Proteomics. George Tsaprailis, Director Linda Breci, Associate Director. Arizona Proteomics Consortium University of Arizona

Size: px
Start display at page:

Download "Proteomics. George Tsaprailis, Director Linda Breci, Associate Director. Arizona Proteomics Consortium University of Arizona"

Transcription

1 Proteomics George Tsaprailis, Director Linda Breci, Associate Director Arizona Proteomics Consortium University of Arizona What is proteomics and how is Mass spectrometry used in proteomics? 1

2 Proteomics: the study of the Proteome A collection of proteins, usually comprising a biological system Important because (1) proteins perform most cellular functions, (2) proteins are the major elements of most cellular structures, and (3) proteins are targets of drugs/toxicants Why Proteomics? Mass Spectrometry Protein ID 2

3 Proteomics involves- Protein Chemistry Mass Spectrometry Computing (+ Bioinformatics) Protein Chemistry Sample isolation/clean-up Sample purification fractions Protein digest peptides 3

4 Key to Proteomics is to obtain peptide masses and/or sequences Mass Spectrometry Protein mixture digestion separation Proteins digestion Peptide mixture separation Peptides MS analysis MS data MS MS/MS All types of hardware used in proteomics Mass Spectrometry 4

5 Computing (+ Bioinformatics) The Proteomic Approach Sample Pre-prep steps 1D PAGE 2D PAGE Protein Chemistry Protein(s) Solution HPLC fractions IP eluent Protein ESI Mass Spectrometry LC-MS/MS MALDI MS Mass Spectrometer Digest Peptides Computing (+ Bioinformatics) Protein Id + Informatics 5

6 What is proteomics and how is Mass spectrometry used in proteomics? Mass Spectrometry What is a mass spectrometer and what does it measure? An instrument that makes ions Measures the mass/charge (m/z) of ions Mass Spectrometry in proteomics For proteins and peptides whole protein mass measurements protein identification based on peptide mass measurement protein identification based on peptide structure analysis (fragmentation) Need to know some basic principles 6

7 Protein/peptide relationship Enzyme Protein Peptides Making ions H+ O H 2 N CH C O H N CH C O H N CH C O H N CH C OH CH 3 CH 2 CH 2 CH 2 CH CH 3 CH 2 CH 3 CH 2 H+ CH 2 NH 2 Ala-Leu-Phe-Lys mass of neutral = Ala-Leu-Phe-Lys m/z of singly charged = Ala-Leu-Phe-Lys m/z of doubly charged =

8 Making ions Ions are made in an ion source Important methods in Proteomics: 1) MALDI (matrix assisted laser desorption) 2) ESI (electrospray ionization Electrospray Ionization ESI Calculated Mass Spectrum Relative Intensity Intensity m/z m/z [M+H] Intensity [M+2H] Matrix Assisted Laser Desorption Ionization MALDI 4 2 [2M+H] , m/z 8

9 Analyzing ions The ion source is coupled to the analyzer Important analyzers in Proteomics: 1) TOF (time of flight) 2) Ion Trap Matrix Assisted Laser Desorption (MALDI) (ion source) Time of Flight (analyzer) FLIGHT TUBE ANALYZER Pulsed laser light Analyzer LASER Ion Beam Detector Sample and matrix on tip of solid probe 9

10 Time of Flight (TOF) Linear Mode: better sensitivity poor resolution Reflectron Mode: less sensitivity higher resolution MALDI-TOF spectrum (mix of peptides) 9 x 4. Ref Ref 5 m/z 25 D:\113_5fmol\Bsaintcal\2Ref\pdata\1\1r (11:26 1/4/1) 1

11 MALDI Reflectron Spectrum Of ACTH 13-Nov-23 ACTHResCk 3 (.98) Cm (1:5) 1 M@LDI TOF LD+ 6.57e % m/z Electrospray (ESI) (ion source) Ion Trap (analyzer) ION TRAP ANALYZER ESI HPLC 45 V Dry gas or Heat Analyzer Ion Beam Detector Liquid sample sprayed from needle or capillary 11

12 ESI-Ion Trap Spectrum 1 [M+H] [M+H] + = = [M+2H] 2+ = ( ) / 2 = Relative Intensity 6 4 [M+2H] [2M+H] + = (951.4 x 2) + 1 = [2M+H] m/z Exercise 1 View an ion trap animation 12

13 Resolution and mass accuracy varies by instrument INSTRUMENT MASS RANGE Resolution Accuracy (Error) m/z (at m/z 1,) (at m/z 1,) LCQ (Ion Trap) to 2, 2, (full scan).3% (3 ppm) 1, (zoom scan) MALDI/TOF to 4, 15, (reflectron).6% (6 ppm) Ext. Cal..3% (3ppm) Int.Cal. FTICR to 4, 5,.1% (1ppm) ( TheoreticalMW MeasuredMW) ppm = 1 TheoreticalMW 6 Resolution Resolution 3, 1, 3, 1, 13

14 MALDI Reflectron Spectrum Of ACTH 13-Nov-23 ACTHResCk 3 (.98) Cm (1:5) 1 M@LDI TOF LD+ 6.57e % m/z You must know the resolution of your instrument to analyze the data! We need to know the possible error in the measurement Is the peak monoisotopic? Is the peak average? 14

15 Analysis of whole proteins by MALDI-TOF and ESI-Ion trap MALDI-TOF = measure with 1 or 2 protons large molecules like Proteins require Linear mode (much lower resolution) ESI-Ion Trap = measure with many protons (high charge state) mass of the protein can be calculated from the multiply charged peaks Mass Spec measures isotopes Excel calculated example: Carbon is 12. For every 12 C there is 1.1% 13 C isotopes add up 1 carbons = 11% 13 C Peak for 1 carbons, the 13 C peak is larger than the 12 C peak 1 carbons 1 carbons

16 Proteins have very large isotope widths Theoretical Isotope distribution of Lysozyme 1st Isotope th Isotope Isotope # m /z % Maximum Lysozyme by MALDI/TOF Average mass = 14, [M+H] [M+H] Intensity [2M+2H] [M+2H] [2M+H] m/z 16

17 Lysozyme by ESI-Ion Trap Average mass = 14, Calculated Mass Spectrum Relative Intensity Intensity m/z m/z So we ve made measurements Now What? A lot of information is available on-line about proteins and/or the gene We will explore protein information in general We will then use the available info to perform data analysis 17

