Analyzing antibody sequence for recombinant antibody expression. Hangxing Yu, Ph.D Senior Scientist, GenScript May 20, 2015
|
|
|
- Bernard Carson
- 10 years ago
- Views:
Transcription
1 Analyzing antibody sequence for recombinant antibody expression Hangxing Yu, Ph.D Senior Scientist, GenScript May 20, 2015
2 Presentation Outline Antibody basics, structure and function Antibody production in vivo Antibody database and analysis Optimization of antibody production 2
3 Antibody basics, structure and function Antibody production in vivo Antibody database and analysis Optimization of antibody production 3
4 What is an Antibody? An antibody (aka Immunoglobulin) is a large Y-shaped protein produced by B cells. Used by the immune system to neutralize foreign objects. 4
5 Types of Antibody in vivo Name Function Light Chain Heavy Chain IgA Found in mucosal areas κ or λ κ or λ α1 α2 IgD Antigen receptors on B cells κ or λ δ IgE Binds to allergen and triggers histamine release κ or λ ε IgM Secreted from B cells with very high avidity κ or λ µ IgG Majority of antibody-based immunity κ or λ γ1 γ2 γ3 γ4 γ1 γ2a γ2b γ3 5
6 Structural and Functional Units of IgG "Y"-shaped molecule Fab region determines its antigen specificity. (Fv region and CDR) Fc region determines the effects. Hinge region. 6
7 Antibody-Antigen Interaction Each antibody binds only to a specific antigen. Ab-Ag interaction are based on non-covalent binding between Ab and Ag. The hinge region allow better binding. 7
8 Antibody-Antigen Interaction Antibody and antigen interact by spatial complementarity. Weak and non-covalent bonds. electrostatic interactions hydrogen bonds Van der Waals forces hydrophobic interactions Binding between antibody and antigen is reversible. 8
9 Complementarity Determining Regions (CDRs) Ab binding residues are mainly located in CDRs. 6 CDRs form the combining site: L1, L2, L3, H1, H2, H3. CDR-H3 and L3 have a distinctive role in antigen recognition. 9
10 Antibody basics, structure and function Antibody production in vivo Antibody database and analysis Optimization of antibody production 10
11 Activation of B cells to Produce Abs 11
12 Antibody Gene Rearrangement 12
13 Antibody Gene Rearrangement Somatic Hypermutation allows slight amino acid differences in the variable domains. Class-switch recombination produce antibodies of different isotypes or subtype. 13
14 Production of migg by Hybridoma Hybridoma: fusion cell of specific antibody producing B cells with myeloma. Used for production of monoclonal antibody. Inventor: Milstein and Köhler. Nobel Prize in Physiology or Medicine in
15 Recombinant Antibody Production Hybridoma Antibody Sequence Gene Synthesizing and Sub cloning Recombinant Antibody Production Small Scale Production for Function Analysis Scale-up Production of Interested Antibodies Stable Cell Line Development Large Scale Production-GLP/cGMP (with partner) 15
16 Antibody basics, structure and function Antibody production in vivo Antibody database and analysis Optimization of antibody production 16
17 Online Antibody Analysis Tool Bioinf IMGT AbCheck - Antibody Sequence Test IgBlast Sequence alignment tools
18 Kabat Numbering 18
19 IMGT Analysis 19
20 IMGT Analysis V domain 20
21 Identifying CDRs by sequence CDR-L1 Start Approx residue 24 Residue always a Cys before Residue after always a Trp. Typically Trp-Tyr-Gln, but also, Trp-Leu-Gln, Trp- Phe-Gln, Trp-Tyr-Leu Length 10 to 17 residues CDR-L2 Start Residues before Length always 16 residues after the end of L1 generally Ile-Tyr, but also, Val-Tyr, Ile-Lys, Ile-Phe always 7 residues (except NEW (7FAB) which has a deletion in this region) CDR-L3 Start Residue before Residues after Length always 33 residues after end of L2 (except NEW (7FAB) which has the deletion at the end of CDR-L2) always Cys always Phe-Gly-XXX-Gly 7 to 11 residues 21
22 Identifying CDRs by sequence CDR-H1 Start Approx residue 26 (always 4 after a Cys) [Chothia / AbM defintion]; Kabat definition starts 5 residues later Residues always Cys-XXX-XXX-XXX before Residues after always a Trp. Typically Trp-Val, but also, Trp-Ile, Trp-Ala Length 10 to 12 residues [AbM definition]; Chothia definition excludes the last 4 residues CDR-H2 Start always 15 residues after the end of Kabat / AbM definition) of CDR-H1 Residues typically Leu-Glu-Trp-Ile-Gly, but a number of variations before Residues after Lys/Arg-Leu/Ile/Val/Phe/Thr/Ala-Thr/Ser/Ile/Ala Length Kabat definition 16 to 19 residues; AbM (and recent Chothia) definition ends 7 residues earlier CDR-H3 Start always 33 residues after end of CDR-H2 (always 2 after a Cys) Residues always Cys-XXX-XXX (typically Cys-Ala-Arg) before Residues after always Trp-Gly-XXX-Gly Length 3 to 25(!) residues 22
