, repeat on Data set B Use automated pipelines Re-useability of analysis steps/tools In different combinations for different purposes Ideally, records each input/output process E.g. GALAXY
26 The (t)errors of cut-and-paste A real-world example (but not with this actual sequence) A plant scientist working on a particular gene/protein asked a bioinformatician colleague to do some analyses on the protein sequence, along with those from the same family in related plants. The sequences were ed to the bioinformatician. Unsurprisingly, the family of proteins exhibited numerous amino acid substitutions, and insertions/deletions It was noticed that one sequence alone had two instances of an inserted dipeptide, Phenylalanine-Threonine. These were 59 amino acids apart, and appeared to be absent from all related proteins in the databases.
27 The (t)errors of cut-and-paste >WillowMatK FSDSAIIDRFVRICRNLSHYYSGSSRKKSLYRIKYILRLSCVKTLFTARKHKSTVRIFLK RLGSELLDEFFTEEEQILFLTFPRVSSISQKLYRGRVWYLDIICINFTELSNHE ID AJ849584; SV 1; linear; genomic DNA; STD; PLN; 622 BP. DE Salix purpurea chloroplast partial trna-lys gene intron and partial matk DE gene for maturase K, clone A XX KW matk gene; maturase K; trna-lys. XX" FT /gene="matk" FT /product="maturase K" FT /db_xref="goa:a0zvw3" FT /db_xref="interpro:ipr024937" FT /db_xref="uniprotkb/trembl:a0zvw3" FT /protein_id="cah " FT /translation="fsdsaiidrfvricrnlshyysgssrkkslyrikyilrlscvktl FT ARKHKSTVRIFLKRLGSELLDEFFTEEEQILFLTFPRVSSISQKLYRGRVWYLDIICIN FT ELSNHE" XX SQ Sequence 622 BP; 205 A; 123 C; 97 G; 197 T; 0 other; gggttgcccg ggactcgaac ccggactagt cggatggagt agagaatttc tttgttaaaa 60
28 Where to get software FASTX Toolkit: NGSUtils: EMBOSS: Exonerate: Velvet: Interleave_fastq.py: popgentools: SAMtools:
29 Thank you Any questions?
Tutorial for Windows and Macintosh. Preparing Your Data for NGS Alignment
Tutorial for Windows and Macintosh Preparing Your Data for NGS Alignment 2015 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) 1.734.769.7249
Module 1. Sequence Formats and Retrieval. Charles Steward
The Open Door Workshop Module 1 Sequence Formats and Retrieval Charles Steward 1 Aims Acquaint you with different file formats and associated annotations. Introduce different nucleotide and protein databases.
A Complete Example of Next- Gen DNA Sequencing Read Alignment. Presentation Title Goes Here
A Complete Example of Next- Gen DNA Sequencing Read Alignment Presentation Title Goes Here 1 FASTQ Format: The de- facto file format for sharing sequence read data Sequence and a per- base quality score
UGENE Quick Start Guide
Quick Start Guide This document contains a quick introduction to UGENE. For more detailed information, you can find the UGENE User Manual and other special manuals in project website: http://ugene.unipro.ru.