18 MALDI-TOF analysis of Alkaline phosphatase Computer Exercise #2 1.2E+9 Intensity 1.E+9 8.E+8 6.E+8 4.E+8 [M+2H] [M+H] [2M+H] E m/z Protein identification Two strategies single stage mass spectrometry (MS) called peptide mass mapping measure all peptides in one spectrum MALDI-TOF produces low confidence results tandem mass spectrometry (MS/MS) measure peptides as they elute from an HPLC ESI-Ion Trap produces high confidence results 18

19 Single Stage Peptide mass mapping Using MALDI-TOF MALDI-TOF Spectrum of tryptic digest 9 x 4. Ref Ref 5 m/z 25 D:\113_5fmol\Bsaintcal\2Ref\pdata\1\1r (11:26 1/4/1) 19

20 MALDI Reflectron Spectrum Of ACTH 13-Nov-23 ACTHResCk 3 (.98) Cm (1:5) 1 M@LDI TOF LD+ 6.57e % m/z Data Analysis for peptide mass mapping MS? protein peptides identify for example: Measured Peptide = rank MS Peptide MW Found in Selected Databases NDALYFPT... SWDLTAL... PTDLDVSY... Important data multiple peaks mass accuracy confirming information (pi, approx. mass, organism, etc.) 2

21 Data Analysis for peptide mass mapping >gi ref NP_ solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Bos taurus]gi gb AAB glycine transporter MAAAQGPVAPSKLEQNGAVPSEATKSDQNLGQGNWRNQIEFVLTSVGYAVGLGNV WRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFK GVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTPVLPWTYCNNPWNTPDCMSVLDN PNITNGSQPPALPGNVSQALNQTLKRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLG CLGVSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGVTLEGAFTGIMYYLTPQ WDKILEAKVWGDAASQIFYSLGCAWGGLVTMASYNKFHNNCYRDSVIISITNCATSV YAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILL GLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLM DNYAASFSLVIISCIMCVSIMYIYGHQNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFIL IFSVIQYQPITYNQYQSSQTGLPLFTCQIAPAHVPQPLSGARTPSPKPWSVRVSVLRA PLCSDSPGRAASNPL MAAAQGPVAPSK = LEQNGAVPSEATK = SDQNLGQGNWR = Measured Peptide = theoretical measured.695 difference error = 55 ppm Data Analysis for peptide mass mapping MS? protein peptides identify MS Peptide MW Found in Selected Databases NDALYFPT... SWDLTAL... PTDLDVSY... Important data multiple peaks mass accuracy confirming information (pi, approx. mass, organism, etc.) rank 21

22 Computer Exercise #4 Analyze peptide mass mapping data 4 lists of peptide masses provided on worksheet (Alternate address of excel data): Problems with whole protein analysis Peaks are broad large groups of isotope peaks peaks further broadened by adducts (contaminants, salts) Proteins are often modified Instrument may not resolve the mass difference No information regarding which amino acid is modified Proteins are in a complex matrix background stuff other proteins (too complex!!!) Therefore proteins are identified from peptides! 22

23 How are proteins separated Proteins from biological organisms are a complex mixture Separating proteins 1D SDS-PAGE Cross linking controls MW separated Low resolution technique, spot can contain 1's to 1's of proteins 2D SDS-PAGE Best for complex protein mixtures (IEF + SDS-PAGE) Other methods Chromatography (reverse phase, size exclusion, ion exchange, affinity) Preparative isolectric focusing (IEF) 1D Electrophoresis Great clean-up tool (rid of salts, detergents, etc ) Great concentration tool Biological analytes Various stains available various detection limits USE PRECAST GELS (polymer issue) if possible Various size gels (spatial resolution) Various MW ranges Protein Mixture or IP eluant 1D SDS-PAGE 23

24 1D Electrophoresis 2D Electrophoresis (1) Separation on the basis of intrinsic charge (pk a ) isoelectric focusing (2) Separation on the basis of Size PAGE (SDS gel electrophoresis) 24

25 2D Electrophoresis Protein Mixture or IP eluant or Cell/tissue 2D SDS-PAGE Great clean-up tool (rid of salts, detergents, etc ) Various stains available various detection limits Protein profiling Various ph ranges 2D gels are very much sample related (sample may require further clean-up prior to 2D gel Avoid excess salts in sample (not focus, IPGs burn, 3-4 mm max salt) Often Automated w/ robotics high throughput (MALDI-TOF) Often good for visualizing PTMs The 1 st D: Isoelectric Focussing + ph 3 ph 7.5 ph 1 + ph 3 ph 7.5 ph 1 + ph 3 ph 7.5 ph 1 + ph 3 ph 7.5 ph 1 25

26 The 2 nd D: SDS-PAGE Proteins migrate through the gel at a rate proportional to their size Smallest proteins travel the furthest distance + + ph 3 ph 3 ph 7.5 ph 7.5 ph1 ph1 ph 3 ph 7.5 ph1 size charge Do Computer Exercise #3 Laboratory tour 26

Electrospray Ion Trap Mass Spectrometry. Introduction

Electrospray Ion Trap Mass Spectrometry. Introduction Electrospray Ion Source Electrospray Ion Trap Mass Spectrometry Introduction The key to using MS for solutions is the ability to transfer your analytes into the vacuum of the mass spectrometer as ionic

More information

Master course KEMM03 Principles of Mass Spectrometric Protein Characterization. Exam

Master course KEMM03 Principles of Mass Spectrometric Protein Characterization. Exam Exam Master course KEMM03 Principles of Mass Spectrometric Protein Characterization 2010-10-29 kl 08.15-13.00 Use a new paper for answering each question! Write your name on each paper! Aids: Mini calculator,

More information

Aiping Lu. Key Laboratory of System Biology Chinese Academic Society APLV@sibs.ac.cn

Aiping Lu. Key Laboratory of System Biology Chinese Academic Society APLV@sibs.ac.cn Aiping Lu Key Laboratory of System Biology Chinese Academic Society APLV@sibs.ac.cn Proteome and Proteomics PROTEin complement expressed by genome Marc Wilkins Electrophoresis. 1995. 16(7):1090-4. proteomics