23 Identifying CDRs by sequence Region Position Sequence Characterization Length CDR-L C W/WYQ/WLQ/WFQ/WYL CDR-L IY/VY/IF CDR-L C FG*G 7-11 Light chain: Amino acids sequence (237 AA) Leader sequence-fr1-cdr1-fr2-cdr2-fr3-cdr3-fr4-constant region-stop codon MKLPVRLLVLMFWIPASSSDVVMTQIPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQ SPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPTFGGGTKLEIKRADAA PTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSST LTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 23
24 Identifying CDRs by sequence Region Position Sequence Characterization Length CDR-H B C**** W/WV/WI/WA CDR-H LQWIG K/R L/I/V/F/T/A T/S/I/A CDR-H C** WG*G 3-25 Heavy chain: Amino acids sequence (458 AA) Leader sequence-fr1-cdr1-fr2-cdr2-fr3-cdr3-fr4-constant region-stop codon MGWSCIFLFLLSVTVGVFSEVQLQQSGPELVKPGASVKISCKASGYSFTGYFMNWVKQSHGKSLE WIGRINPNNGDSLYNQKFKGKATLTVDKSSTTAHMELLSLTSEDSAVYYCGRDYFFDYWGQGTTL TVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYT LSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLT PKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKC RVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPA ENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK 24
25 Ab Check - Sequence Analysis 25
26 Ab Check - Sequence Analysis The following unusual sequence features have been identified: L7 = I in 0.542% of light chains (17 examples) L106A = K in 0.542% of light chains (17 examples) 26
27 Antibody basics, structure and function Antibody production in vivo Antibody database and analysis Optimization of antibody production 27
28 Rapid Transient Gene Expression 28
29 Advantages of GenScript Recombinant Abs Advantages: Prominent 293 and CHO suspension systems promote large-scale and fast-delivery of recombinant protein and monoclonal antibody up to gram level. A strong commitment of scientific teams with many years of experience in developing highly productive stable cell lines with strict expression stability evaluation. Comprehensive professional process development enhances the protein expression capacity of cell lines. GenScript has successfully delivered >500 proteins in mammalian expression system with >100 stable cell lines. 29
30 Licensed NRC Technologies HEK293 Highly stable 293EBNA1 clone Increase recombinant protein yields through coexpression Afford the advantages of serum-free production Rapid and high yield recombinant protein production Availability of a Master Cell Bank (MCB) for cgmp production CHO-pTT Provides comparable protein expression level to those of HEK293 system Rapid production of recombinant proteins that require post-translation modification for research or pharmaceutical use. 30
31 MamPower Guaranteed Services Customer provides Amount Purity & endotoxin level options Timeline Deliverables Price starting from Antibody sequence 5mg 95% by SDS-PAGE 5-6 weeks 10mg 25mg 50mg 100mg 250mg 500mg 95% by SDS-PAGE Endotoxin 10EU/mg Concentration 1mg/ml 95% by HPLC Endotoxin 1EU/mg 6-8 weeks 8-10 weeks LC and HC in puc57 vector Optimized gene sequence report Purified antibody at listed amount and purity QC data $2,999 Key features of MamPower guaranteed recombinant antibody production services Gene synthesis is included in the package no additional cost to you. Guarantee recombinant antibody amount, purity and desired endotoxin level no cost to you if we don't deliver as promised. Flexible scale from 5mg to 500mg. Competitive price. Fast turnaround time -as little as 5 weeks. 31
32 Case Study Expression level was low (2.5 mg/l) Optimized Antibody Sequence OptimumGene TM Codon Optimization Optimized Transfection and Purification Expression level was significantly increased (25 mg/l) 32
33 Summary Antibody is used by the immune system to neutralize foreign objects (antigens). Antibody-antigen binding residues are mainly located in CDRs. Analysis of sequence could assist to evaluate the expression level of a certain antibody. GenScript could offer you the professional service for optimized recombinant antibody production. 33
34 About GenScript Gene Cell Line Peptide GenScript Products & Services Discovery Biology Protein Antibody 34
35 Thank you Upcoming webinar Expression vectors: how to choose, or customize, vectors for gene & protein expression Presented by Rachel Speer, Ph.D, Technical Writer, GenScript June 3, 2015/11:00 AM EST Visit our website for archived webinars: Contact today s presenter: [email protected] Thank you Conclusion 35
Some terms: An antigen is a molecule or pathogen capable of eliciting an immune response
Overview of the immune system We continue our discussion of protein structure by considering the structure of antibodies. All organisms are continually subject to attack by microorganisms and viruses.
