Delivering a Healthy Start for pregnant women, new mums, babies and young children

Size: px
Start display at page:

Download "Delivering a Healthy Start for pregnant women, new mums, babies and young children"


1 HS52A Delivering a Healthy Start for pregnant women, new mums, babies and young children Read more A guide for health professionals 2012/13

2 Contents What is Healthy Start? Who qualifies? What do Healthy Start beneficiaries receive? What beneficiaries can spend Healthy Start vouchers on Healthy Start: recommendations and evidence What to do next Who can give out the application leaflet? Nutrition, health and inequality:healthinequalities;howhealthy Startgivesyoutheopportunitytohelpdisadvantagedwomen;Therole ofhealthprofessionalsiscrucial Nutrition in pregnancy:obesityandpregnancy;whatpregnant womenshouldeat...andcutdownon;healthysnackstorecommend; Foodstoavoidduringpregnancy;Caffeine;Physicalactivity Dangers in pregnancy:toxoplasmosis;smoking;alcoholand pregnancy;breastfeedingandalcohol;illegaldrugs Healthy Start vitamins for pregnant women and breastfeeding mothers:howhealthystartbeneficiariesclaimtheirfreevitamins; What sinhealthystartvitaminsforwomen? The early postnatal period:breastfeeding;maintainingahealthydiet; Infantformulamilk;Follow-onformulas;Non-milk-basedformulas Nutrition for growing babies:whentostartintroducingsolidfoods; Adviceformotherswhochoosetointroducesolidfoodsbeforesix months;vegetarianbabies;foodstoavoid;milk;otherdrinks;food allergies;peanutsandallergiesinthefamily Nutrition for young children:everydayeating;fat;ricedrink; Fussyeaters;Childrenoverfive;Vegetarianandveganchildren;Iron. Vitamin supplements for children Find out more:healthystartresources General resources Breastfeeding organisations References 2 / 3

3 Welcome ThisHealthyStartguidehasbeencreatedtoassisthealthprofessionals insignpostingtheschemeandgivingnutritionaladvicetoapplicants andbeneficiaries.italsosummarisesthecorehealthadvicefor pregnantwomenandyoungchildrenasagreedbythefouruk HealthDepartments:England,NorthernIreland,ScotlandandWales. What is Healthy Start? Healthy Start is a UK-wide government scheme which aims to improve the health of pregnant women and families on benefits or low incomes. Beneficiariesaresentvouchersthatcanbeusedtobuyliquidcow s milk,plainfreshorfrozenfruitandvegetables,andinfantformulamilk, pluscouponsthatcanbeexchangedforfreevitamins(forpregnant women,newmumsandchildren). Ongoingnutritionandhealthinformationrelevanttotheageoftheir oldestchildissentwiththevoucherstoreinforcethescheme srole asapublichealthmeasureandtohelpbeneficiariesmakethemost ofthescheme. HealthyStartisalsoagreatopportunityforallhealthprofessionalsand othersworkingwithpregnantwomenandyoungfamiliestoprovide encouragement,informationandsupportaboutsubjectssuchashealthy eating,breastfeeding,vitaminsupplementsandnutritionforpregnant women,newmums,babiesandyoungchildren. TheHealthyStartapplicationformhastobesupportedbyahealth professional(usuallyamidwifeorhealthvisitor,butitcanbeany registerednurseordoctor),soitalsoencourageslow-incomewomen andfamiliestomakecontactwithlocalhealthservices.

4 Who qualifies? Women more than 10 weeks pregnant, and families with children under four years old, qualify for Healthy Start if the family is receiving: IncomeSupport,or Income-basedJobseeker sallowance,or Income-relatedEmploymentandSupportAllowance,or ChildTaxCredit(butnotWorkingTaxCreditunlessthefamilyis receivingworkingtaxcreditrun-ononly*)andanannualfamily incomeof 16,190orlessin2012/13. Womenalsoqualifyforthewholeoftheirpregnancyiftheyareunder 18whentheyapply,eveniftheydon tgetanyoftheabovebenefits ortaxcredits. * WorkingTaxCreditrun-onistheWorkingTaxCreditreceivedinthefourweeksimmediately afterapersonhasstoppedworkingfor16hoursormoreperweek. 4 / 5

5 What do Healthy Start beneficiaries receive? Healthy Start vouchers Pregnantwomenreceiveone voucheraweekworth Babiesundertheageofoneget twovouchersaweekwortha totalof Eachchildagedoveroneand underfourreceivesonevoucher aweekworth Vouchersarepostedouteveryfourweeks.Theycanbespentinawide rangeofparticipatinglocalshopsandgreengrocersaswellassupermarkets. Foralistofshopsbypostcode,visitwww.healthystart.nhs.ukanduse thepostcodecheckertofindlocalshops. Healthy Start vitamin coupons Everyeightweeksbeneficiariesalsoreceivevitamincoupons,which theycanexchangeforvitaminsintheirlocalarea.theircouponswillbe validforwomen stabletsand/orchildren sdrops,dependingontheir circumstances. Trustsandboardsmustensurethatarrangementsareinplacetosupply bothkindsofvitaminsupplements.maternityunitscanalsosupplythem iftheywish.moreinformationonhowtoordervitaminsandreclaimthe costofthosegivenoutthroughtheschemeisavailableonthehealthy

6 What beneficiaries can spend Healthy Start vouchers on HealthyStartvoucherscanbeacceptedaspaymentorpartpaymentfor milk, plain fresh or frozen fruit and vegetables,andinfant formula milk.therearemoredetailsbelow. Milk Plaincow smilk whole,semi-skimmedorskimmed.itcanbe pasteurised,sterilised,long-lifeoruht. Beneficiariescan tspendtheirvouchersonflavouredmilk,colouredmilk, evaporatedmilk,condensedmilk,goat smilk,soyamilkorpowdered milk exceptinfantformulamilk. Plain fresh or frozen fruit and veg Anykindofplainfreshorfrozenfruitorvegetables,wholeor chopped,packagedorloose. Beneficiariescan tspendtheirvouchersonanyfreshorfrozenfruitandveg whichhasaddedsalt,fat,sugaroranyotheringredient.theyalsocan tspend themonpre-cooked,driedortinnedfruitandvegetables,fruitjuiceorsmoothies. Infant formula milk Infantformulamilkthatsaysonthepacketitcanbeusedfrombirth. Beneficiariescan tspendtheirvouchersoninfantformulasthataren t basedoncow smilk,suchassoyaformula.theyalsocan tspendthem onfollow-onformulasthataremadeforbabiesagedsixmonthsorolder. 6 / 7


8 Healthy Start Recommendations and evidence Healthy Start replaced the means-tested elements of the Welfare Food Scheme throughout the UK in Proposals for reform of the previous scheme were based on recommendations made by the Committee on Medical Aspects of Food and Nutrition Policy (COMA) (DH 2002). The National Institute for Health and Clinical Excellence (NICE) has a number of recommendations for health professionals working with women and young children that relate to Healthy Start. You can see them in full at They include: For pregnant women or those who may become pregnant Advisethemtotakeasupplementcontaining400micrograms(mcg) offolicaciddailypre-conceptionanduptothe12thweekofpregnancy; alsoprovideadviceonsuitablevitaminsupplementssuchashealthystart vitaminsforwomenandadvisethemtoeatfoodsrichinfolateandfolic acid. EnsurethateligiblewomenreceiveaHealthyStartapplicationleaflet (HS01)assoonaspossibleinpregnancy. ForwomenreceivingHealthyStartvouchers,providepracticaladviceon howtoincreasetheirintakeoffruitandvegetables. Duringthebookingappointment,offeradviceandinformationtoall womenaboutthebenefitsoftakingvitamindduringpregnancyand whilebreastfeedingandadvisethemofasuitablesupplementsuchas HealthyStartvitaminsforwomen;checkthatwomenatthegreatestrisk ofvitaminddeficiency(thosewhoarenotexposedtomuchsun,for examplethosewhocoveruptheirskinforculturalreasonsandpeople withdarkerskin,suchaspeopleofafrican-caribbeanandsouthasian origin)arefollowingtheadvice. 8 / 9

9 For mums and babies AdvisemothersaboutsuitablevitaminDsupplementssuchasHealthy Startvitaminsforwomen;checkthatwomenatthegreatestriskof deficiency(asbefore)arefollowingtheadvice. ForwomenreceivingHealthyStartvouchers,providepracticaladvice onhowtoincreasetheirintakeoffruitandvegetables. For families and carers of babies over six months and pre-school children OfferHealthyStartvitamindrops(A,CandD)toallchildrenaged fromsixmonthstotheirfourthbirthday,whoarehavinglessthan 500ml(apint)ofinfantformulaadayandwhosefamiliesareeligible forhealthystart. Provideparentsandcarerswithpracticaladviceonhowtheycan introducebabiestoavarietyofsolidfoods. AswellastheNICEguidance,theNational Service Framework for Children, Young People and Maternity Services(DH2004)statesthat maternityserviceprovidersshouldensurethatallpregnantwomenare offeredclearinformationontheavailabilityofhealthystart.