More information

Proteomics in Practice

Proteomics in Practice Reiner Westermeier, Torn Naven Hans-Rudolf Höpker Proteomics in Practice A Guide to Successful Experimental Design 2008 Wiley-VCH Verlag- Weinheim 978-3-527-31941-1 Preface Foreword XI XIII Abbreviations,

More information

Introduction to Proteomics

Introduction to Proteomics Introduction to Proteomics Why Proteomics? Same Genome Different Proteome Black Swallowtail - larvae and butterfly Biological Complexity Yeast - a simple proteome 6,113 proteins = 344,855 tryptic peptides

More information

Introduction to mass spectrometry (MS) based proteomics and metabolomics

Introduction to mass spectrometry (MS) based proteomics and metabolomics Introduction to mass spectrometry (MS) based proteomics and metabolomics Tianwei Yu Department of Biostatistics and Bioinformatics Rollins School of Public Health Emory University September 10, 2015 Background

More information

AB SCIEX TOF/TOF 4800 PLUS SYSTEM. Cost effective flexibility for your core needs

AB SCIEX TOF/TOF 4800 PLUS SYSTEM. Cost effective flexibility for your core needs AB SCIEX TOF/TOF 4800 PLUS SYSTEM Cost effective flexibility for your core needs AB SCIEX TOF/TOF 4800 PLUS SYSTEM It s just what you expect from the industry leader. The AB SCIEX 4800 Plus MALDI TOF/TOF

More information

Principles and Applications of Proteomics

Principles and Applications of Proteomics Principles and Applications of Proteomics Why Proteomics? 2-DE Overview Sample preparation 1 st & 2 nd dimension seperation Data Analysis Sample preparation for Mass Spectrometry Mass Spectrometry MALDI-TOF,

More information

Proteomic Analysis using Accurate Mass Tags. Gordon Anderson PNNL January 4-5, 2005

Proteomic Analysis using Accurate Mass Tags. Gordon Anderson PNNL January 4-5, 2005 Proteomic Analysis using Accurate Mass Tags Gordon Anderson PNNL January 4-5, 2005 Outline Accurate Mass and Time Tag (AMT) based proteomics Instrumentation Data analysis Data management Challenges 2 Approach

More information

Effects of Intelligent Data Acquisition and Fast Laser Speed on Analysis of Complex Protein Digests

Effects of Intelligent Data Acquisition and Fast Laser Speed on Analysis of Complex Protein Digests Effects of Intelligent Data Acquisition and Fast Laser Speed on Analysis of Complex Protein Digests AB SCIEX TOF/TOF 5800 System with DynamicExit Algorithm and ProteinPilot Software for Robust Protein

More information

TECHNICAL BULLETIN. ProteoMass Peptide & Protein MALDI-MS Calibration Kit. Catalog Number MSCAL1 Store at Room Temperature

TECHNICAL BULLETIN. ProteoMass Peptide & Protein MALDI-MS Calibration Kit. Catalog Number MSCAL1 Store at Room Temperature ProteoMass Peptide & Protein MALDI-MS Calibration Kit Catalog Number MSCAL1 Store at Room Temperature TECHNICAL BULLETIN Description This kit provides a range of standard peptides and proteins for the

More information

Introduction to Proteomics 1.0

Introduction to Proteomics 1.0 Introduction to Proteomics 1.0 CMSP Workshop Tim Griffin Associate Professor, BMBB Faculty Director, CMSP Objectives Why are we here? For participants: Learn basics of MS-based proteomics Learn what s

More information

Mass Spectrometry Based Proteomics

Mass Spectrometry Based Proteomics Mass Spectrometry Based Proteomics Proteomics Shared Research Oregon Health & Science University Portland, Oregon This document is designed to give a brief overview of Mass Spectrometry Based Proteomics

More information

Pesticide Analysis by Mass Spectrometry

Pesticide Analysis by Mass Spectrometry Pesticide Analysis by Mass Spectrometry Purpose: The purpose of this assignment is to introduce concepts of mass spectrometry (MS) as they pertain to the qualitative and quantitative analysis of organochlorine

More information

Laboration 1. Identifiering av proteiner med Mass Spektrometri. Klinisk Kemisk Diagnostik

Laboration 1. Identifiering av proteiner med Mass Spektrometri. Klinisk Kemisk Diagnostik Laboration 1 Identifiering av proteiner med Mass Spektrometri Klinisk Kemisk Diagnostik Sven Kjellström 2014 kjellstrom.sven@gmail.com 0702-935060 Laboration 1 Klinisk Kemisk Diagnostik Identifiering av

More information

Molecular Cell Biology. Prof. D. Karunagaran. Department of Biotechnology. Indian Institute of Technology Madras

Molecular Cell Biology. Prof. D. Karunagaran. Department of Biotechnology. Indian Institute of Technology Madras Molecular Cell Biology Prof. D. Karunagaran Department of Biotechnology Indian Institute of Technology Madras Module 5 Methods in Cell Biology (Methods to Manipulate Protein, DNA and RNA and Methods to

More information

Electrospray Mass Spectrometry of Tris-acetylacetonatochromium(III)

Electrospray Mass Spectrometry of Tris-acetylacetonatochromium(III) Electrospray Mass Spectrometry of Tris-acetylacetonatochromium(III) Purpose: Verify the synthesis of the synthesis product, Cr(acac) 3. The presence of any urea containing byproducts will also be determined.