Types, production of antibodies and Antibody/antigen interaction
Types, production of antibodies and Antibody/antigen interaction Antibodies Secreted by B lymphocytes Great diversity and specificity: >109 different antibodies; can distinguish between very similar molecules
KMS-Specialist & Customized Biosimilar Service
KMS-Specialist & Customized Biosimilar Service 1. Polyclonal Antibody Development Service KMS offering a variety of Polyclonal Antibody Services to fit your research and production needs. we develop polyclonal
Antibody Function & Structure
Antibody Function & Structure Specifically bind to antigens in both the recognition phase (cellular receptors) and during the effector phase (synthesis and secretion) of humoral immunity Serology: the
Aviva Systems Biology
Aviva Custom Antibody Service and Price Mouse Monoclonal Antibody Service Package Number Description Package Contents Time Price Customer provides antigen protein $6,174 Monoclonal package1 (From protein
Advanced BioDesign Outlines Solutions. Antibody Overview. by Advanced BioDesign. Project Start. Immunogenicity. Selecting Your Antigen
Advanced BioDesign Outlines Solutions by Advanced BioDesign Antibody Overview Launching an immunisation programme is an important experimental step that needs care. With Advanced BioDesign, you may develop
Antibody Structure, and the Generation of B-cell Diversity CHAPTER 4 04/05/15. Different Immunoglobulins
Antibody Structure, and the Generation of B-cell Diversity B cells recognize their antigen without needing an antigen presenting cell CHAPTER 4 Structure of Immunoglobulin G Different Immunoglobulins Differences
Antibody Services. Best Guarantees in the Industry! Monoclonal Antibody Services. Polyclonal Antibody Services. Express Antibody TM Services
Antibody Services Best Guarantees in the Industry! Monoclonal Antibody Services Polyclonal Antibody Services Express Antibody TM Services Guaranteed Antibody Services Antibody Purification Services Your
CHAPTER 9 IMMUNOGLOBULIN BIOSYNTHESIS
CHAPTER 9 IMMUNOGLOBULIN BIOSYNTHESIS Although the process by which a functional gene for immunoglobulin HEAVY and LIGHT CHAINS is formed is highly unusual, the SYNTHESIS, POST- TRANSLATIONAL PROCESSING
Chapter 2 Antibodies. Contents. Introduction
Chapter 2 Antibodies Keywords Immunohistochemistry Antibody labeling Fluorescence microscopy Fluorescent immunocytochemistry Fluorescent immunohistochemistry Indirect immunocytochemistry Immunostaining
MAB Solut. MABSolys Génopole Campus 1 5 rue Henri Desbruères 91030 Evry Cedex. www.mabsolut.com. is involved at each stage of your project
Mabsolus-2015-UK:Mise en page 1 03/07/15 14:13 Page1 Services provider Department of MABSolys from conception to validation MAB Solut is involved at each stage of your project Creation of antibodies Production
Genes to Proteins to Antibodies
Genes to Proteins to Antibodies About Us Fusion Antibodies is a CRO established in 2001 as a spin-out from Queen s University Belfast. The company building is situated in a charming area of Springbank
Antibody Services from GenScript
Services from GenScript www.genscript.com GenScript USA Inc. 860 Centennial Ave., Piscataway, NJ 08854 USA Toll-Free: 1-877-436-7274 Fax: 1-732-210-0262 1-732-885-5878 Academic Services Pharmaceutical
Guidance for Industry
Guidance for Industry Interpreting Sameness of Monoclonal Antibody Products Under the Orphan Drug Regulations U.S. Department of Health and Human Services Food and Drug Administration Center for Drug Evaluation
Antibody Services from GenScript, Brochure
Services from GenScript, Brochure Interest in any of the products, request or order them at Bio-Connect. Bio-Connect B.V. T NL +31 (0)26 326 44 50 T BE +32 (0)2 503 03 48 Begonialaan 3a F NL +31 (0)26
Bio-Reagents Gene synthesis Peptide Synthesis Protein Expression Antibody Production. Life Science Products and Services
Bio-Reagents Gene synthesis Peptide Synthesis Protein Expression Antibody Production Life Science Products and Services Since 2002, Biomatik has provided worldwide researchers in life science discovery
Custom Antibody Services