10 The Scientific Advisory Committee on Nutrition (SACN) has made a number of recommendations: In1991theCommitteeonMedicalAspectsofFoodandNutritionPolicy (COMA SACN spredecessor)recommendedthatcertainat-risk individuals,orgroupsatriskofvitaminddeficiency,shouldtake supplementsof7 10mcgofvitaminDdaily(DH1991).TheChiefMedical Officer(CMO)subsequentlyendorsedtheserecommendationsfor vulnerablegroupsin2005(cmo2005).comahadalsorecommended thatallchildrenagedonetofiveyearsshouldbegivenasupplement containingvitaminsa,candd(dh1994),andtheukhealth Departmentshavesincerecommendedthatallchildrenhavesupplements fromsixmonthsuntilfiveyearsofageunlesstheyaregettingmorethan 500mlofinfantformulaaday. In2007,SACNspecificallyreiteratedCOMA soriginalrecommendations onvitamindinitspositionstatementupdate on Vitamin D(SACN2007), recommendingthatallpregnantandbreastfeedingwomenshouldtake adailysupplementofvitamindinordertoensurethattheirown requirementforvitamindismetandtobuildadequatefetalstores forearlyinfancy,andallyoungchildrenshouldbegivenavitamind supplementuntilfiveyearsofageaspreviouslyrecommendedbycoma. NICE(2008)hasalsohighlightedtheimportanceofvitaminD supplementsforpregnantandbreastfeedingwomen. 10 / 11

11 SACNhasalsorecommendedthatallwomenwhocouldbecome pregnantshouldtake400mcgoffolicaciddailyasamedicinalorfood supplementpriortoconceptionanduntilthe12thweekofpregnancy. Womenwithahistoryofneuraltubedefect(NTD)affectedpregnancyare advisedtotake5mgperdaypriortoconceptionanduntilthe12thweek ofpregnancy(sacn2006). Intheirreviewofthekeyfindingsfromthe2005InfantFeedingSurvey, SACNincludedthefollowingrecommendations: Increasetheawarenessofbreastfeedingamongyoungandlow-income mothersbydiscussinginfantfeedingduringpregnancyandproviding supportintacklingpracticalbarrierstobreastfeeding.theprofileof HealthyStartshouldberaisedandhealthprofessionals,atevery opportunity,shouldofferpracticalsupportandadvicetothoseeligible forthescheme(sacn2008b,paragraph125). Inequalitiesinaccesstoantenatalandpostnatalcareareapparent. Identifyingsub-groupsofwomenwhodonotusematernalhealthservices iskeytoimprovingpolicyadherence.thereisaneedtomakeantenatal andpostnatalservicesmoreaccessibleforwomenfromhard-to-reach addition,thetopicofbreastfeedingshouldberaisedwheneverpossible duringantenatalconsultationsandencouragementshouldbegivento thoseleastlikelytobreastfeed(sacn2008b,paragraph128).

12 What to do next FindouthowHealthyStartvitaminsaredistributedbyyourtrustor boardandroutinelytellpregnantwomenandfamiliesonthescheme aboutthevitamins,whythey reimportantandhowtogetthem. OrderHealthyStartapplicationleaflets(HS01)andotherresourcesat MakesureHealthyStartisembeddedinyourlocalpoliciestopromote breastfeedingandhealthyeating. UseHealthyStartasanopportunitytosignpostlocalinitiativesfor pregnantwomenandyoungfamilies. VisittheHealthyStartwebsitewww.healthystart.nhs.ukformore informationabouttheschemeandyourrole,andtoviewtheinformation thatissentdirectlytobeneficiarieswiththeirvouchers. 12 / 13

13 Who can give out the application leaflet? Anyonecanorderbulksuppliesoftheapplicationleaflet(HS01)andgive themout,butitisespeciallyimportanttomakethemavailablewherever servicesforpregnantwomenandfamiliesarebeingprovided. Anymemberofthepubliccanalsorequesttheirowncopydirectlyfrom thehealthystarthelplineon ,ordownloadthe Bookingandhealthandsocialcareassessmentappointmentsaregood opportunitiestoprovidetheapplicationleafletinpersonbecausepregnant womencanreceivevouchersfromthe10thweekofpregnancy.many salso agoodideatorecordtheuptakeofhealthystartinthewoman snotes. Countersigning the form WhensomeoneappliesforHealthyStart,aregisteredmidwife,nurseor medicalpractitionerhastocompleteandsignpartboftheapplication leaflettoconfirmtheexpecteddateofdelivery(edd)and/orthedate(s) s important that Part B is fully completed, or the application cannot be processed. Pleasenote:healthprofessionalsaren trequiredtocheckthatan applicantisgettingthebenefitstheyclaimtobe we lldothat.nordo healthprofessionalsneedtoreportanysubsequentchangesinpeople s circumstancesoncethey reonthescheme it sthebeneficiary s responsibility.however,healthprofessionalsareaskedtoofferappropriate adviceonbreastfeedingandhealthyeatingandtoindicatethattheyhave salsoagoodideatousethe opportunitytotalkaboutotherrelevantservicesandtoexplainwhy HealthyStartvitaminsareimportant.

14 Nutrition, health and inequality There s growing evidence to suggest that nutrition during pregnancy and in the early years of a child s life can help prepare them for healthy adulthood. A healthy diet can also help reduce the risk of obesity and chronic diseases such as heart disease and some cancers later in life. COMA spanelonchildandmaternalnutritionproducedascientific Review of the Welfare Food Scheme(nowHealthyStart),acknowledging thatmaternalandchildnutritionmayaffectlong-termhealthoutcomes (DH2002). SACNalsorecentlypublisheditsreportThe Influence of Maternal, Fetal and Child Nutrition on the Development of Chronic Disease in Later Life, concludingthatimprovingthenutritionalstatusofwomenofchild-bearing age,infantsandyoungchildrenhasthepotentialtoimprovethehealthof futuregenerations(sacn2011). 14 / 15

15 Health inequalities Manypeoplefollowahealthybalanceddiet,butalargenumberdon t, particularlyamongthemoredisadvantagedandvulnerableinsociety (DH2005).TheIndependent Inquiry into Inequalities in Health(Acheson1998) emphasisedtheinfluenceofpoverty,educationandpoorearlynutritionon healthinequalities.thereportrecommendedpoliciestoimprovenutrition, reducefoodpovertyandpreventchildhoodobesity.the Low Income Diet and Nutrition Survey(2007)assessedthedietaryhabitsandnutritionalstatusofthe UKlowincomepopulation.Theareasofconcernhighlightedweresimilarto thosealreadyidentifiedinthegeneralpopulation,althoughsomeweremore marked.forexample,thesurveyfoundevidenceoflowfruitandvegetable consumptionandpoornutritionalstatusforsomevitaminsandminerals, includingvitamind(nelsonetal.2007).morerecently,recommendations havebeenmadebysacninanumberofitsreportsincludingthe Nutritional Wellbeing of the British Population (SACN2008a) anditsreviewofthekey findingsfromtheinfantfeedingsurvey2005,infant Feeding Survey 2005: A commentary on infant feeding practices in the UK (SACN2008b). Women in disadvantaged groups are significantly less likely to: accessmaternityservicesearly stayintouchwithhealthservicesthroughouttheirpregnancies haveawell-balanceddiet breastfeedtheirbabies giveupsmokinginpregnancy introducesolidfoodsattherecommendedage. Women from disadvantaged, vulnerable or excluded groups including pregnant teenagers are more likely to have poorer maternal and neonatal outcomes, for example: infantmortality lowbirthweight postnataldepression.