More information

Pep-Miner: A Novel Technology for Mass Spectrometry-Based Proteomics

Pep-Miner: A Novel Technology for Mass Spectrometry-Based Proteomics Pep-Miner: A Novel Technology for Mass Spectrometry-Based Proteomics Ilan Beer Haifa Research Lab Dec 10, 2002 Pep-Miner s Location in the Life Sciences World The post-genome era - the age of proteome

More information

LABORATÓRIUMI GYAKORLAT SILLABUSZ SYLLABUS OF A PRACTICAL DEMONSTRATION. financed by the program

LABORATÓRIUMI GYAKORLAT SILLABUSZ SYLLABUS OF A PRACTICAL DEMONSTRATION. financed by the program TÁMOP-4.1.1.C-13/1/KONV-2014-0001 projekt Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére program

More information

In-Depth Qualitative Analysis of Complex Proteomic Samples Using High Quality MS/MS at Fast Acquisition Rates

In-Depth Qualitative Analysis of Complex Proteomic Samples Using High Quality MS/MS at Fast Acquisition Rates In-Depth Qualitative Analysis of Complex Proteomic Samples Using High Quality MS/MS at Fast Acquisition Rates Using the Explore Workflow on the AB SCIEX TripleTOF 5600 System A major challenge in proteomics

More information

Separation of Amino Acids by Paper Chromatography

Separation of Amino Acids by Paper Chromatography Separation of Amino Acids by Paper Chromatography Chromatography is a common technique for separating chemical substances. The prefix chroma, which suggests color, comes from the fact that some of the

More information

High-Throughput 3-D Chromatography Through Ion Exchange SPE

High-Throughput 3-D Chromatography Through Ion Exchange SPE High-Throughput 3-D Chromatography Through Ion Exchange SPE Application Note 205 Luke Roenneburg and Alan Hamstra (Gilson, Inc.) Introduction 2-dimensional (2-D) separation is the separation of a sample

More information

Workshop IIc. Manual interpretation of MS/MS spectra. Ebbing de Jong. Center for Mass Spectrometry and Proteomics Phone (612)625-2280 (612)625-2279

Workshop IIc. Manual interpretation of MS/MS spectra. Ebbing de Jong. Center for Mass Spectrometry and Proteomics Phone (612)625-2280 (612)625-2279 Workshop IIc Manual interpretation of MS/MS spectra Ebbing de Jong Why MS/MS spectra? The information contained in an MS spectrum (m/z, isotope spacing and therefore z ) is not enough to tell us the amino

More information

Guide to Reverse Phase SpinColumns Chromatography for Sample Prep

Guide to Reverse Phase SpinColumns Chromatography for Sample Prep Guide to Reverse Phase SpinColumns Chromatography for Sample Prep www.harvardapparatus.com Contents Introduction...2-3 Modes of Separation...4-6 Spin Column Efficiency...7-8 Fast Protein Analysis...9 Specifications...10

More information

LC-MS/MS for Chromatographers

LC-MS/MS for Chromatographers LC-MS/MS for Chromatographers An introduction to the use of LC-MS/MS, with an emphasis on the analysis of drugs in biological matrices LC-MS/MS for Chromatographers An introduction to the use of LC-MS/MS,

More information

Introduction to Mass Spectrometry. W.M. Keck Biomedical Mass Spectrometry Lab

Introduction to Mass Spectrometry. W.M. Keck Biomedical Mass Spectrometry Lab Introduction to Mass Spectrometry W.M. Keck Biomedical Mass Spectrometry Lab Moore Health Sciences Library Rooms 1335 & 1337 May 18, 2010 The Keck Mass Spectrometry Lab of the Biomolecular Resource Facility

More information

Appendix 5 Overview of requirements in English

Appendix 5 Overview of requirements in English Appendix 5 Overview of requirements in English This document is a translation of Appendix 4 (Bilag 4) section 2. This translation is meant as a service for the bidder and in case of any differences between

More information

Week 9: MS in Space and Proteomics

Week 9: MS in Space and Proteomics Week 9: MS in Space and Proteomics 1 Last Time Detectors Small Molecule Applications, Environmental: (e.g. TWQC) 2 Mass Spectrometry in Space Possibly the coolest application of small molecule MS is in

More information

Functional Data Analysis of MALDI TOF Protein Spectra

Functional Data Analysis of MALDI TOF Protein Spectra Functional Data Analysis of MALDI TOF Protein Spectra Dean Billheimer dean.billheimer@vanderbilt.edu. Department of Biostatistics Vanderbilt University Vanderbilt Ingram Cancer Center FDA for MALDI TOF

More information

Tutorial for Proteomics Data Submission. Katalin F. Medzihradszky Robert J. Chalkley UCSF

Tutorial for Proteomics Data Submission. Katalin F. Medzihradszky Robert J. Chalkley UCSF Tutorial for Proteomics Data Submission Katalin F. Medzihradszky Robert J. Chalkley UCSF Why Have Guidelines? Large-scale proteomics studies create huge amounts of data. It is impossible/impractical to

More information

ANALYSIS OF PROTEINS AND PROTEOMES BY MASS SPECTROMETRY

ANALYSIS OF PROTEINS AND PROTEOMES BY MASS SPECTROMETRY Annu. Rev. Biochem. 2001. 70:437 73 Copyright c 2001 by Annual Reviews. All rights reserved ANALYSIS OF PROTEINS AND PROTEOMES BY MASS SPECTROMETRY Matthias Mann, 1,2 Ronald C. Hendrickson, 2 and Akhilesh

More information

Definition of the Measurand: CRP

Definition of the Measurand: CRP A Reference Measurement System for C-reactive Protein David M. Bunk, Ph.D. Chemical Science and Technology Laboratory National Institute of Standards and Technology Definition of the Measurand: Human C-reactive

More information

Methods for Protein Analysis

Methods for Protein Analysis Methods for Protein Analysis 1. Protein Separation Methods The following is a quick review of some common methods used for protein separation: SDS-PAGE (SDS-polyacrylamide gel electrophoresis) separates

More information

PosterREPRINT AN LC/MS ORTHOGONAL TOF (TIME OF FLIGHT) MASS SPECTROMETER WITH INCREASED TRANSMISSION, RESOLUTION, AND DYNAMIC RANGE OVERVIEW

PosterREPRINT AN LC/MS ORTHOGONAL TOF (TIME OF FLIGHT) MASS SPECTROMETER WITH INCREASED TRANSMISSION, RESOLUTION, AND DYNAMIC RANGE OVERVIEW OVERVIEW Exact mass LC/MS analysis using an orthogonal acceleration time of flight (oa-tof) mass spectrometer is a well-established technique with a broad range of applications. These include elemental

More information

Contents. Preface to the Second Edition List of Contributors XIII

Contents. Preface to the Second Edition List of Contributors XIII Contents Preface to the Second Edition List of Contributors XIII XI 1 The MALDI Process and Method 1 Franz Hillenkamp, Thorsten W. Jaskolla, and Michael Karas 1.1 Introduction 1 1.2 Analyte Incorporation

More information

0 10 20 30 40 50 60 70 m/z

0 10 20 30 40 50 60 70 m/z Mass spectrum for the ionization of acetone MS of Acetone + Relative Abundance CH 3 H 3 C O + M 15 (loss of methyl) + O H 3 C CH 3 43 58 0 10 20 30 40 50 60 70 m/z It is difficult to identify the ions

More information

NUVISAN Pharma Services

NUVISAN Pharma Services NUVISAN Pharma Services CESI MS Now available! 1st CRO in Europe! At the highest levels of quality. LABORATORY SERVICES Equipment update STATE OF THE ART AT NUVISAN CESI MS Now available! 1st CRO in Europe!