Databases and mapping BWA. Samtools
Databases and mapping BWA Samtools FASTQ, SFF, bax.h5 ACE, FASTG FASTA BAM/SAM GFF, BED GenBank/Embl/DDJB many more File formats FASTQ Output format from Illumina and IonTorrent sequencers. Quality scores:
Version 5.0 Release Notes
Version 5.0 Release Notes 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) +1.734.769.7249 (elsewhere) +1.734.769.7074 (fax) www.genecodes.com
Introduction to NGS data analysis
Introduction to NGS data analysis Jeroen F. J. Laros Leiden Genome Technology Center Department of Human Genetics Center for Human and Clinical Genetics Sequencing Illumina platforms Characteristics: High
Bioinformatics Resources at a Glance
Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences
SeqScape Software Version 2.5 Comprehensive Analysis Solution for Resequencing Applications
Product Bulletin Sequencing Software SeqScape Software Version 2.5 Comprehensive Analysis Solution for Resequencing Applications Comprehensive reference sequence handling Helps interpret the role of each
Next generation sequencing (NGS)
Next generation sequencing (NGS) Vijayachitra Modhukur BIIT [email protected] 1 Bioinformatics course 11/13/12 Sequencing 2 Bioinformatics course 11/13/12 Microarrays vs NGS Sequences do not need to be known
RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison
RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the
When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want
1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very
SRA File Formats Guide
SRA File Formats Guide Version 1.1 10 Mar 2010 National Center for Biotechnology Information National Library of Medicine EMBL European Bioinformatics Institute DNA Databank of Japan 1 Contents SRA File
Comparing Methods for Identifying Transcription Factor Target Genes
Comparing Methods for Identifying Transcription Factor Target Genes Alena van Bömmel (R 3.3.73) Matthew Huska (R 3.3.18) Max Planck Institute for Molecular Genetics Folie 1 Transcriptional Regulation TF
Introduction to Bioinformatics 3. DNA editing and contig assembly
Introduction to Bioinformatics 3. DNA editing and contig assembly Benjamin F. Matthews United States Department of Agriculture Soybean Genomics and Improvement Laboratory Beltsville, MD 20708 [email protected]
Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011
Sequence Formats and Sequence Database Searches Gloria Rendon SC11 Education June, 2011 Sequence A is the primary structure of a biological molecule. It is a chain of residues that form a precise linear
Searching Nucleotide Databases
Searching Nucleotide Databases 1 When we search a nucleic acid databases, Mascot always performs a 6 frame translation on the fly. That is, 3 reading frames from the forward strand and 3 reading frames
Welcome to the Plant Breeding and Genomics Webinar Series
Welcome to the Plant Breeding and Genomics Webinar Series Today s Presenter: Dr. Candice Hansey Presentation: http://www.extension.org/pages/ 60428 Host: Heather Merk Technical Production: John McQueen
This document presents the new features available in ngklast release 4.4 and KServer 4.2.
This document presents the new features available in ngklast release 4.4 and KServer 4.2. 1) KLAST search engine optimization ngklast comes with an updated release of the KLAST sequence comparison tool.
CD-HIT User s Guide. Last updated: April 5, 2010. http://cd-hit.org http://bioinformatics.org/cd-hit/