16 How Healthy Start gives you the opportunity to help disadvantaged women Becausepregnantwomenandfamiliesneedtogettheirapplication leafletcountersignedbyahealthprofessional,theapplicationprocess offersanopportunitytoidentifythosewhoaremorelikelytobe disadvantaged,youngandlivinginvulnerablesituationsaswellasto engagewiththemandreferthemontorelevantservicesforadditional supportifrequired.forexample,awomanwhoqualifiesforhealthystart maybelesslikelytobreastfeed.asahealthprofessionalyoumaybeable todirecthertobreastfeedingeducationandsupport,peersupportand thelocalsurestartchildren scentreorfamilycentre. It sachancetodiscussbreastfeedingandnutritionandgivewomen generalhealthadviceatatimewhentheyarelikelytobemostreceptive toit.forinstance,youmightbeabletosuggestwhattheyspendtheir voucherson. TheUKHealthDepartmentsbelievethatmaternityservicesshouldbe proactiveinengagingallwomen,butparticularlythosewomenfrom disadvantagedgroupsandcommunities,earlyinpregnancyandmaintaining contactuptoandafterbirth(dh2004;welshassemblygovernment2005). SACNhasalsorecommendedthatadviceoninfantfeedingneedstobe tailoredaccordingtosocialgroup(sacn2008a).seealsopages30and31. The role of health professionals is crucial Recentresearchhasshownthattheroleofhealthprofessionalsinintroducing HealthyStartisincrediblyimportant.ParentswhoareintroducedtoHealthy Startthroughahealthprofessionalaremorelikelytoseethemselvesworking inpartnershipwithhealthystartforthebenefitoftheirchildrenasopposed toviewingtheschemesimplyasfinancialsupport(dhqualitativeresearch, October2009,unpublished). 16 / 17

17 Nutrition in pregnancy HealthyStartencouragespregnantwomenfromdisadvantagedgroups toincludemilkandavarietyoffruitandvegetablesintheirdiet.teenage girls,whohaveincreasednutritionalrequirements,areatgreaterriskof nutrientdeficienciesduringpregnancy,whichiswhyevery pregnant woman under 18 years old is eligible for Healthy Start. Healthyeatingduringpregnancyisimportantforboththehealthofthe motherandthedevelopmentandgrowthofthebaby.also,womenare mostlikelytoinfluencethedietarydecisionsofthewholefamilyandare centraltothefuturehealthyeatingoftheirchildren. Ahealthybalanceddietthatincludesatleastfiveportionsoffruitand vegetablesadaycanhelpreducetheriskofheartdiseaseandsomecancers. Obesity and pregnancy It simportantthatwomenaregivenadviceaboutweightgainduring pregnancy.there sanincreasedriskofcomplicationsiftheirbodymass index(bmi)isabove35(orlessthan18),suchasincreasedbloodpressure whichcanleadto,amongotherconditions,gestationaldiabetes. Dieticiansmaybeabletoprovidesupport. Womendon tneedto eatfortwo whenthey arepregnant.evenwith multiplepregnancies, it sthequalityandnot thequantityofthediet thatisimportant.

18 What pregnant women should eat Theeatwellplate 1 shows howmuchofeachtype offoodisneededtohavea healthy,well-balanceddiet. Plenty of fruit and vegetables(fresh,frozen,tinned,driedoraglass of100%unsweetenedfruitjuice) avariety,atleastfiveportionsaday. Plenty of starchy foods,suchaswholemealbread,potatoes,rice,pasta, chapatis,yamsandbreakfastcereals,asthemainpartofeverymeal. Some protein,suchasleanmeatandchicken,fish,eggsandpulsessuch asbeansandlentils,whicharealsogoodsourcesofiron.pleasenote: pregnantwomenshouldtrytoeatatleasttwoportionsoffishaweek, butshouldnothavemorethantwoportionsofoilyfishaweek. Plenty of fibre,whichhelpspreventconstipation it sinwholegrain bread,wholegraincereals,pasta,rice,pulsesandfruitandvegetables. Some dairy foods,includinglower-fatversionsofmilk,cheeseand yoghurt,whichcontaincalciumandarealsoagoodsourceofprotein. There are some foods that pregnant women should avoid seepage19. and cut down on Foodssuchascakesandbiscuitsbecausethey rehighinfatandsugars andcancauseunnecessaryweightgaininpregnancy. Healthy snacks to recommend instead include: Maltloaf,lower-fatyoghurts,fruit includingfresh,tinnedor100% unsweetenedfruitjuice,andsmallhandfulsofdriedfruitsuchasraisins orapricots. 18 / 19 1 DepartmentofHealthinassociationwiththeWelshGovernment, thescottishgovernmentandthefoodstandardsagencyinnorthernireland

19 Foods to avoid during pregnancy Some types of cheese:mouldripenedandblue-veinedsoft cheeses(suchasbrie,camembertordanishblue).thesemaycontain listeria,whichcancausemiscarriage,stillbirthorsevereillnessinthe newbornbaby. Pâté:alltypesofpâté,includingvegetablepâtés,astheycan containlisteria. Uncooked or undercooked ready meals,includingraworpartially cookedmeat,especiallypoultry. Raw or partially cooked eggs,toavoidtheriskofsalmonella. Raw or undercooked meat. Liver, liver products, fish liver oil supplements and supplements containing vitamin A (retinol)(seepage28). Some types of fish:pregnantwomenshouldavoideatingshark, marlinandswordfishandlimittheamountoftunatheyeattono morethantwotunasteaks(170geachraw)orfourcans(140gdrained weight)perweek;thesetypesoffishcontainhighlevelsofmercury, whichcandamagethebaby sdevelopingnervoussystem. Raw shellfish. Unpasteurised milk andproductsmadefromunpasteurisedmilk. Alcohol(seepage23). A note on peanuts Previousadvicehasbeenthatwomenmaychoosetoavoideatingpeanuts duringpregnancyandwhenbreastfeedingifthereisahistoryofallergyintheir child simmediatefamily(suchasasthma,eczema,hayfever,foodallergiesetc). Thisadvicehasnowchangedasthelatestresearchshowsthatthereisnoclear evidencethateatingpeanutsduringpregnancyandwhenbreastfeeding affectsthechancesofababydevelopingapeanutallergy.sopregnantand breastfeedingwomenarenowadvisedthattheycaneatpeanutsaspartof ahealthybalanceddietiftheychoosetoandarenotallergicthemselves.