More information

Waters Core Chromatography Training (2 Days)

Waters Core Chromatography Training (2 Days) 2015 Page 2 Waters Core Chromatography Training (2 Days) The learning objective of this two day course is to teach the user core chromatography, system and software fundamentals in an outcomes based approach.

More information

Application of a New Immobilization H/D Exchange Protocol: A Calmodulin Study

Application of a New Immobilization H/D Exchange Protocol: A Calmodulin Study Application of a New Immobilization H/D Exchange Protocol: A Calmodulin Study Jiang Zhao; Mei Zhu; Daryl E. Gilblin; Michael L. Gross Washington University Center for Biomrdical and Bioorganic Mass Spectrometry:

More information

STANFORD UNIVERSITY MASS SPECTROMETRY 333 CAMPUS DR., MUDD 175 STANFORD, CA 94305-5080

STANFORD UNIVERSITY MASS SPECTROMETRY 333 CAMPUS DR., MUDD 175 STANFORD, CA 94305-5080 Training on the ZQ Open access MS Questions? Contact Dr. Allis Chien allis@stanford.edu 650-723-0710 0710 STANFORD UNIVERSITY MASS SPECTROMETRY STANFORD UNIVERSITY MASS SPECTROMETRY 333 CAMPUS DR., MUDD

More information

Application Note # LCMS-81 Introducing New Proteomics Acquisiton Strategies with the compact Towards the Universal Proteomics Acquisition Method

Application Note # LCMS-81 Introducing New Proteomics Acquisiton Strategies with the compact Towards the Universal Proteomics Acquisition Method Application Note # LCMS-81 Introducing New Proteomics Acquisiton Strategies with the compact Towards the Universal Proteomics Acquisition Method Introduction During the last decade, the complexity of samples

More information

Accurate calibration of on-line Time of Flight Mass Spectrometer (TOF-MS) for high molecular weight combustion product analysis

Accurate calibration of on-line Time of Flight Mass Spectrometer (TOF-MS) for high molecular weight combustion product analysis Accurate calibration of on-line Time of Flight Mass Spectrometer (TOF-MS) for high molecular weight combustion product analysis B. Apicella*, M. Passaro**, X. Wang***, N. Spinelli**** mariadellarcopassaro@gmail.com

More information

Statistical Analysis Strategies for Shotgun Proteomics Data

Statistical Analysis Strategies for Shotgun Proteomics Data Statistical Analysis Strategies for Shotgun Proteomics Data Ming Li, Ph.D. Cancer Biostatistics Center Vanderbilt University Medical Center Ayers Institute Biomarker Pipeline normal shotgun proteome analysis

More information

Chapter 14. Modeling Experimental Design for Proteomics. Jan Eriksson and David Fenyö. Abstract. 1. Introduction

Chapter 14. Modeling Experimental Design for Proteomics. Jan Eriksson and David Fenyö. Abstract. 1. Introduction Chapter Modeling Experimental Design for Proteomics Jan Eriksson and David Fenyö Abstract The complexity of proteomes makes good experimental design essential for their successful investigation. Here,

More information

13C NMR Spectroscopy

13C NMR Spectroscopy 13 C NMR Spectroscopy Introduction Nuclear magnetic resonance spectroscopy (NMR) is the most powerful tool available for structural determination. A nucleus with an odd number of protons, an odd number

More information

Chapter 21 Principles of Chromatography and Mass Spectrometry Problems 1,2,3,4,8,9,11,13

Chapter 21 Principles of Chromatography and Mass Spectrometry Problems 1,2,3,4,8,9,11,13 Chapter 21 Principles of Chromatography and Mass Spectrometry Problems 1,2,3,4,8,9,11,13 21-1 What is Chromatography Process to separate and purify compounds in a mixture by passing them trough a material

More information

Preprocessing, Management, and Analysis of Mass Spectrometry Proteomics Data

Preprocessing, Management, and Analysis of Mass Spectrometry Proteomics Data Preprocessing, Management, and Analysis of Mass Spectrometry Proteomics Data M. Cannataro, P. H. Guzzi, T. Mazza, and P. Veltri Università Magna Græcia di Catanzaro, Italy 1 Introduction Mass Spectrometry

More information

M.Sc. in Nano Technology with specialisation in Nano Biotechnology

M.Sc. in Nano Technology with specialisation in Nano Biotechnology M.Sc. in Nano Technology with specialisation in Nano Biotechnology Nanotechnology is all about designing, fabricating and controlling materials, components and machinery with dimensions on the nanoscale,

More information

A Hybrid Microchip/Capillary Electrophoresis Mass Spectrometry Platform for Rapid and Ultrasensitive Bioanalysis

A Hybrid Microchip/Capillary Electrophoresis Mass Spectrometry Platform for Rapid and Ultrasensitive Bioanalysis A Hybrid Microchip/Capillary Electrophoresis Mass Spectrometry Platform for Rapid and Ultrasensitive Bioanalysis Ryan Kelly 1, Chenchen Wang, Cheng S. Lee, Richard D. Smith, Keqi Tang 1 Environmental Molecular

More information

ProteinPilot Report for ProteinPilot Software

ProteinPilot Report for ProteinPilot Software ProteinPilot Report for ProteinPilot Software Detailed Analysis of Protein Identification / Quantitation Results Automatically Sean L Seymour, Christie Hunter SCIEX, USA Pow erful mass spectrometers like

More information

AxION edoor. Web-Based, Open-Access Mass Spectrometry Software

AxION edoor. Web-Based, Open-Access Mass Spectrometry Software AxION edoor Web-Based, Open-Access Mass Spectrometry Software 2 AxION edoor is the open-access software solution for today s fast-paced laboratory. It is designed to operate and optimize the management

More information

Brochure More information from http://www.researchandmarkets.com/reports/2172993/

Brochure More information from http://www.researchandmarkets.com/reports/2172993/ Brochure More information from http://www.researchandmarkets.com/reports/2172993/ Proteomics Today. Protein Assessment and Biomarkers Using Mass Spectrometry, 2D Electrophoresis,and Microarray Technology.