Custom Antibody Services Custom service offerings DNA sequence Plasmid Peptide Structure Protein Peptide Small molecule Cells Spleen Lymphocytes Antigen Preparation Immunization Fusion & Subcloning Expansion
Integrated Protein Services
Integrated Protein Services Custom protein expression & purification Version DC04-0012 Expression strategy The first step in the recombinant protein generation process is to design an appropriate expression
The Use of Antibodies in Immunoassays
TECHNICAL NOTE The Use of Antibodies in Immunoassays Introduction Structure of an IgG Antibody Immunological reagents are the backbone of every immunoassay system. Immunoassays can be utilized to quantitatively
LESSON 3: ANTIBODIES/BCR/B-CELL RESPONSES
Introduction to immunology. LESSON 3: ANTIBODIES/BCR/B-CELL RESPONSES Today we will get to know: The antibodies How antibodies are produced, their classes and their maturation processes Antigen recognition
1.Gene Synthesis. 2.Peptide & Phospho-P. Assembly PCR. Design & Synthesis. Advantages. Specifications. Advantages
1.Gene Synthesis Assembly PCR Looking for a cdna for your research but could not fish out the gene through traditional cloning methods or a supplier? Abnova provides a gene synthesis service via assembly
GenScript Antibody Services
GenScript Antibody Services Scientific experts, innovative technologies, proven performance We specialize in custom antibody production to empower your research Custom Polyclonal Antibody Production Custom
GenScript Antibody Services
GenScript Antibody Services Scientific experts, innovative technologies, proven performance We specialize in custom antibody production to empower your research Custom Polyclonal Antibody Production Custom
Chapter 5: Organization and Expression of Immunoglobulin Genes
Chapter 5: Organization and Expression of Immunoglobulin Genes I. Genetic Model Compatible with Ig Structure A. Two models for Ab structure diversity 1. Germ-line theory: maintained that the genome contributed
Integrated Protein Services
Integrated Protein Services Custom protein expression & purification Last date of revision June 2015 Version DC04-0013 www.iba-lifesciences.com Expression strategy The first step in the recombinant protein
Basics of Immunology
Basics of Immunology 2 Basics of Immunology What is the immune system? Biological mechanism for identifying and destroying pathogens within a larger organism. Pathogens: agents that cause disease Bacteria,
3 months 1.5 months 1.5 months. 1 month
Rabbit monoclonal antibody (Mab) is secreted by the plasma B-cell of the rabbit. Traditional generation of rabbit Mab relies on a rabbit myeloma for B- cell fusion (
Antibody Production Price List
Antibody Production Price List Presenting Insight Biotechnology s price list for custom polyclonal and monoclonal antibody production services. We are happy to tailor individual packages towards the specific
Luca Romagnoli, Ph.D. Business Development Manager
Modelli innovativi di produzione per lo sviluppo di un processo altamente qualitativo di farmaci biologici Luca Romagnoli, Ph.D. Business Development Manager BIOLOGICAL DRUGS - SOURCES Monoclonal antibodies
Custom Antibodies Services. GeneCust Europe. GeneCust Europe
GeneCust Europe Laboratoire de Biotechnologie du Luxembourg S.A. 6 rue Dominique Lang L-3505 Dudelange Luxembourg Tél. : +352 27620411 Fax : +352 27620412 Email : [email protected] Web : www.genecust.com
Chapter 3.2» Custom Monoclonal
198 3 3.2 Custom Monoclonal 199 Mouse monoclonal antibody development Chapter 3.2» Custom Monoclonal 200 In vitro monoclonals expression service 201 Mouse monoclonal antibody additional services 202 Magnetic
HuCAL Custom Monoclonal Antibodies
HuCAL Custom Monoclonal HuCAL Custom Monoclonal Antibodies Highly Specific, Recombinant Antibodies in 8 Weeks Highly Specific Monoclonal Antibodies in Just 8 Weeks HuCAL PLATINUM (Human Combinatorial Antibody
A customizable ADCC assay service for antibodies & fusion proteins.
Antibody Dependent Cell- Mediated Cytotoxicity (ADCC) Assay A customizable ADCC assay service for antibodies & fusion proteins. Our ADCC assay service accurately detects cell lysis based on LDH-release.