20 Caffeine Consuminghighlevelsofcaffeine duringpregnancycanresultinbabies beingbornwithlowbirthweight, whichcanincreasetheriskofhealth problemsinlaterlife.toomuchcan alsocausemiscarriages,sopregnant womenshouldlimittheircaffeine intake. Pregnantwomenshouldhaveno morethan200mgofcaffeineper day,i.e.nomorethanapproximately twomugsofinstantcoffeeorone mugoffiltercoffeeortwomugsof teaortwocansofenergydrink. Physical activity Regularphysicalactivityisimportant forallwomenanditisrecommended thattheyhave150minutesof moderateintensityactivityaweek, suchasbriskwalking.pregnant womenshouldaimtostayasactiveas possible,bearinginmindthestageof pregnancytheyareat.iftheytake partingymclassestheyshouldmake surethattheirinstructorknowsthey arepregnantandtaketheiradviceon appropriateactivity.contactsports andthoseactivitieswithariskof fallingshouldbeavoided.women whohaven tbeenundertakingregular physicalactivitypriortotheir pregnancyshouldconsiderlow-impact exercisetheywillenjoy,suchasbrisk walking,swimmingandaqua-natal classes,whicharegentleinmovement andintensity.theyshouldbeadvised tobuildupexercisegradually,for examplein10-minutelotsthroughout theday,andtoavoidsittingforlong periodsoftime. Physical activity for children Beforetheybegintocrawl,babies shouldbeencouragedtobephysically activebyreachingandgrasping, pullingandpushing,movingtheir head,bodyandlimbsduringdaily routines,andduringsupervisedfloor play,includingtummytime.once babiescanmovearound,theyshould beencouragedtobeasactiveas possibleinasafe,supervisedand nurturingplayenvironment. Childrenwhocanwalkontheirown shouldbephysicallyactiveeveryday foratleast180minutes(3hours).this shouldbespreadthroughouttheday, indoorsoroutside.the180minutes canincludelightactivitysuchas standingup,movingaround,rolling andplaying,aswellasmoreenergetic activitylikeskipping,hopping,running andjumping.activeplay,suchas usingaclimbingframe,ridingabike, playinginwater,chasinggamesand ballgames,isthebestwayforthisage grouptobephysicallyactive. 20 / 21

21 Under5sshouldnotbeinactivefor longperiods,exceptwhenthey re asleep.watchingtv,travellingbycar, busortrainorbeingstrappedintoa buggyforlongperiodsarenotgood forachild shealthanddevelopment. There sgrowingevidencethatsuch behaviourcanincreasetheirriskof poorhealth.allchildrenunderfive whoareoverweightcanimprovetheir healthbymeetingtheseactivity guidelines.toachieveandmaintaina healthyweight,theymayneedtodo additionalactivityandmakechanges totheirdiet. Dangers in pregnancy Toxoplasmosis This infection is rare but can have serious consequences. Pregnant women should reduce the risks of contracting toxoplasmosis by: washingfruit,vegetablesandsaladbeforeeating washinghandsbeforehandlingfood washingallsurfacesandutensils washinghandsafterpreparingrawmeat thoroughlycookingrawmeat heatingready-preparedmealsuntiltheyarepipinghotallthe waythrough keepingleftoverscoveredinthefridgeandusingthemwithintwodays avoidingcontaminationwithcatfaecesinthecatlittertrayorsoil they shouldasksomeoneelsetotakecareofit,oratleastweargloves avoidingcontactwithabortedlambs,newbornlambsandafterbirth nothelpingwithlambingormilkingewes. Formoreinformationvisit:

22 Smoking Everytimeawomansmokesduringpregnancyitincreasestheriskof miscarriage,prematurebirth,lowbirthweightandstillbirth.italsotrebles theriskofcotdeathandcanleadtochildrendevelopingasthmaand respiratoryinfectionsinlaterlife. Youshouldaskpregnantwomenwhattheirsmokingstatusis,advise themofthehealthbenefitsofstoppingsmokingandthenprovidethem withinformationandsupporttohelpthemquit,includingreferraltotheir localstopsmokingservice. Asmokefreehomeisbestforpregnantwomen,babiesandyoung childrenasexposuretosecondhandsmokecanbeharmful.youshould providefamilieswithpracticaladviceabouthowtheycancreate asmokefreehome. If women want additional help or advice to stop smoking in pregnancy, direct them to: NHSPregnancySmokingHelpline (England) Smokeline(Scotland) StopSmokingWales SmokersHelpline(Wales) (NorthernIreland) 22 / 23

23 Alcohol and pregnancy Alcoholcanbeharmfultothedevelopingbabyandmayleadtoearly miscarriage.heavydrinkingisparticularlyrisky.itisadvisedthatpregnant womenorwomentryingtoconceiveshouldavoiddrinkingalcohol. Iftheydochoosetodrink,tominimisetherisktothebabytheyshouldnot drinkmorethanoneortwounitsonceortwiceaweek andshouldnotget drunk.additionally,nicerecommendsthatwomenshouldavoidalcoholinthe firstthreemonthsinparticular,becauseoftheincreasedriskofmiscarriage. Oneunitofalcohol=asingle (25ml)measureofspiritsat40% ABV(alcoholbyvolume),half apintofbeerat3.5%abv, orhalfa175mlglassofwineat 11.5%ABV.Largerorstronger drinksthanthesewouldcontain morethanoneunitofalcohol. Itcanbeparticularlyeasyto underestimateunitswhendrinks arepouredathome. Formoreadviceonalcohol andunitinformationvisit Orcall: Drinkline Drinkline(Scotland) Breastfeeding and alcohol Alcoholcanpassthroughthemother s milktobreastfedbabiesinverysmall amounts.itisunlikelythathavingan occasionaldrinkwillharmthemother orbaby,butitmightaffecthoweasily thebabyfeeds.breastfeedingwomen shouldbeadvisedtodrinkverylittle,for examplenomorethanoneortwounits onceortwiceaweek.ifabreastfeeding womanintendstodrinkmorethanthis, theycanexpressmilkinadvance. Ifabreastfeedingmotherdrinks alcoholbeforefeeding,itcanaffect thebabyinanumberofways: Themilkmaysmelldifferentandthe babymaynotfeedaswellasnormal. Thebabymaysleeplesswellfor somehoursafterfeeding. Itisnotadvisableforwomentoshare abedorasofawiththeirbabyif theyhavebeendrinking.ifthey sleepheavilytheycouldputtheir babyatrisk.

24 Illegal drugs Useofillegaldrugscanbeharmfultobothmotherandbaby.Women whomaygetpregnant,whoarepregnantorwhoarebreastfeeding shouldnormallyaimtobecompletelydrugfree.however,regulardaily usersofsomeillegaldrugsassociatedwithwithdrawalproblemsshould notstopusingabruptlywithoutseekingadvice. Mostnon-dependentdruguserswillcertainlybeabletostopusingillegal drugsontheirownwithlittleornodifficulty.forthosewomenwhoneedit, primarycareandspecialistdrugsservices canprovideadviceandsupportabout quitting.nicehasproducedguidance onthecarethatpregnantwomenwith complexsocialfactors,includingthose misusingdrugs,shouldreceive Womenatriskofdevelopingmarked withdrawalsymptoms,particularlydaily usersofdepressantdrugssuchas opiatesorbenzodiazepines,should obtainveryearlymedicaladvicebefore makinganylargeorabruptreductions intheirdruguse.whenmedically supportedwithdrawalisneeded,this Confidential advice for drug users FRANK(UK-wide) KnowtheScore(Scotland) DAN24/7(Wales) canthenbeproperlyplannedtobeassafeaspossibleforbothmother andbaby.somewomenwithmarkedheroindependencedoneedtostay onsomesubstitutemedicationthroughoutthefirsttrimester,andfor someforthewholepregnancy. 24 / 25

25 Healthy Start vitamins for pregnant women and breastfeeding mothers Women in families supported by Healthy Start can claim free vitamins while they re pregnant and up to their baby s first birthday. They re sent a coupon every eight weeks that can be exchanged for Healthy Start women s vitamin tablets. It simportantthatwomengetallthevitaminsandmineralsthey needforthemselvesandtheirgrowingbabywhilethey repregnant andbreastfeeding.therearecertainsupplementstheyshouldtakewhich willhelppreventthemfrombecomingdeficient. How Healthy Start beneficiaries claim their free vitamins EachNHSorganisationorboardisresponsiblefordistributingvitamins locally.somemayalsochoosetosellorsupplythemfreeofcharge towomenandchildrenwhoarenoteligibleforhealthystart.formore informationaboutvitamindistributionineachukcountry,visit Beneficiariesreceiveavitamincouponandareadvisedtoasktheir midwife,healthvisitororpublichealthnurseaboutwheretheycan usethecoupon,andtotakeitwiththemtocollecttheirvitamins. So it s essential that health professionals know what the local arrangements are.