More information

Nuclear Structure. particle relative charge relative mass proton +1 1 atomic mass unit neutron 0 1 atomic mass unit electron -1 negligible mass

Nuclear Structure. particle relative charge relative mass proton +1 1 atomic mass unit neutron 0 1 atomic mass unit electron -1 negligible mass Protons, neutrons and electrons Nuclear Structure particle relative charge relative mass proton 1 1 atomic mass unit neutron 0 1 atomic mass unit electron -1 negligible mass Protons and neutrons make up

More information

Mass Spectrometry. Overview

Mass Spectrometry. Overview Mass Spectrometry Overview Mass Spectrometry is an analytic technique that utilizes the degree of deflection of charged particles by a magnetic field to find the relative masses of molecular ions and fragments.2

More information

SimGlycan Software*: A New Predictive Carbohydrate Analysis Tool for MS/MS Data

SimGlycan Software*: A New Predictive Carbohydrate Analysis Tool for MS/MS Data SimGlycan Software*: A New Predictive Carbohydrate Analysis Tool for MS/MS Data Automated Data Interpretation for Glycan Characterization Jenny Albanese 1, Matthias Glueckmann 2 and Christof Lenz 2 1 AB

More information

MultiQuant Software 2.0 for Targeted Protein / Peptide Quantification

MultiQuant Software 2.0 for Targeted Protein / Peptide Quantification MultiQuant Software 2.0 for Targeted Protein / Peptide Quantification Gold Standard for Quantitative Data Processing Because of the sensitivity, selectivity, speed and throughput at which MRM assays can

More information

Mass Spectra Alignments and their Significance

Mass Spectra Alignments and their Significance Mass Spectra Alignments and their Significance Sebastian Böcker 1, Hans-Michael altenbach 2 1 Technische Fakultät, Universität Bielefeld 2 NRW Int l Graduate School in Bioinformatics and Genome Research,

More information

AMD Analysis & Technology AG

AMD Analysis & Technology AG AMD Analysis & Technology AG Application Note 120419 Author: Karl-Heinz Maurer APCI-MS Trace Analysis of volatile organic compounds in ambient air A) Introduction Trace analysis of volatile organic compounds

More information

泛 用 蛋 白 質 體 學 之 質 譜 儀 資 料 分 析 平 台 的 建 立 與 應 用 Universal Mass Spectrometry Data Analysis Platform for Quantitative and Qualitative Proteomics

泛 用 蛋 白 質 體 學 之 質 譜 儀 資 料 分 析 平 台 的 建 立 與 應 用 Universal Mass Spectrometry Data Analysis Platform for Quantitative and Qualitative Proteomics 泛 用 蛋 白 質 體 學 之 質 譜 儀 資 料 分 析 平 台 的 建 立 與 應 用 Universal Mass Spectrometry Data Analysis Platform for Quantitative and Qualitative Proteomics 2014 Training Course Wei-Hung Chang ( 張 瑋 宏 ) ABRC, Academia

More information

PrepTip. Reverse Phase PrepTip User Guide

PrepTip. Reverse Phase PrepTip User Guide PrepTip Reverse Phase PrepTip User Guide All text, photographs and illustrations are copyrighted by Harvard Apparatus, Inc. 2004. PrepTip is a trademark of Harvard Apparatus, Inc. Harvard Apparatus 84

More information

Mass Spectrometry Signal Calibration for Protein Quantitation

Mass Spectrometry Signal Calibration for Protein Quantitation Cambridge Isotope Laboratories, Inc. www.isotope.com Proteomics Mass Spectrometry Signal Calibration for Protein Quantitation Michael J. MacCoss, PhD Associate Professor of Genome Sciences University of

More information

Advantages of the LTQ Orbitrap for Protein Identification in Complex Digests

Advantages of the LTQ Orbitrap for Protein Identification in Complex Digests Application Note: 386 Advantages of the LTQ Orbitrap for Protein Identification in Complex Digests Rosa Viner, Terry Zhang, Scott Peterman, and Vlad Zabrouskov, Thermo Fisher Scientific, San Jose, CA,

More information

Introduction to Proteomics

Introduction to Proteomics Introduction to Proteomics Åsa Wheelock, Ph.D. Division of Respiratory Medicine & Karolinska Biomics Center asa.wheelock@ki.se In: Systems Biology and the Omics Cascade, Karolinska Institutet, June 9-13,

More information

amazon SL Innovation with Integrity Setting New Standards in Performance, Simplicity and Value Ion Trap MS

amazon SL Innovation with Integrity Setting New Standards in Performance, Simplicity and Value Ion Trap MS amazon SL Setting New Standards in Performance, Simplicity and Value Innovation with Integrity Ion Trap Best-In-Class Ion Trap Mass Spectrometer for Routine Analysis The amazon SL entry-level system is

More information

The Theory of HPLC. Gradient HPLC

The Theory of HPLC. Gradient HPLC The Theory of HPLC Gradient HPLC i Wherever you see this symbol, it is important to access the on-line course as there is interactive material that cannot be fully shown in this reference manual. Aims

More information

Standard Mixture. TOF/TOF Calibration Mixture. Calibration Mixture 1 (Cal Mix 1, 1:10) Calibration Mixture 1 (Cal Mix 1, 1:100)

Standard Mixture. TOF/TOF Calibration Mixture. Calibration Mixture 1 (Cal Mix 1, 1:10) Calibration Mixture 1 (Cal Mix 1, 1:100) Mass Standards Kit for Calibration of AB SCIEX TOF/TOF Instruments Protocol 1 Product Description The Mass Standards Kit includes reagents needed to test instrument function, optimize instrument parameters,

More information

7 Electrophoresis. µ proportional to Q

7 Electrophoresis. µ proportional to Q 7 Electrophoresis Objectives: A) To perform agarose gel electrophoresis of the proteins isolated in last week's experiment and B) to interpret the banding patterns produced by these proteins. Introduction:

More information

Chapter 3 Amino Acids, Peptides, Proteins

Chapter 3 Amino Acids, Peptides, Proteins Chapter 3 Amino Acids, Peptides, Proteins Also start memorizing AA: names, structures, abbreviations, 1 letter codes, pka s of side chains 3.1 Amino acids Amino acid is monomer condensed into peptide (small)

More information

Q-TOF User s Booklet. Enter your username and password to login. After you login, the data acquisition program will automatically start.