CD-HIT User s Guide Last updated: April 5, 2010 http://cd-hit.org http://bioinformatics.org/cd-hit/ Program developed by Weizhong Li s lab at UCSD http://weizhong-lab.ucsd.edu [email protected] 1. Introduction
Analysis of ChIP-seq data in Galaxy
Analysis of ChIP-seq data in Galaxy November, 2012 Local copy: https://galaxy.wi.mit.edu/ Joint project between BaRC and IT Main site: http://main.g2.bx.psu.edu/ 1 Font Conventions Bold and blue refers
Removing Sequential Bottlenecks in Analysis of Next-Generation Sequencing Data
Removing Sequential Bottlenecks in Analysis of Next-Generation Sequencing Data Yi Wang, Gagan Agrawal, Gulcin Ozer and Kun Huang The Ohio State University HiCOMB 2014 May 19 th, Phoenix, Arizona 1 Outline
Basic processing of next-generation sequencing (NGS) data
Basic processing of next-generation sequencing (NGS) data Getting from raw sequence data to expression analysis! 1 Reminder: we are measuring expression of protein coding genes by transcript abundance
Analysis of NGS Data
Analysis of NGS Data Introduction and Basics Folie: 1 Overview of Analysis Workflow Images Basecalling Sequences denovo - Sequencing Assembly Annotation Resequencing Alignments Comparison to reference
A Tutorial in Genetic Sequence Classification Tools and Techniques
A Tutorial in Genetic Sequence Classification Tools and Techniques Jake Drew Data Mining CSE 8331 Southern Methodist University [email protected] www.jakemdrew.com Sequence Characters IUPAC nucleotide
?<BACBC;@@A=2(?@?;@=2:;:%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%
NGS data format NGS data format @SRR031028.1708655 GGATGATGGATGGATAGATAGATGAAGAGATGGATGGATGGGTGGGTGGTATGCAGCATACCTGAAGTGC BBBCB=ABBB@BA=?BABBBBA??B@BAAA>ABB;@5=@@@?8@:==99:465727:;41'.9>;933!4 @SRR031028.843803
GenBank, Entrez, & FASTA
GenBank, Entrez, & FASTA Nucleotide Sequence Databases First generation GenBank is a representative example started as sort of a museum to preserve knowledge of a sequence from first discovery great repositories,
Clone Manager. Getting Started
Clone Manager for Windows Professional Edition Volume 2 Alignment, Primer Operations Version 9.5 Getting Started Copyright 1994-2015 Scientific & Educational Software. All rights reserved. The software
Biological Sequence Data Formats
Biological Sequence Data Formats Here we present three standard formats in which biological sequence data (DNA, RNA and protein) can be stored and presented. Raw Sequence: Data without description. FASTA
Focusing on results not data comprehensive data analysis for targeted next generation sequencing
Focusing on results not data comprehensive data analysis for targeted next generation sequencing Daniel Swan, Jolyon Holdstock, Angela Matchan, Richard Stark, John Shovelton, Duarte Mohla and Simon Hughes
17 July 2014 WEB-SERVER MANUAL. Contact: Michael Hackenberg ([email protected])
WEB-SERVER MANUAL Contact: Michael Hackenberg ([email protected]) 1 1 Introduction srnabench is a free web-server tool and standalone application for processing small- RNA data obtained from next generation
Prepare the environment Practical Part 1.1
Prepare the environment Practical Part 1.1 The first exercise should get you comfortable with the computer environment. I am going to assume that either you have some minimal experience with command line
Text file One header line meta information lines One line : variant/position
Software Calling: GATK SAMTOOLS mpileup Varscan SOAP VCF format Text file One header line meta information lines One line : variant/position ##fileformat=vcfv4.1! ##filedate=20090805! ##source=myimputationprogramv3.1!