26 What s in Healthy Start vitamins for women? Healthy Start vitamins for women contain folic acid, vitamin D and vitamin C. Here s why they re important for pregnant women and new mums. Folic acid Taking400mcg(0.4milligrams)offolicacidperdaybothbeforeandup untilthe12thweekofpregnancycanhelppreventntdssuchasspina bifida,wherethespinedoesn tdevelopproperlyinunbornbabies. Eveniffolicacidisn ttakenbeforeconception,it sworthstartingassoon asthewomanisawareofthepregnancy,anditshouldcontinuetobe takenuntilthe12thweekofpregnancy.folate,thenaturalformoffolic acid,canbefoundinpeas,potatoes,broccoli,orangejuice,brussels sprouts,asparagus,black-eyedbeans,spinachandkale,andit simportant forpregnantwomentoeatplentyofthesefoods.however,it svery difficulttomeetthisincreasedrequirementoffolatefromfoodalone. Therefore,takingfolicacidsupplementsisimportantwhentryingtoget pregnantandintheearlystagesofpregnancy. IfamotherhasalreadyhadapregnancyaffectedbyanNTDorhas diabetesoristakinganti-epilepticmedicines,sheisadvisedtoseek medicaladvicefromhergp. Recommendation: all women who are trying to get pregnant or who are pregnant should take 400mcg of folic acid each day up until they are 12 weeks pregnant. Women who have already had a pregnancy affected by an NTD need to take 5mg of folic acid each day until the 12th week of their pregnancy. In addition, women who have diabetes and those taking anti-epileptic medicines should consult their GP for advice as they will need to take a higher dose of folic acid. (AsrecommendedbyCOMA (2000),SACN(2006)andNICE(2008).) 26 / 27

Delivering a Healthy Start for pregnant women, new mums, babies and young children

Delivering a Healthy Start for pregnant women, new mums, babies and young children HS52A Delivering a Healthy Start for pregnant women, new mums, babies and young children Read more A guide for health professionals 1 Contents What is Healthy Start? Who qualifies?

More information

HS58A. Healthy Start vitamins and why you need them

HS58A. Healthy Start vitamins and why you need them HS58A Healthy Start vitamins and why you need them Folic acid Taking a folic acid supplement before you re pregnant and until the 12th week of your pregnancy is really important because it reduces the

More information

Help prègnant women, new mothers and children get their freè Healthy Start vitamins

Help prègnant women, new mothers and children get their freè Healthy Start vitamins HS52BE Help prègnant women, new mothers and children get their freè Healthy Start vitamins Read more A guide for health professionals in England 2012/13 Healthy Start: a better

More information

Vitamin supplements and you For pregnant or breastfeeding women, and babies and young children

Vitamin supplements and you For pregnant or breastfeeding women, and babies and young children Vitamin supplements and you For pregnant or breastfeeding women, and babies and young children about this leaflet Vitamins are really important they are essential nutrients that your body needs, in small

More information

Vitamin supplements and you

Vitamin supplements and you Vitamin supplements and you Vitamin supplements and you For pregnant or breastfeeding women, and babies and young children about this leaflet Vitamins are really important they are essential nutrients

More information

Help prègnant women, new mothers and children get their freè Healthy Start vitamins

Help prègnant women, new mothers and children get their freè Healthy Start vitamins HS52BE Help prègnant women, new mothers and children get their freè Healthy Start vitamins Read more A guide for health professionals in England Healthy Start: a better diet plus

More information

Infant Feeding Survey 2010: Summary

Infant Feeding Survey 2010: Summary Infant Feeding Survey 2010: Summary Authors: Fiona McAndrew, Jane Thompson, Lydia Fellows, Alice Large, Mark Speed and Mary J. Renfrew A survey carried out on behalf of the Health and Social Care Information

More information

A Quick Guide to the Government s Healthy Eating Recommendations

A Quick Guide to the Government s Healthy Eating Recommendations A Quick Guide to the Government s Healthy Eating Recommendations About Public Health England Public Health England exists to protect and improve the nation's health and wellbeing, and reduce health inequalities.

More information

Protecting and improving the nation s health. Vitamin D. Information for healthcare professionals

Protecting and improving the nation s health. Vitamin D. Information for healthcare professionals Protecting and improving the nation s health Vitamin D Information for healthcare professionals 1 Vitamin D: Information for healthcare professionals Why is vitamin D important? Some of the UK population

More information

Vitamin supplements and you

Vitamin supplements and you Vitamin supplements and you For pregnant or breastfeeding women, and babies and young children About this leaflet Vitamins are really important they are essential nutrients that your body needs, in small

More information

Information for you. Healthy eating and vitamin supplements in pregnancy. Who is this information for? Healthy eating

Information for you. Healthy eating and vitamin supplements in pregnancy. Who is this information for? Healthy eating Information for you Published in October 2014 (next review date: 2017) Healthy eating and vitamin supplements in pregnancy Who is this information for? This information is for you if you want to know more

More information

Vitamin supplements and you

Vitamin supplements and you Vitamin supplements and you Guidance for pregnant or breastfeeding women, babies and young children Health Improvement About this leaflet Vitamins are really important they are essential nutrients that

More information

Diet, activity and your risk of prostate cancer

Diet, activity and your risk of prostate cancer Diet, activity and your risk of prostate cancer Prostate cancer is the most common cancer in men in the UK. About one in eight men (12.5 per cent) will get prostate cancer at some point in their lives.

More information

Assess Life, Health and Wellbeing in the London Borough of Bexley Listening to you, working for you

Assess Life, Health and Wellbeing in the London Borough of Bexley Listening to you, working for you Joint Strategic Needs Assessment Chapter 20 Diet and Nutrition Assess Life, Health and Wellbeing in the London Borough of Bexley Listening to you, working for you CHAPTER 20 DIET AND NUTRITION 20.1 Introduction

More information

Encourage regular eating, preferably three meals a day with two healthy snacks (for example fruit or yoghurt rather than sweets or crisps) in

Encourage regular eating, preferably three meals a day with two healthy snacks (for example fruit or yoghurt rather than sweets or crisps) in Encourage regular eating, preferably three meals a day with two healthy snacks (for example fruit or yoghurt rather than sweets or crisps) in between. This will help to keep blood sugar levels even. Eat

More information

simple steps give you for good bowel health

simple steps give you for good bowel health simple steps give you for good bowel health This booklet contains simple steps you can take to help achieve good bowel health. This is important to everyone, as these small changes will help your digestive

More information


INTEGRATED STRATEGIC NEEDS ASSESSMENT: DIET AND HEALTHY EATING SUMMARY INTEGRATED STRATEGIC NEEDS ASSESSMENT: DIET AND HEALTHY EATING SUMMARY KEY ISSUES Eating a nutritious, balanced diet is important in maintaining health and reduces the risk of a number of diseases including

More information

What can happen if you have low iron levels?

What can happen if you have low iron levels? Iron in your diet Iron in your diet Why is iron important? Iron is important because it helps your body to make haemoglobin. Haemoglobin, or Hb, is the protein found in red blood cells that carries oxygen

More information

Dietary Guidelines 2010 Self-Test Answer Key

Dietary Guidelines 2010 Self-Test Answer Key Name: Date: 1. One Purpose of the Dietary Guidelines for Americans (DGAs) is to a) Provide a science base for U.S. food and nutrition program policies - See page 6 b) Encourage everyone to eat a balanced

More information

A Healthy Diet Supporting Information

A Healthy Diet Supporting Information A Healthy Diet Supporting Information 1 What is a Healthy Diet? Childhood obesity is on the increase, so establishing good eating patterns early in life is very important. A healthy diet is one that is

More information


CHILD CARE DIPLOMA. Course Sample CHILD CARE DIPLOMA Course Sample Unit CHP2 Providing for children s physical needs inclusive of health and safety The Statutory framework for the EYFS is a requirement for all registered early years providers.