Q-TOF User s Booklet. Enter your username and password to login. After you login, the data acquisition program will automatically start. Q-TOF User s Booklet Enter your username and password to login. After you login, the data acquisition program will automatically start. ~ 1 ~ This data acquisition window will come up after the program

More information

PeptidomicsDB: a new platform for sharing MS/MS data.

PeptidomicsDB: a new platform for sharing MS/MS data. PeptidomicsDB: a new platform for sharing MS/MS data. Federica Viti, Ivan Merelli, Dario Di Silvestre, Pietro Brunetti, Luciano Milanesi, Pierluigi Mauri NETTAB2010 Napoli, 01/12/2010 Mass Spectrometry

More information

Purification of reaction mixtures using flash chromatography.

Purification of reaction mixtures using flash chromatography. Purification of reaction mixtures using flash chromatography. This technical note details the use of ISOLUTE Flash chromatography columns for the purification of reaction mixtures. What is flash chromatography?

More information

Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance?

Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance? Optimization 1 Choices, choices, choices... Which sequence database? Which modifications? What mass tolerance? Where to begin? 2 Sequence Databases Swiss-prot MSDB, NCBI nr dbest Species specific ORFS

More information

Biopharmaceutical Glycosylation Analysis

Biopharmaceutical Glycosylation Analysis Biopharmaceutical Glycosylation Analysis Glycosylation Analysis: Product Offering Molecular model of erythropoietin with complex N-linked glycans. Courtesy of M.R Wormald and R.A Dwek, Oxford Glycobioloy

More information

THE BASICS OF MASS SPECTROMETRY IN THE TWENTY- FIRST CENTURY

THE BASICS OF MASS SPECTROMETRY IN THE TWENTY- FIRST CENTURY THE BASICS OF MASS SPECTROMETRY IN THE TWENTY- FIRST CENTURY Gary L. Glish* and Richard W. Vachet Enormous advances in our understanding of the chemistry underlying life processes have identified new targets

More information

Increasing the Multiplexing of High Resolution Targeted Peptide Quantification Assays

Increasing the Multiplexing of High Resolution Targeted Peptide Quantification Assays Increasing the Multiplexing of High Resolution Targeted Peptide Quantification Assays Scheduled MRM HR Workflow on the TripleTOF Systems Jenny Albanese, Christie Hunter AB SCIEX, USA Targeted quantitative

More information

Application Note # MT-90 MALDI-TDS: A Coherent MALDI Top-Down-Sequencing Approach Applied to the ABRF-Protein Research Group Study 2008

Application Note # MT-90 MALDI-TDS: A Coherent MALDI Top-Down-Sequencing Approach Applied to the ABRF-Protein Research Group Study 2008 Bruker Daltonics Application Note # MT-90 MALDI-TDS: A Coherent MALDI Top-Down-Sequencing Approach Applied to the ABRF-Protein Research Group Study 2008 In the ABRF-PRG study 2008 [*] the ability to characterize

More information

Mass spectrometry. Dr. Kevin R. Tucker

Mass spectrometry. Dr. Kevin R. Tucker Mass spectrometry Dr. Kevin R. Tucker What is mass spectrometry? A versatile analytical technique used to determine the composition of chemical samples either at the atomic or molecular level. Ionic forms

More information

High resolution mass spectrometry (HRMS*) in Graz

High resolution mass spectrometry (HRMS*) in Graz High resolution mass spectrometry (HRMS*) in Graz 10.2.2012 * Instruments with high resolution where exact mass measurements can be performed 1 HRMS in Graz s and Ionization Techniques 2 6 3 5 4 1 TU Graz

More information

Lipid analysis by multiple "omic" mass spectrometry platforms Where we ve been, where we are, and where we re going

Lipid analysis by multiple omic mass spectrometry platforms Where we ve been, where we are, and where we re going Lipid analysis by multiple "omic" mass spectrometry platforms Where we ve been, where we are, and where we re going Jeff McDonald Department of Molecular Genetics UT Southwestern Medical Center Dallas,

More information

LC-MS/MS Method for the Determination of Docetaxel in Human Serum for Clinical Research

LC-MS/MS Method for the Determination of Docetaxel in Human Serum for Clinical Research LC-MS/MS Method for the Determination of Docetaxel in Human Serum for Clinical Research J. Jones, J. Denbigh, Thermo Fisher Scientific, Runcorn, Cheshire, UK Application Note 20581 Key Words SPE, SOLA,

More information

How To Use Gc-Ms

How To Use Gc-Ms The CHROMacademy Essential Guide Understanding GC-MS Analysis Part 1 Speakers John Hinshaw GC Dept. Dean CHROMacademy Tony Taylor Technical Director Crawford Scientific Moderator M ( g ) e M ( g ) 2e Peter

More information

--not necessarily a protein! (all proteins are polypeptides, but the converse is not true)

--not necessarily a protein! (all proteins are polypeptides, but the converse is not true) 00Note Set 5b 1 PEPTIDE BONDS AND POLYPEPTIDES OLIGOPEPTIDE: --chain containing only a few amino acids (see tetrapaptide, Fig 5.9) POLYPEPTIDE CHAINS: --many amino acids joined together --not necessarily

More information

Unique Software Tools to Enable Quick Screening and Identification of Residues and Contaminants in Food Samples using Accurate Mass LC-MS/MS

Unique Software Tools to Enable Quick Screening and Identification of Residues and Contaminants in Food Samples using Accurate Mass LC-MS/MS Unique Software Tools to Enable Quick Screening and Identification of Residues and Contaminants in Food Samples using Accurate Mass LC-MS/MS Using PeakView Software with the XIC Manager to Get the Answers

More information

Session 1. Course Presentation: Mass spectrometry-based proteomics for molecular and cellular biologists