Grundlagen und Anwendung der Genom- und Proteomforschung
Grundlagen und Anwendung der Genom- und Proteomforschung Profilmodul (Vorlesung/Seminar WS 2012/13) Philipps-Universität Marburg Fachbereich Biologie Professor Dr. Egon Amann & Dr. Frank Vitzthum Gastbeiträge
Optimal Conditions for F(ab ) 2 Antibody Fragment Production from Mouse IgG2a
Optimal Conditions for F(ab ) 2 Antibody Fragment Production from Mouse IgG2a Ryan S. Stowers, 1 Jacqueline A. Callihan, 2 James D. Bryers 2 1 Department of Bioengineering, Clemson University, Clemson,
Your partner in immunology
Your partner in immunology Expertise Expertise Reactivity Reactivity Quality Quality Advice Advice Who are we? Specialist of antibody engineering Covalab is a French biotechnology company, specialised
HuCAL Custom Monoclonal Antibodies
HuCAL Custom Monoclonal Antibodies Highly Specific Monoclonal Antibodies in just 8 Weeks PROVEN, HIGHLY SPECIFIC, HIGH AFFINITY ANTIBODIES IN 8 WEEKS WITHOUT HuCAL PLATINUM IMMUNIZATION (Human Combinatorial
CHAPTER 6 ANTIBODY GENETICS: ISOTYPES, ALLOTYPES, IDIOTYPES
CHAPTER 6 ANTIBODY GENETICS: ISOTYPES, ALLOTYPES, IDIOTYPES See APPENDIX: (3) OUCHTERLONY; (4) AFFINITY CHROMATOGRAPHY Human immunoglobulins are made up of LIGHT and HEAVY chains encoded by a total of
HUMORAL IMMUNE RE- SPONSES: ACTIVATION OF B CELLS AND ANTIBODIES JASON CYSTER SECTION 13
SECTION 13 HUMORAL IMMUNE RE- SPONSES: ACTIVATION OF B CELLS AND ANTIBODIES CONTACT INFORMATION Jason Cyster, PhD (Email) READING Basic Immunology: Functions and Disorders of the Immune System. Abbas,
Elabscience Biotechnology Co.,Ltd
Biotechnology Co.,Ltd Your one-stop custom antibody service Antibody is a kind of protein that is the most widely used in the fields of biology and medicine. Antibodies, as the preparations for disease
ELITE Custom Antibody Services
ELITE Custom Antibody Services ELITE Custom Antibody Services Experience, confidence, and understanding As a manufacturer and service provider, we have the experience, confidence, and understanding to
Applications of Ab Molecules. Chapter 4 Monoclonal Ab (p.99) Chapter 5 Ab genes and Ab Engineering (p.128)
Applications of Ab Molecules Chapter 4 Monoclonal Ab (p.99) Chapter 5 Ab genes and Ab Engineering (p.128) Monoclonal Antibodies Clonal Selection of B Lymphocytes Hybridoma Köhler and Milsten (1975) - continuous
Recombinant Protein Expression & Purification -- Challenges & Solutions
Recombinant Protein Expression & Purification -- Challenges & Solutions Liyan Pang, Ph.D. [email protected] Table of Contents 1 2 3 4 5 6 Choose Expression System Optimize Protein Expression Protein
EMABling Antibody Production Platform
EMABling Antibody Production Platform An industrial solution for the production of therapeutic antibodies with high cytotoxic activity B IOMANUFACTURING EMABling : A fully integrated development platform
The Leading Gene Through Screen CRO
The Leading Gene Through Screen CRO Molecular Biology Services Molecular Biology drives modern drug discovery. Drug screening, target validation and structural biology processes frequently require recombinant
THE His Tag Antibody, mab, Mouse
THE His Tag Antibody, mab, Mouse Cat. No. A00186 Technical Manual No. TM0243 Update date 01052011 I Description.... 1 II Key Features. 2 III Storage 2 IV Applications.... 2 V Examples - ELISA..... 2 VI
LFB GROUP & SANOFI combine their bioproduction capabilities to provide integrated CMO services for biopharmaceuticals
LFB GROUP & SANOFI combine their bioproduction capabilities to provide integrated CMO services for biopharmaceuticals MAbLaunch TM is a joint bioproduction platform combining LFB Biomanufacturing (LFB
Custom Antibodies & Recombinant Proteins
Custom Antibodies & Recombinant Proteins INTRODUCTION Custom services to meet your research and development requirements Improvements in health, medicine and diagnostics over the past century can be largely
Bispecific antibodies with native chain structure
Bispecific antibodies with native chain structure 11.03.2014 Kristin Fritsch Natural function of antibodies I. Spasevska, Biosciences Master Reviews, 2014 IgG Antibody http://www.ebioscience.com/knowledge-center/antigen/immunoglobulin/structure.htm
Outline. Market & Technology Trends. LifeTein Technology Portfolio. LifeTein Services
1 Outline Market & Technology Trends LifeTein Technology Portfolio LifeTein Services 2 Synthetic Therapeutic Peptides More than 60 synthetic therapeutic peptides under 50 amino acids in size have reached
Aviva Systems Biology
Aviva Custom Antibody Services and Prices Rabbit Polyclonal Antibody Service Package Number Description Package Contents Time Price Polyclonal package 1 (From protein to antiserum) Polyclonal package 2
CUSTOM ANTIBODIES. Fully customised services: rat and murine monoclonals, rat and rabbit polyclonals, antibody characterisation, antigen preparation
CUSTOM ANTIBODIES Highly competitive pricing without compromising quality. Rat monoclonal antibodies for the study of gene expression and proteomics in mice and in mouse models of human diseases available.