More information

Weaning. Starting solid food

Weaning. Starting solid food Weaning Starting solid food What is weaning? The information in this leaflet will help you wean your baby onto solid foods. Your baby s development from breast or formula milk feeding to sharing in the

More information

Protecting and improving the nation s health. Vitamin D. All you need to know

Protecting and improving the nation s health. Vitamin D. All you need to know Protecting and improving the nation s health Vitamin D All you need to know 1 Vitamin D: All you need to know Why is vitamin D important? Throughout our lives, we need vitamin D to keep our bones and teeth

More information

FACTSHEET. Weaning your baby

FACTSHEET. Weaning your baby FACTSHEET Weaning your baby This factsheet gives you information on introducing your baby to solid food. It covers: The recommendation for exclusive breastfeeding for the first 6 months The introduction

More information

Maternal and child nutrition

Maternal and child nutrition Maternal and child nutrition Issued: March 2008 last modified: November 2014 NICE public health guidance 11 NICE 2008 Contents Introduction... 6 1 Key priorities... 7 Healthy

More information

Weaning learning to like new tastes and textures

Weaning learning to like new tastes and textures Complementary feeding or weaning is introducing solid foods in addition to your baby s milk feeds. Babies develop at different rates so begin when your baby is ready by six months, but not before four

More information

The eatwell plate is based on the Government s Eight Tips for Eating Well, which are:

The eatwell plate is based on the Government s Eight Tips for Eating Well, which are: Teachers Notes The eatwell plate The eatwell plate is a pictorial food guide showing the proportion and types of foods that are needed to make up a healthy, varied and balanced diet. The plate has been

More information

The meaning of. When is it best to start?

The meaning of. When is it best to start? 1 2 The meaning of When is it best to start? There comes a time when a baby needs more nourishment than breast milk or infant formula alone can provide. Government guidelines strongly encourage mothers

More information

Healthy Eating During Pregnancy

Healthy Eating During Pregnancy Healthy Eating During Pregnancy Pregnancy is a time of great change. Your body is changing to allow your baby to grow and develop. Good nutrition will help you meet the extra demands of pregnancy while

More information

Nutrition Requirements

Nutrition Requirements Who is responsible for setting nutrition requirements in the UK? In the UK we have a set of Dietary Reference Values (DRVs). DRVs are a series of estimates of the energy and nutritional requirements of

More information

-Grains are divided into 2 subgroups: whole grains and refined grains.

-Grains are divided into 2 subgroups: whole grains and refined grains. Nutrition (Pre-3 rd ) was written to educate young people, parents and teachers about where our food comes from. This guide provides nutrition facts, useful definitions, and additional websites for teachers

More information

Nutrition: a guide for feeding infants with cystic fibrosis

Nutrition: a guide for feeding infants with cystic fibrosis Nutrition: a guide for feeding infants with cystic fibrosis Factsheet April 2013 Nutrition: a guide for feeding infants with cystic fibrosis Introduction Feeding a baby with cystic fibrosis (CF) is similar

More information


EARLY PREGNANCY INFORMATION EARLY PREGNANCY INFORMATION INFORMATION COVERED Healthy diet/foods to avoid Smoking, alcohol & drugs Blood tests Antenatal screening Flu and whooping cough vaccinations What to do if unwell Healthy Diet

More information

Lifestyle and Special Diet Guidance

Lifestyle and Special Diet Guidance Lifestyle and Special Diet Guidance Vegan A vegan diet consists of vegetables, grains, nuts, fruits and other foods made only from plants. We have a variety of recipes which are suitable for vegans on

More information

Nutrition Information from My Plate Guidelines

Nutrition Information from My Plate Guidelines Nutrition Information from My Plate Guidelines Note: This information was compiled from the website: for participants in the 4-H Food Prep Contest 1/12/16. The information

More information

How has your view of healthy eating changed during pregnancy? B Y A T H A R K H A L I D A N D D A F I N A N I S H O R I

How has your view of healthy eating changed during pregnancy? B Y A T H A R K H A L I D A N D D A F I N A N I S H O R I How has your view of healthy eating changed during pregnancy? B Y A T H A R K H A L I D A N D D A F I N A N I S H O R I Hypothesis Decisions based on eating choices would shift towards the healthy alternative

More information

Calcium and Vitamin D: Important at Every Age

Calcium and Vitamin D: Important at Every Age Calcium and Vitamin D: Important at Every Age National Institutes of Health Osteoporosis and Related Bone Diseases ~ National Resource Center 2 AMS Circle Bethesda, MD 20892-3676 Tel: (800) 624-BONE or

More information

(t)01224 554400 (e) Please ask for publication CGD 060003

(t)01224 554400 (e) Please ask for publication CGD 060003 If you need this, or any other NHS Grampian publication in an alternative format (large print, audio tape etc) or in another language please contact Corporate Communications. (t)01224 554400 (e)

More information

Planning for & Eating Well in Pregnancy. Andrea Basu BSc RD MSc RPHNutr. Community Development Dietitian Team Lead North Wales NHS Trust (East)

Planning for & Eating Well in Pregnancy. Andrea Basu BSc RD MSc RPHNutr. Community Development Dietitian Team Lead North Wales NHS Trust (East) Planning for & Eating Well in Pregnancy Andrea Basu BSc RD MSc RPHNutr. Community Development Dietitian Team Lead North Wales NHS Trust (East) Up to 50% of pregnancies are likely to be unplanned, so all

More information

Diet and cancer. Questions about cancer? Ask Macmillan Page 1 of 7

Diet and cancer. Questions about cancer? Ask Macmillan Page 1 of 7 This information is an extract from the booklet, Understanding complementary therapies. You may find the full booklet helpful. We can send you a copy free see page 7. There are several well-established

More information

Fat myths. Myth: All fats are equal and equally bad for you. Myth: Lowering the amount of fat you eat is what matters the most.

Fat myths. Myth: All fats are equal and equally bad for you. Myth: Lowering the amount of fat you eat is what matters the most. Alexandra Palumbo Fat myths Myth: All fats are equal and equally bad for you. Myth: Lowering the amount of fat you eat is what matters the most. Myth: Fat-free means healthy. Saturated fats Trans-fats

More information

your eatwell Feeding your baby in the first year

your eatwell Feeding your baby in the first year baby your Feeding your baby in the first year eatwell This booklet gives practical advice about feeding your baby. It takes you from the early months when your baby is fed only with breast

More information

If a child or adult needs to avoid cows milk, remember that it may be present in many foods, such as:

If a child or adult needs to avoid cows milk, remember that it may be present in many foods, such as: Milk Allergy Cows milk allergy affects around 3 6% of (3 6 in every 100) infants and young children who usually start to have symptoms in their first few months. This causes many health problems and is

More information

What is a balanced diet?

What is a balanced diet? 01 Balanced diet The Eatwell Plate What is a balanced diet? Your balanced diet will be specific to you it will depend on your age, your body weight and your gender. It also depends on how active you are.

More information

The meaning of. When is it best to start?