Session 1. Course Presentation: Mass spectrometry-based proteomics for molecular and cellular biologists Program Overview Session 1. Course Presentation: Mass spectrometry-based proteomics for molecular and cellular biologists Session 2. Principles of Mass Spectrometry Session 3. Mass spectrometry based proteomics

More information

Building innovative drug discovery alliances. Evotec Munich. Quantitative Proteomics to Support the Discovery & Development of Targeted Drugs

Building innovative drug discovery alliances. Evotec Munich. Quantitative Proteomics to Support the Discovery & Development of Targeted Drugs Building innovative drug discovery alliances Evotec Munich Quantitative Proteomics to Support the Discovery & Development of Targeted Drugs Evotec AG, Evotec Munich, June 2013 About Evotec Munich A leader

More information

How To Use An Acquity Qda Detector

How To Use An Acquity Qda Detector Mass-Directed Isolation of a Synthetic Peptide Using the ACQUITY QDa Detector Jo-Ann M. Jablonski and Andrew J. Aubin Waters Corporation, Milford, MA, USA APPLICATION BENEFITS The ACQUITY QDa Detector

More information

Increasing Quality While Maintaining Efficiency in Drug Chemistry with DART-TOF MS Screening

Increasing Quality While Maintaining Efficiency in Drug Chemistry with DART-TOF MS Screening Increasing Quality While Maintaining Efficiency in Drug Chemistry with DART-TOF MS Screening Application Note Forensics Author Erin Shonsey Director of Research Alabama Department of Forensic Science Abstract

More information

Using Natural Products Application Solution with UNIFI for the Identification of Chemical Ingredients of Green Tea Extract

Using Natural Products Application Solution with UNIFI for the Identification of Chemical Ingredients of Green Tea Extract Using Natural Products Application Solution with UNIFI for the Identification of Chemical Ingredients of Green Tea Extract Lirui Qiao, 1 Rob Lewis, 2 Alex Hooper, 2 James Morphet, 2 Xiaojie Tan, 1 Kate

More information

for mass spectrometry calibration tools Thermo Scientific Pierce Controls and Standards for Mass Spectrometry

for mass spectrometry calibration tools Thermo Scientific Pierce Controls and Standards for Mass Spectrometry Thermo Scientific Pierce Controls and Standards for Mass Spectrometry calibration tools for mass spectrometry Ensure confidence in instrument performance with Thermo Scientific Pierce Calibration Solutions

More information

Mass spectrometry. What are the principles behind MS? What do all MS instruments have in common?

Mass spectrometry. What are the principles behind MS? What do all MS instruments have in common? Mass spectrometry What are the principles behind MS? What do all MS instruments have in common? What are the different types of MS? Lecture outline: 1) Introduction to mass spectrometry 2) sample introduction

More information

SPECIAL FEATURE: TUTORIAL

SPECIAL FEATURE: TUTORIAL JOURNAL OF MASS SPECTROMETRY, VOL. 32, 263È276 (1997) SPECIAL FEATURE: TUTORIAL High-resolution Mass Spectrometry and Accurate Mass Measurements with Emphasis on the Characterization of Peptides and Proteins

More information

[ Care and Use Manual ]

[ Care and Use Manual ] PREP Calibration Mix DIOS Low i. Introduction Pre-packaged PREP Calibration Mixtures eliminate the need to purchase and store large quantities of the component calibration reagents, simplifying sample

More information

Challenges in Computational Analysis of Mass Spectrometry Data for Proteomics

Challenges in Computational Analysis of Mass Spectrometry Data for Proteomics Ma B. Challenges in computational analysis of mass spectrometry data for proteomics. SCIENCE AND TECHNOLOGY 25(1): 1 Jan. 2010 JOURNAL OF COMPUTER Challenges in Computational Analysis of Mass Spectrometry

More information

Troubleshooting Guide for DNA Electrophoresis

Troubleshooting Guide for DNA Electrophoresis Troubleshooting Guide for Electrophoresis. ELECTROPHORESIS Protocols and Recommendations for Electrophoresis electrophoresis problem 1 Low intensity of all or some bands 2 Smeared bands 3 Atypical banding

More information

ProteinChip Energy Absorbing Molecules (EAM)

ProteinChip Energy Absorbing Molecules (EAM) ProteinChip Energy Absorbing Molecules (EAM) Instruction Manual Catalog #C30-00001, #C30-00002, #C30-00003, #C30-00004 For technical support, call your local Bio-Rad office, or in the US, call 1-800-4BIORAD

More information

Supplementary Materials and Methods (Metabolomics analysis)

Supplementary Materials and Methods (Metabolomics analysis) Supplementary Materials and Methods (Metabolomics analysis) Metabolite extraction and mass spectrometry analysis. 12 Vldlr-/- knock out and 12 wild type (WT) retinas were separately frozen at -80 ºC in

More information

Separation of Peptides from Enzymatic Digestion on Different Acclaim Columns: A Comparative Study

Separation of Peptides from Enzymatic Digestion on Different Acclaim Columns: A Comparative Study Application Update Now sold under the Thermo Scientific brand Separation of Peptides from Enzymatic Digestion on Different claim Columns: A Comparative Study INTRODUCTION Separation of peptides which can

More information

Background Information

Background Information 1 Gas Chromatography/Mass Spectroscopy (GC/MS/MS) Background Information Instructions for the Operation of the Varian CP-3800 Gas Chromatograph/ Varian Saturn 2200 GC/MS/MS See the Cary Eclipse Software

More information

ProteinScape. Innovation with Integrity. Proteomics Data Analysis & Management. Mass Spectrometry

ProteinScape. Innovation with Integrity. Proteomics Data Analysis & Management. Mass Spectrometry ProteinScape Proteomics Data Analysis & Management Innovation with Integrity Mass Spectrometry ProteinScape a Virtual Environment for Successful Proteomics To overcome the growing complexity of proteomics

More information

Ionization Methods in Organic Mass Spectrometry Contents:

Ionization Methods in Organic Mass Spectrometry Contents: Ionization Methods in Organic Mass Spectrometry Contents:. Introduction. Gas-Phase Ionization. Electron Ionization (EI). Chemical Ionization (CI). Desorption Chemical Ionization (DCI). Negative-ion chemical

More information