Geniron. Custom Antibody Services. Serum services Antibody Monoclonal. Purification Antibody Mono Y Genetic Immunization Genbody Polyclonal Antibody
Geniron Custom Antibody Services Serum services Antibody Monoclonal Purification Antibody Mono Y Genetic Immunization Genbody Polyclonal Antibody Geniron Poly Y WE PROVIDE OUR SERVICES TO With Expertise
Expression and Purification of Recombinant Protein in bacteria and Yeast. Presented By: Puspa pandey, Mohit sachdeva & Ming yu
Expression and Purification of Recombinant Protein in bacteria and Yeast Presented By: Puspa pandey, Mohit sachdeva & Ming yu DNA Vectors Molecular carriers which carry fragments of DNA into host cell.
LifeTein in Industrial Production of Therapeutic Peptides. Phil Moore, PhD Director of Business Development LifeTein LLC, NJ, USA
LifeTein in Industrial Production of Therapeutic Peptides Phil Moore, PhD Director of Business Development LifeTein LLC, NJ, USA 1 Outline Market and Technology Trend LifeTein s Technology portfolio LifeTein
From cells to therapeuticsvivalis. Humalex Fully human antibody discovery platform An integrated therapeutic development offering
From cells to therapeuticsvivalis Humalex Fully human antibody discovery platform An integrated therapeutic development offering Humalex from bench-top to clinical development The Humalex platform enables
In Vitro And In Vivo Production Of Antibodies
In Vitro And In Vivo Production Of Antibodies OCTOBER 27, 2015 BY ADMIN Overview An antibody is a protein normally produced by the B cells of the immune system. Their original purpose is to identify and
specific B cells Humoral immunity lymphocytes antibodies B cells bone marrow Cell-mediated immunity: T cells antibodies proteins
Adaptive Immunity Chapter 17: Adaptive (specific) Immunity Bio 139 Dr. Amy Rogers Host defenses that are specific to a particular infectious agent Can be innate or genetic for humans as a group: most microbes
Introduction to Bioprocessing
Introduction to Bioprocessing Cambridge Healthtech Institute Peptalk Palm Springs, CA Presented by Susan Dana Jones and Sheila Magil BioProcess Technology Consultants www.bptc.com BioProcess Technology
The immune response Antibodies Antigens Epitopes (antigenic determinants) the part of a protein antigen recognized by an antibody Haptens small
The immune response Antibodies Antigens Epitopes (antigenic determinants) the part of a protein antigen recognized by an antibody Haptens small molecules that can elicit an immune response when linked
SCANTIBODIES Laboratory, Inc. Contract Monoclonal Antibody Production
A Technical Publication of SCANTIBODIES Laboratory, Inc. Volume 1 Number 4 9336 Abraham Way Santee, CA 92071 USA (619) 258-9300 fax (619) 258-9366 www.scantibodies.com SCANTIBODIES Laboratory, Inc. Contract
博 士 論 文 ( 要 約 ) A study on enzymatic synthesis of. stable cyclized peptides which. inhibit protein-protein interactions
博 士 論 文 ( 要 約 ) 論 文 題 目 A study on enzymatic synthesis of stable cyclized peptides which inhibit protein-protein interactions ( 蛋 白 質 間 相 互 作 用 を 阻 害 する 安 定 な 環 状 化 ペプチドの 酵 素 合 成 に 関 する 研 究 ) 氏 名 張 静 1
Biotinylated Secondary Antibodies
Biotinylated Secondary Antibodies Anti-Goat ABB-02-01 Biotin Labeled Rabbit Anti-Goat IgG (H+L) Antibody $44.00 Affinity purified polyclonal antibody to Goat IgG, heavy and light chains (whole IgG) made
LFB GROUP & SANOFI combine their bioproduction capabilities to provide integrated CMO services for biopharmaceuticals
LFB GROUP & SANOFI combine their bioproduction capabilities to provide integrated CMO services for biopharmaceuticals MAbLaunch TM is a joint bioproduction platform combining LFB Biomanufacturing (LFB
Superior TrueMAB TM monoclonal antibodies for the recognition of proteins native epitopes
Superior TrueMAB TM monoclonal antibodies for the recognition of proteins native epitopes Outlines Brief introduction of OriGene s mission on gene-centric product solution. TrueMAB monoclonal antibody
UNDERSTANDING MULTIPLE MYELOMA AND LABORATORY VALUES Benjamin Parsons, DO [email protected] Gundersen Health System Center for Cancer and