The meaning of. When is it best to start? 1 2 The meaning of When is it best to start? There comes a time when a baby needs more nourishment than breast or infant alone can provide. Government guidelines strongly encourage mothers to breast-feed

More information


INFANTS AND YOUNG CHILD FEEDING (UPTO 2 YEARS) INFANTS AND YOUNG CHILD FEEDING (UPTO 2 YEARS) Breastfeeding is the best way to satisfy the nutritional and psychological needs of the baby. Mother s milk (breast milk, human milk) contains all nutrients

More information

Section C. Diet, Food Production, and Public Health

Section C. Diet, Food Production, and Public Health This work is licensed under a Creative Commons Attribution-NonCommercial-ShareAlike License. Your use of this material constitutes acceptance of that license and the conditions of use of materials on this

More information

Introduction to WIC. Objectives

Introduction to WIC. Objectives Objectives Introduction to WIC After completing this lesson, you will be able to: Describe the participants served by WIC. Describe how WIC improves the health of participants. Identify the history and

More information

Iron in your diet. Patient information

Iron in your diet. Patient information Iron in your diet Patient information Iron in your diet Why is iron important? Iron is important because it helps your body to make haemoglobin. Haemoglobin, or Hb, is the protein found in red blood cells

More information

Preconception Care: Things to Do before You Become Pregnant

Preconception Care: Things to Do before You Become Pregnant Preconception Care: Things to Do before You Become Pregnant Planning a pregnancy with someone that you love can be exciting and rewarding. There are many things for you and your partner to consider before

More information

The AusTrAliAn Guide To healthy eating Eat a wide variety of nutritious foods from these five food groups every day Drink water.

The AusTrAliAn Guide To healthy eating Eat a wide variety of nutritious foods from these five food groups every day Drink water. The AusTrAliAn Guide To healthy eating Eat a wide variety of nutritious foods from these five food groups every day Drink water. use small amounts only sometimes and in small amounts Daily Diets These

More information

If your child reacts to cows milk, isn t it time you reacted too?

If your child reacts to cows milk, isn t it time you reacted too? If your child reacts to cows milk, isn t it time you reacted too? Restless sleep? Skin rashes? Diarrhoea? Vomiting? Reflux? Colic? Free iphone App Parent information leaflet See page 11 What is a food

More information

Nutrient Reference Values for Australia and New Zealand

Nutrient Reference Values for Australia and New Zealand Nutrient Reference Values for Australia and New Zealand Questions and Answers 1. What are Nutrient Reference Values? The Nutrient Reference Values outline the levels of intake of essential nutrients considered,

More information

Off to the best start. Important information about feeding your baby

Off to the best start. Important information about feeding your baby Off to the best start Important information about feeding your baby mum s milk the best start for your baby What happens in your baby s first years has a big effect on how healthy he or she will be in

More information

Introducing Solid Foods. Giving your baby a better start in life

Introducing Solid Foods. Giving your baby a better start in life Introducing Solid Foods Giving your baby a better start in life Starting your baby on solids Often called weaning, introducing solid foods should start when your baby is around 6 months old. Gradually,

More information

Pregnancy Planning. Eat a nutritious, well-balanced diet

Pregnancy Planning. Eat a nutritious, well-balanced diet Pregnancy Planning Your health and habits affect a baby from the earliest days of a pregnancy. Before you find out for sure that you are pregnant, a great deal has already happened. Your baby's major organs

More information


DIABETES & HEALTHY EATING DIABETES & HEALTHY EATING Food gives you the energy you need for healthy living. Your body changes most of the food you eat into a sugar called glucose. (glucose) Insulin helps your cells get the sugar

More information


CENTRAL SURREY HEALTH BREASTFEEDING POLICY CENTRAL SURREY HEALTH BREASTFEEDING POLICY PRINCIPLES To ensure that all children receive a chance to grow and develop to their fullest potential, it is not enough simply to make breastfeeding possible;

More information

Fish in the diet a review. Sara Stanner British Nutrition Foundation

Fish in the diet a review. Sara Stanner British Nutrition Foundation Fish in the diet a review Sara Stanner British Nutrition Foundation BNF who we are, what we do? What the review covers Fish consumption Nutrient composition

More information

Plant Based Diet. Christina Lichtinger, PharmD

Plant Based Diet. Christina Lichtinger, PharmD Plant Based Diet Christina Lichtinger, PharmD Plant based diets do not provide enough protein MYTH Dairy is required in the diet in order to consume enough calcium MYTH Sufficient Vitamin B12 is not available

More information


CORPORATE HEALTH LOWERING YOUR CHOLESTEROL & BLOOD PRESSURE CORPORATE HEALTH LOWERING YOUR CHOLESTEROL & BLOOD PRESSURE What is Cholesterol? What s wrong with having high cholesterol? Major risk factor for cardiovascular disease Higher the cholesterol higher the

More information

PERINATAL NUTRITION. Nutrition during pregnancy and lactation. Nutrition during infancy.

PERINATAL NUTRITION. Nutrition during pregnancy and lactation. Nutrition during infancy. PERINATAL NUTRITION Nutrition during pregnancy and lactation Nutrition during infancy. Rama Bhat, MD. Department of Pediatrics, University of Illinois Hospital Chicago, Illinois. Nutrition During Pregnancy

More information

Making Healthy Food Choices. Section 2: Module 5

Making Healthy Food Choices. Section 2: Module 5 Making Healthy Food Choices Section 2: Module 5 1 Nutrition For Health What is healthy Tips on planning meals Making a shopping list/ Bulk orders Using WIC foods Cook and freeze What foods to choose How

More information

healthy eating for gestational diabetes

healthy eating for gestational diabetes Talking diabetes No.19 healthy eating for gestational diabetes Gestational diabetes occurs in 5 8% of Australian women during pregnancy. It happens because the changing hormone levels in the body have

More information

Healthy eating for breastfeeding mothers

Healthy eating for breastfeeding mothers Healthy eating for breastfeeding mothers Healthy eating is important when you are breastfeeding. Your body has a greater need for most nutrients. Some of the extra energy required for breastfeeding comes

More information

Healthy Eating: A Whole Diet Approach.

Healthy Eating: A Whole Diet Approach. Healthy Eating: A Whole Diet Approach. The importance of a healthy and varied diet A good diet is important for good health. A healthy and varied diet can help to maintain a healthy body weight, enhance

More information

INFANT FEEDING. Principles for succesful feeding: Sucklings (those. who depends mainly on milk. nutrition. Toddlers (those

INFANT FEEDING. Principles for succesful feeding: Sucklings (those. who depends mainly on milk. nutrition. Toddlers (those CHILD NUTRITION INFANT FEEDING Principles for succesful feeding: Sucklings (those who depends mainly on milk as their source of nutrition. Toddlers (those who eat mainly solid foods). Breast Feeding Breast

More information

The Bronx Health Link

The Bronx Health Link Monthly Newsletter The Bronx Health Link MARCH 2007 Gestational Diabetes Y ou are 28 weeks pregnant. Your health care provider has just told you that you have gestational (ges-tay-shun-all) diabetes. Should

More information

Presentation Prepared By: Jessica Rivers, BASc., PTS

Presentation Prepared By: Jessica Rivers, BASc., PTS Presentation Prepared By: Jessica Rivers, BASc., PTS Presentation Outline Why should we care about our eating habits? Why is nutrition so important as we age? How do we know if we are eating healthy? What

More information

Baby Steps To A Healthy Pregnancy

Baby Steps To A Healthy Pregnancy Preconception Middlesex-London Health Unit 50 King Street, London, ON N6A 5L7 519-663-5317 Published 2015. Copyright of the Middlesex London Health Unit. All rights reserved. Baby Steps To A Healthy Pregnancy

More information

Floradix and Floravital. for more Energy and Vitality

Floradix and Floravital. for more Energy and Vitality Tired of being tired? Floradix and Floravital for more Energy and Vitality SUITABLE FOR VEGETARIANS, GMO FREE, FREE FROM ALCOHOL, PRESERVATIVES, ARTIFICIAL FLAVOURINGS AND COLOURINGS. Helping maintain

More information

Deciding whether to become a parent

Deciding whether to become a parent Deciding whether to become a parent This information is an extract from the booklet, Relationships, sex and fertility for young people affected by cancer. You may find the full booklet helpful. We can

More information

FACT SHEET N 394 UPDATED MAY 2015. Healthy diet

FACT SHEET N 394 UPDATED MAY 2015. Healthy diet FACT SHEET N 394 UPDATED MAY 2015 Healthy diet KEY FACTS n A healthy diet helps protect against malnutrition in all its forms, as well as noncommunicable diseases (NCDs), including diabetes, heart disease,