Database manager does something that sounds trivial. It makes it easy to setup a new database for searching with Mascot. It also makes it easy to
1 Database manager does something that sounds trivial. It makes it easy to setup a new database for searching with Mascot. It also makes it easy to automate regular updates of these databases. 2 However,
Data Analysis & Management of High-throughput Sequencing Data. Quoclinh Nguyen Research Informatics Genomics Core / Medical Research Institute
Data Analysis & Management of High-throughput Sequencing Data Quoclinh Nguyen Research Informatics Genomics Core / Medical Research Institute Current Issues Current Issues The QSEQ file Number files per
Practical Guideline for Whole Genome Sequencing
Practical Guideline for Whole Genome Sequencing Disclosure Kwangsik Nho Assistant Professor Center for Neuroimaging Department of Radiology and Imaging Sciences Center for Computational Biology and Bioinformatics
When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want
1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very
Bioinformatics Grid - Enabled Tools For Biologists.
Bioinformatics Grid - Enabled Tools For Biologists. What is Grid-Enabled Tools (GET)? As number of data from the genomics and proteomics experiment increases. Problems arise for the current sequence analysis
AS4.1 190509 Replaces 260806 Page 1 of 50 ATF. Software for. DNA Sequencing. Operators Manual. Assign-ATF is intended for Research Use Only (RUO):
Replaces 260806 Page 1 of 50 ATF Software for DNA Sequencing Operators Manual Replaces 260806 Page 2 of 50 1 About ATF...5 1.1 Compatibility...5 1.1.1 Computer Operator Systems...5 1.1.2 DNA Sequencing
4.2.1. What is a contig? 4.2.2. What are the contig assembly programs?
Table of Contents 4.1. DNA Sequencing 4.1.1. Trace Viewer in GCG SeqLab Table. Box. Select the editor mode in the SeqLab main window. Import sequencer trace files from the File menu. Select the trace files
Introduction to GCG and SeqLab
Oxford University Bioinformatics Centre Introduction to GCG and SeqLab 31 July 2001 Oxford University Bioinformatics Centre, 2001 Sir William Dunn School of Pathology South Parks Road Oxford, OX1 3RE Contents
Library page. SRS first view. Different types of database in SRS. Standard query form
SRS & Entrez SRS Sequence Retrieval System Bengt Persson Whatis SRS? Sequence Retrieval System User-friendly interface to databases http://srs.ebi.ac.uk Developed by Thure Etzold and co-workers EMBL/EBI
RESTRICTION DIGESTS Based on a handout originally available at
RESTRICTION DIGESTS Based on a handout originally available at http://genome.wustl.edu/overview/rst_digest_handout_20050127/restrictiondigest_jan2005.html What is a restriction digests? Cloned DNA is cut
NGS Data Analysis: An Intro to RNA-Seq
NGS Data Analysis: An Intro to RNA-Seq March 25th, 2014 GST Colloquim: March 25th, 2014 1 / 1 Workshop Design Basics of NGS Sample Prep RNA-Seq Analysis GST Colloquim: March 25th, 2014 2 / 1 Experimental
EndNote Beyond the Basics
IOE Library Guide EndNote Beyond the Basics These notes assume that you know EndNote basics and are using it regularly. Additional tips and instruction is contained within the guides and FAQs available
How To Use The Assembly Database In A Microarray (Perl) With A Microarcode) (Perperl 2) (For Macrogenome) (Genome 2)
The Ensembl Core databases and API Useful links Installation instructions: http://www.ensembl.org/info/docs/api/api_installation.html Schema description: http://www.ensembl.org/info/docs/api/core/core_schema.html
Geneious 8.1. Biomatters Ltd
Geneious 8.1 Biomatters Ltd August 10, 2015 2 Contents 1 Getting Started 5 1.1 Downloading & Installing Geneious.......................... 5 1.2 Geneious setup...................................... 6 1.3
Genome Explorer For Comparative Genome Analysis
Genome Explorer For Comparative Genome Analysis Jenn Conn 1, Jo L. Dicks 1 and Ian N. Roberts 2 Abstract Genome Explorer brings together the tools required to build and compare phylogenies from both sequence
Introduction to next-generation sequencing data
Introduction to next-generation sequencing data David Simpson Centre for Experimental Medicine Queens University Belfast http://www.qub.ac.uk/research-centres/cem/ Outline History of DNA sequencing NGS
Delivering the power of the world s most successful genomics platform
Delivering the power of the world s most successful genomics platform NextCODE Health is bringing the full power of the world s largest and most successful genomics platform to everyday clinical care NextCODE
DNA Sequencing Data Compression. Michael Chung
DNA Sequencing Data Compression Michael Chung Problem DNA sequencing per dollar is increasing faster than storage capacity per dollar. Stein (2010) Data 3 billion base pairs in human genome Genomes are
BIOL 3200 Spring 2015 DNA Subway and RNA-Seq Data Analysis
BIOL 3200 Spring 2015 DNA Subway and RNA-Seq Data Analysis By the end of this lab students should be able to: Describe the uses for each line of the DNA subway program (Red/Yellow/Blue/Green) Describe
Practical Solutions for Big Data Analytics
Practical Solutions for Big Data Analytics Ravi Madduri Computation Institute ([email protected]) Paul Dave ([email protected]) Dinanath Sulakhe ([email protected]) Alex Rodriguez ([email protected])
Supervised DNA barcodes species classification: analysis, comparisons and results. Tutorial. Citations
Supervised DNA barcodes species classification: analysis, comparisons and results Emanuel Weitschek, Giulia Fiscon, and Giovanni Felici Citations If you use this procedure please cite: Weitschek E, Fiscon
8/7/2012. Experimental Design & Intro to NGS Data Analysis. Examples. Agenda. Shoe Example. Breast Cancer Example. Rat Example (Experimental Design)
Experimental Design & Intro to NGS Data Analysis Ryan Peters Field Application Specialist Partek, Incorporated Agenda Experimental Design Examples ANOVA What assays are possible? NGS Analytical Process
Human Genomes and Big Data Challenges QUANTITY, QUALITY AND QUANDRY. 2013. Gerry Higgins, M.D., Ph.D. AssureRx Health, Inc.