UNDERSTANDING MULTIPLE MYELOMA AND LABORATORY VALUES Benjamin Parsons, DO [email protected] Gundersen Health System Center for Cancer and Blood Disorders La Crosse, WI UNDERSTANDING MULTIPLE
Antigens & Antibodies II. Polyclonal antibodies vs Monoclonal antibodies
A Brief Review of Antibody Structure A Brief Review of Antibody Structure The basic antibody is a dimer of dimer (2 heavy chain-light chain pairs) composed of repeats of a single structural unit known
B Cells and Antibodies
B Cells and Antibodies Andrew Lichtman, MD PhD Brigham and Women's Hospital Harvard Medical School Lecture outline Functions of antibodies B cell activation; the role of helper T cells in antibody production
INTERNATIONAL CONFERENCE ON HARMONISATION OF TECHNICAL REQUIREMENTS FOR REGISTRATION OF PHARMACEUTICALS FOR HUMAN USE Q5B
INTERNATIONAL CONFERENCE ON HARMONISATION OF TECHNICAL REQUIREMENTS FOR REGISTRATION OF PHARMACEUTICALS FOR HUMAN USE ICH HARMONISED TRIPARTITE GUIDELINE QUALITY OF BIOTECHNOLOGICAL PRODUCTS: ANALYSIS
Guidance for Industry. Monoclonal Antibodies Used as Reagents in Drug Manufacturing
Guidance for Industry Monoclonal Antibodies Used as Reagents in Drug Manufacturing U.S. Department of Health and Human Services Food and Drug Administration enter for Drug Evaluation and Research (DER)
B cell activation and Humoral Immunity
B cell activation and Humoral Immunity Humoral immunity is mediated by secreted antibodies and its physiological function is defense against extracellular microbes (including viruses) and microbial exotoxins.
Valentina Gualato, Ph.D. Process Development Scientist
COMPANY PRESENTATION Quality and Innovation Valentina Gualato, Ph.D. Process Development Scientist MISSION areta international is a biotech company dedicated to the contract development and manufacturing
Anti-ATF6 α antibody, mouse monoclonal (1-7)
Anti-ATF6 α antibody, mouse monoclonal (1-7) 73-500 50 ug ATF6 (activating transcription factor 6) is an endoplasmic reticulum (ER) membrane-bound transcription factor activated in response to ER stress.
Carbohydrates, proteins and lipids
Carbohydrates, proteins and lipids Chapter 3 MACROMOLECULES Macromolecules: polymers with molecular weights >1,000 Functional groups THE FOUR MACROMOLECULES IN LIFE Molecules in living organisms: proteins,
Helices From Readily in Biological Structures
The α Helix and the β Sheet Are Common Folding Patterns Although the overall conformation each protein is unique, there are only two different folding patterns are present in all proteins, which are α
Custom Antibodies. Animals Chicken, Goat, Guinea Pig, Mouse, Rat, Rabbit, etc. Antibody Identification Dot blot ELISA IHC Western blot
Custom Antibodies aapptec provides custom peptides and immunology products with high quality and fast delivery at an affordable price to research scientists worldwide. aapptec has unparalleled experience
Chapter 18: Applications of Immunology
Chapter 18: Applications of Immunology 1. Vaccinations 2. Monoclonal vs Polyclonal Ab 3. Diagnostic Immunology 1. Vaccinations What is Vaccination? A method of inducing artificial immunity by exposing
Antibody responses to linear and conformational epitopes
Antibody responses to linear and conformational epitopes PhD course: Biological Sequence Analysis 30.05.2008 Pernille Andersen Outline Antibodies and B-cell epitopes Classification of B-cell epitopes Prediction
PRODUCTION AND QUALITY CONTROL OF MEDICINAL PRODUCTS DERIVED BY RECOMBINANT DNA TECHNOLOGY
PRODUCTION AND QUALITY CONTROL OF MEDICINAL PRODUCTS DERIVED BY RECOMBINANT DNA TECHNOLOGY Guideline Title Production and Quality Control of Medicinal Products derived by recombinant DNA Technology Legislative
Accelerating Antibody Process Development: Exploring the Synergies Between Engineered Host Cells and Process Development
Pharma&Biotech Accelerating Antibody Process Development: Exploring the Synergies Between Engineered Host Cells and Process Development James Rance PhD Head of Development Services Singapore Lonza Biologics