More information

Original Date: May 20, Introduction

Original Date: May 20, Introduction Introduction Eating well when pregnant is one of the first and best gifts you can give to your baby. What you choose to eat will influence your health and his. You might be unsure about what is right for

More information

Advice for Patients Prevention of Kidney Stones

Advice for Patients Prevention of Kidney Stones Advice for Patients Prevention of Kidney Stones Exceptional healthcare, personally delivered Contents nleft Kidney Calculus on Plain X-Ray n The Anatomy of the Urinary Tract nprevention General Advice:

More information

Healthy Eating for Pregnancy

Healthy Eating for Pregnancy Healthy Eating for Pregnancy The Health Promotion Unit of the Department of Health and Children acknowledges and thanks the Paediatric Interest Group of the Irish Nutrition and Dietetic Institute for their

More information

Women and Children s Directorate

Women and Children s Directorate Women and Children s Directorate Gestational diabetes mellitus Milton Keynes Hospital NHS Foundation Trust Standing Way, Eaglestone, Milton Keynes, MK6 5LD Telephone: 01908 660033 Page 1 of 8 What is gestational

More information

F r e q u e n t l y As k e d Qu e s t i o n s

F r e q u e n t l y As k e d Qu e s t i o n s page 1 Folic Acid Q: What is folic acid? A: Folic (FOH-lik) acid is a B vitamin. It helps the body make healthy new cells. Folic acid and folate mean the same thing. Folic acid is a manmade form of folate.

More information

How healthy is your diet? Questionnaire

How healthy is your diet? Questionnaire This questionnaire is designed to allow you to assess the nutritional value of your diet. Answer yes or no to the questions below and then read the supplementary information that will help you to consider

More information


DIET AND ECZEMA IN CHILDREN DIET AND ECZEMA IN CHILDREN It has been known for many years that what children eat may have an effect on their eczema. There has been an ever-increasing interest in the part that diet plays in the development

More information

HS40. Healthy Start A guide for retailers

HS40. Healthy Start A guide for retailers HS40 Healthy Start A guide for retailers Information in this leaflet is valid from 6 April 2011 1 Welcome to Healthy Start Healthy Start is a UK-wide government scheme that helps pregnant women, new mums

More information

Your Results. For more information visit: Name: Date: In partnership with

Your Results. For more information visit: Name: Date: In partnership with Your Results Name: Date: For more information visit: In partnership with Introduction Everyone is at risk of developing diabetes, heart disease, kidney disease, stroke and

More information

Why your weight matters during pregnancy and after birth

Why your weight matters during pregnancy and after birth Information for you Published in November 2011 (next review date: 2015) Why your weight matters during pregnancy and after birth Most women who are overweight have a straightforward pregnancy and birth

More information

Eat Smart! Follow the. Healthy Eating. Food Pyramid!

Eat Smart! Follow the. Healthy Eating. Food Pyramid! Eat Smart! Follow the Healthy Eating Food Pyramid! Food contains various types of nutrients to keep us healthy. For the sake of health, the nutritional value, functions, freshness and hygiene condition

More information

Eat well, A healthy diet during pregnancy is essential for both the mother and the baby. Nutrients and benefits

Eat well, A healthy diet during pregnancy is essential for both the mother and the baby. Nutrients and benefits Eat well, mum Nutrition 11 ating well should start even before you plan for a baby and this should be maintained throughout your pregnancy. Good nutrition safeguards your health during pregnancy and ensures

More information

Question 1: How many meals do you typically eat in one day? Question 2: How many times do you typically eat BETWEEN meals (snack) in one day?

Question 1: How many meals do you typically eat in one day? Question 2: How many times do you typically eat BETWEEN meals (snack) in one day? Eating Habits - Questions list Introduction: Eating habits affect your health and risk for certain diseases. Of course, when and what you eat is complicated, and influenced by psychological, social, and

More information

Homework Help Heart Disease & Stroke

Homework Help Heart Disease & Stroke Preventing Heart Disease & Stroke What causes heart disease and stroke? high blood pressure high cholesterol diabetes smoking stress drinking too much alcohol not being physically active being overweight

More information

Insulin Dependent Diabetes Trust

Insulin Dependent Diabetes Trust Insulin Dependent Diabetes Trust Type 2 and You April 2010 Registered Company Number 3148360 Registered Charity No 1058284 Welcome to the third issue of Type 2 and You. In this issue we look at healthy

More information

Health visiting programme external webinar. 21 st November 2014 09.00-10.00. Health Visiting Week of Action: Get involved! #HVPWofAction #PHPCYPWeek

Health visiting programme external webinar. 21 st November 2014 09.00-10.00. Health Visiting Week of Action: Get involved! #HVPWofAction #PHPCYPWeek Health visiting programme external webinar 21 st November 2014 09.00-10.00 Health Visiting Week of Action: Get involved! #HVPWofAction #PHPCYPWeek Health Visiting Programme Team Sabrina Fuller- Head of

More information

Revised standards for school food

Revised standards for school food Revised standards for school food 1 This presentation covers: Why we have standards for school food School Food Plan: outcome of review and recommendations School Food Plan Standards Pilot: aim, sample

More information

Teaching Manual for the Dietary Guideline Placemats

Teaching Manual for the Dietary Guideline Placemats Teaching Manual for the Dietary Guideline Placemats 1 Lesson #1: The Placemat Description: This lesson will provide an overview of the purpose and message behind the placemats. Things to bring to the lesson:

More information

Position Statement on Breastfeeding

Position Statement on Breastfeeding ABN 64 005 081 523 RTO 21659 Applies to All ABA staff and volunteers Position statement The Australian Breastfeeding Association (ABA) endorses the following statement from the Joint WHO/ UNICEF Meeting

More information

Self-care guide for people with diabetes

Self-care guide for people with diabetes Self-care guide for people with diabetes English Version Supported by an unrestricted grant from 1 When the diagnosis is diabetes..................03 What is diabetes?............................04 What

More information


REDUCING YOUR RISK OF BREAST CANCER REDUCING YOUR RISK OF BREAST CANCER Breast cancer is the most common cancer in the UK. One in eight women develop the disease at some stage in their lifetimes. Breast cancer is rare in men, with around

More information

Vitamin D. Why Vitamin D is important and how to get enough

Vitamin D. Why Vitamin D is important and how to get enough Vitamin D Why Vitamin D is important and how to get enough Why is vitamin D vital for health? Vitamin D is needed by the body for both physical and mental health, but is best known for making sure bones

More information

Is there a baby in your future? Plan for it.

Is there a baby in your future? Plan for it. Is there a baby in your future? Plan for it. You plan for school, work, holidays and even your retirement. What about your baby? Parenting begins long before your baby is conceived. Babies begin to develop

More information

Diet and Arthritis. Dr Áine O Connor Nutrition Scientist. British Nutrition Foundation. 2011 The British Nutrition Foundation

Diet and Arthritis. Dr Áine O Connor Nutrition Scientist. British Nutrition Foundation. 2011 The British Nutrition Foundation Diet and Arthritis Dr Áine O Connor Nutrition Scientist British Nutrition Foundation Outline Background What is arthritis? What are the common forms? Body weight and arthritis Diet and arthritis Nutrients

More information

How to eat well for good health

How to eat well for good health eat well for is about how to make good food choices for a healthy balanced diet. It describes the different at different stages of life and discusses the importance of developing good dietary practices

More information

Taking a statin to reduce the risk of coronary heart disease and stroke

Taking a statin to reduce the risk of coronary heart disease and stroke Patient decision aid Taking a statin to reduce the risk of coronary heart disease and stroke Published:

More information

Improving Maternal and Infant Nutrition: A Framework for Action

Improving Maternal and Infant Nutrition: A Framework for Action Improving Maternal and Infant Nutrition: A Framework for Action January 2011 Improving Maternal and Infant Nutrition: A Framework for Action January 2011 The Scottish Government, Edinburgh 2011 Crown copyright

More information