Human Genomes and Big Data Challenges QUANTITY, QUALITY AND QUANDRY 2013. Gerry Higgins, M.D., Ph.D. AssureRx Health, Inc. Table of Contents EXECUTIVE SUMMARY... 3 I. The Abundance and Diversity of Omics
DNA Sequencing Overview
DNA Sequencing Overview DNA sequencing involves the determination of the sequence of nucleotides in a sample of DNA. It is presently conducted using a modified PCR reaction where both normal and labeled
LifeScope Genomic Analysis Software 2.5
USER GUIDE LifeScope Genomic Analysis Software 2.5 Graphical User Interface DATA ANALYSIS METHODS AND INTERPRETATION Publication Part Number 4471877 Rev. A Revision Date November 2011 For Research Use
The Artemis Manual. Copyright 1999-2014 by Genome Research Limited
The Artemis Manual Copyright 1999-2014 by Genome Research Limited This document describes release 16 of Artemis a DNA sequence viewer and sequence annotation tool. Artemis is free software; you can redistribute
The QuickStudy Guide for Sage ACT! 2013
The QuickStudy Guide for Sage ACT! 2013 Using ACT! Everyday The Basics How Did Quick Get Included in the Book Name? Using This QuickStudy Guide Hey, Don t Skip This What s Contact and Customer Management
Introduction to Genome Annotation
Introduction to Genome Annotation AGCGTGGTAGCGCGAGTTTGCGAGCTAGCTAGGCTCCGGATGCGA CCAGCTTTGATAGATGAATATAGTGTGCGCGACTAGCTGTGTGTT GAATATATAGTGTGTCTCTCGATATGTAGTCTGGATCTAGTGTTG GTGTAGATGGAGATCGCGTAGCGTGGTAGCGCGAGTTTGCGAGCT
Unipro UGENE Manual. Version 1.20.0
Unipro UGENE Manual Version 1.20.0 December 16, 2015 Unipro UGENE Online User Manual About Unipro About UGENE Key Features User Interface High Performance Computing Cooperation Download and Installation
A Multiple DNA Sequence Translation Tool Incorporating Web Robot and Intelligent Recommendation Techniques
Proceedings of the 2007 WSEAS International Conference on Computer Engineering and Applications, Gold Coast, Australia, January 17-19, 2007 402 A Multiple DNA Sequence Translation Tool Incorporating Web
Hadoop-BAM and SeqPig
Hadoop-BAM and SeqPig Keijo Heljanko 1, André Schumacher 1,2, Ridvan Döngelci 1, Luca Pireddu 3, Matti Niemenmaa 1, Aleksi Kallio 4, Eija Korpelainen 4, and Gianluigi Zanetti 3 1 Department of Computer
Database Searching Tutorial/Exercises Jimmy Eng
Database Searching Tutorial/Exercises Jimmy Eng Use the PETUNIA interface to run a search and generate a pepxml file that is analyzed through the PepXML Viewer. This tutorial will walk you through the
Integrated Rule-based Data Management System for Genome Sequencing Data
Integrated Rule-based Data Management System for Genome Sequencing Data A Research Data Management (RDM) Green Shoots Pilots Project Report by Michael Mueller, Simon Burbidge, Steven Lawlor and Jorge Ferrer
Biological Databases and Protein Sequence Analysis
Biological Databases and Protein Sequence Analysis Introduction M. Madan Babu, Center for Biotechnology, Anna University, Chennai 25, India Bioinformatics is the application of Information technology to
Introduction. Overview of Bioconductor packages for short read analysis
Overview of Bioconductor packages for short read analysis Introduction General introduction SRAdb Pseudo code (Shortread) Short overview of some packages Quality assessment Example sequencing data in Bioconductor
-> Integration of MAPHiTS in Galaxy
Enabling NGS Analysis with(out) the Infrastructure, 12:0512 Development of a workflow for SNPs detection in grapevine From Sets to Graphs: Towards a Realistic Enrichment Analy species: MAPHiTS -> Integration
Hadoopizer : a cloud environment for bioinformatics data analysis
Hadoopizer : a cloud environment for bioinformatics data analysis Anthony Bretaudeau (1), Olivier Sallou (2), Olivier Collin (3) (1) [email protected], INRIA/Irisa, Campus de Beaulieu, 35042,
Module 3. Genome Browsing. Using Web Browsers to View Genome Annota4on. Kers4n Howe Wellcome Trust Sanger Ins4tute zfish- [email protected].