B Lymphocyte (B cell)
B Lymphocyte (B cell) B cells: Develop from stem cells in the bone marrow and differentiate into antibody-producing plasma cells in the blood Are capable of making a vast number of antibody specificities
Custom polyclonal antibody production
EUROGENTEC 2008 Catalogue > www.eurogentec.com > [email protected] Custom polyclonal antibody production 231 General overview 232 Selecting a polyclonal programme 233 Peptide antibodies versus protein
INDUSTRY OVERVIEW. Our business segments. (ii) Global drug development service market Preclinical drug development services
The information and statistics set out in this section and other sections of this document were extracted from different official government publications, available sources from public market research
From Biology to Discovery
POLYCLONAL ANTIBODY PRODUCTION SERVICES Abbiotec offers custom polyclonal antibody production services to the scientific community to accelerate a project From Biology to Discovery. When the antibody for
Protein Physics. A. V. Finkelstein & O. B. Ptitsyn LECTURE 1
Protein Physics A. V. Finkelstein & O. B. Ptitsyn LECTURE 1 PROTEINS Functions in a Cell MOLECULAR MACHINES BUILDING BLOCKS of a CELL ARMS of a CELL ENZYMES - enzymatic catalysis of biochemical reactions
Name (print) Name (signature) Period. (Total 30 points)
AP Biology Worksheet Chapter 43 The Immune System Lambdin April 4, 2011 Due Date: Thurs. April 7, 2011 You may use the following: Text Notes Power point Internet One other person in class "On my honor,
Custom Protein Expression
Custom Protein Expression Introduction Cosmogenetech Inc., an industry leader in gene, peptide synthesis, is pleased to launch the new protein expression and purification service. Cosmogenetech Inc. has
Structure of proteins
Structure of proteins Primary structure: is amino acids sequence or the covalent structure (50-2500) amino acids M.Wt. of amino acid=110 Dalton (56 110=5610 Dalton). Single chain or more than one polypeptide
Amino Acids. Amino acids are the building blocks of proteins. All AA s have the same basic structure: Side Chain. Alpha Carbon. Carboxyl. Group.
Protein Structure Amino Acids Amino acids are the building blocks of proteins. All AA s have the same basic structure: Side Chain Alpha Carbon Amino Group Carboxyl Group Amino Acid Properties There are
Production of antigens and antibodies in plants: alternative technology?
Production of antigens and antibodies in plants: alternative technology? George Lomonossoff John Innes Centre Norwich, UK ECOPA, Alicante 29 th Sept. 2006 Why use Plants as Biofactories? Produce large
Questions related to peptide antibodies
www.lifetechindia.com Some Commonly Asked Questions about custom antibody production (Click over the Q# to see details) Questions related to protein antigens and general information Q1 How much antigen
European Medicines Agency
European Medicines Agency July 1996 CPMP/ICH/139/95 ICH Topic Q 5 B Quality of Biotechnological Products: Analysis of the Expression Construct in Cell Lines Used for Production of r-dna Derived Protein
Immunology. Immunoglobulins: Structure and Function. Amit Bhattacharya Department of Zoology University of Delhi Delhi - 110007
Immunology Immunoglobulins: Structure and Function Amit Bhattacharya Department of Zoology University of Delhi Delhi - 110007 Correspondence Address: H-3/ 56, Mahavir Enclave, Palam Dabri Road, New Delhi
Peptide bonds: resonance structure. Properties of proteins: Peptide bonds and side chains. Dihedral angles. Peptide bond. Protein physics, Lecture 5
Protein physics, Lecture 5 Peptide bonds: resonance structure Properties of proteins: Peptide bonds and side chains Proteins are linear polymers However, the peptide binds and side chains restrict conformational
Why is FTO important?
Antibodies, Patents and Freedom to Operate: The Monoclonal Maze Timothy J. Shea, Jr. Director Tracy Muller Associate Sterne, Kessler, Goldstein & Fox P.L.L.C. 4 th Annual Antibody Therapeutics Conference