Module 3 Genome Browsing Using Web Browsers to View Genome Annota4on Kers4n Howe Wellcome Trust Sanger Ins4tute zfish- [email protected] Introduc.on Genome browsing The Ensembl gene set Guided examples
PROGRAMMING FOR BIOLOGISTS. BIOL 6297 Monday, Wednesday 10 am -12 pm
PROGRAMMING FOR BIOLOGISTS BIOL 6297 Monday, Wednesday 10 am -12 pm Tomorrow is Ada Lovelace Day Ada Lovelace was the first person to write a computer program Today s Lecture Overview of the course Philosophy
Step by Step Guide to Importing Genetic Data into JMP Genomics
Step by Step Guide to Importing Genetic Data into JMP Genomics Page 1 Introduction Data for genetic analyses can exist in a variety of formats. Before this data can be analyzed it must imported into one
Mascot Search Results FAQ
Mascot Search Results FAQ 1 We had a presentation with this same title at our 2005 user meeting. So much has changed in the last 6 years that it seemed like a good idea to re-visit the topic. Just about
GDC Data Transfer Tool User s Guide. NCI Genomic Data Commons (GDC)
GDC Data Transfer Tool User s Guide NCI Genomic Data Commons (GDC) Contents 1 Getting Started 3 Getting Started.......................................................... 3 The GDC Data Transfer Tool: An
Pairwise Sequence Alignment
Pairwise Sequence Alignment [email protected] SS 2013 Outline Pairwise sequence alignment global - Needleman Wunsch Gotoh algorithm local - Smith Waterman algorithm BLAST - heuristics What
Banana is a native application for Windows, Linux and Mac and includes functions that allow the user to manage different types of accounting files:
banana Accounting 7 TECHNICA NICAL DATA Applications and accounting types Banana is a native application for Windows, Linux and Mac and includes functions that allow the user to manage different types
Sequence Database Administration
Sequence Database Administration 1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases
SeqPig: simple and scalable scripting for large sequencing data sets in Hadoop
SeqPig: simple and scalable scripting for large sequencing data sets in Hadoop André Schumacher, Luca Pireddu, Matti Niemenmaa, Aleksi Kallio, Eija Korpelainen, Gianluigi Zanetti and Keijo Heljanko Abstract
BioHPC Web Computing Resources at CBSU
BioHPC Web Computing Resources at CBSU 3CPG workshop Robert Bukowski Computational Biology Service Unit http://cbsu.tc.cornell.edu/lab/doc/biohpc_web_tutorial.pdf BioHPC infrastructure at CBSU BioHPC Web
The Artemis Manual. Copyright 1999-2011 by Genome Research Limited
The Artemis Manual Copyright 1999-2011 by Genome Research Limited This document describes release 13 of Artemis a DNA sequence viewer and sequence annotation tool. Artemis is free software; you can redistribute
RNA Express. Introduction 3 Run RNA Express 4 RNA Express App Output 6 RNA Express Workflow 12 Technical Assistance
RNA Express Introduction 3 Run RNA Express 4 RNA Express App Output 6 RNA Express Workflow 12 Technical Assistance ILLUMINA PROPRIETARY 15052918 Rev. A February 2014 This document and its contents are
MiSeq: Imaging and Base Calling
MiSeq: Imaging and Page Welcome Navigation Presenter Introduction MiSeq Sequencing Workflow Narration Welcome to MiSeq: Imaging and. This course takes 35 minutes to complete. Click Next to continue. Please
Creating and Using Databases with Microsoft Access
CHAPTER A Creating and Using Databases with Microsoft Access In this chapter, you will Use Access to explore a simple database Design and create a new database Create and use forms Create and use queries
UCLA Team Sequences Cell Line, Puts Open Source Software Framework into Production
Page 1 of 6 UCLA Team Sequences Cell Line, Puts Open Source Software Framework into Production February 05, 2010 Newsletter: BioInform BioInform - February 5, 2010 By Vivien Marx Scientists at the department
Building Bioinformatics Capacity in Africa. Nicky Mulder CBIO Group, UCT
Building Bioinformatics Capacity in Africa Nicky Mulder CBIO Group, UCT Outline What is bioinformatics? Why do we need IT infrastructure? What e-infrastructure does it require? How we are developing this
NaviCell Data Visualization Python API
NaviCell Data Visualization Python API Tutorial - Version 1.0 The NaviCell Data Visualization Python API is a Python module that let computational biologists write programs to interact with the molecular
Manual for Demo Data
Manual for Demo Data SEQUENCE Pilot module SeqPatient developed by JSI medical systems GmbH JSI medical systems Corp. Tullastr. 18 One Boston Place, Suite 2600 77975 Ettenheim Boston, MA 02108 GERMANY
org.rn.eg.db December 16, 2015 org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank accession numbers.
org.rn.eg.db December 16, 2015 org.rn.egaccnum Map Entrez Gene identifiers to GenBank Accession Numbers org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank
Processing NGS Data with Hadoop-BAM and SeqPig
Processing NGS Data with Hadoop-BAM and SeqPig Keijo Heljanko 1, André Schumacher 1,2, Ridvan Döngelci 1, Luca Pireddu 3, Matti Niemenmaa 1, Aleksi Kallio 4, Eija Korpelainen 4, and Gianluigi Zanetti 3
TCB No. 2012-008 September 2012. Technical Bulletin. GS FLX+ System & GS FLX System. Installation of 454 Sequencing System Software v2.
TCB No. 2012-008 September 2012 Technical Bulletin GS FLX+ System & GS FLX System Installation of 454 Sequencing System Software v2.8 Summary This document describes how to upgrade the 454 Sequencing System
