Delivering a Healthy Start for pregnant women, new mums, babies and young children
|
|
- Esther Morgan
- 8 years ago
- Views:
Transcription
1 HS52A Delivering a Healthy Start for pregnant women, new mums, babies and young children Read more A guide for health professionals /13
2 Contents What is Healthy Start? Who qualifies? What do Healthy Start beneficiaries receive? What beneficiaries can spend Healthy Start vouchers on Healthy Start: recommendations and evidence What to do next Who can give out the application leaflet? Nutrition, health and inequality:healthinequalities;howhealthy Startgivesyoutheopportunitytohelpdisadvantagedwomen;Therole ofhealthprofessionalsiscrucial Nutrition in pregnancy:obesityandpregnancy;whatpregnant womenshouldeat...andcutdownon;healthysnackstorecommend; Foodstoavoidduringpregnancy;Caffeine;Physicalactivity Dangers in pregnancy:toxoplasmosis;smoking;alcoholand pregnancy;breastfeedingandalcohol;illegaldrugs Healthy Start vitamins for pregnant women and breastfeeding mothers:howhealthystartbeneficiariesclaimtheirfreevitamins; What sinhealthystartvitaminsforwomen? The early postnatal period:breastfeeding;maintainingahealthydiet; Infantformulamilk;Follow-onformulas;Non-milk-basedformulas Nutrition for growing babies:whentostartintroducingsolidfoods; Adviceformotherswhochoosetointroducesolidfoodsbeforesix months;vegetarianbabies;foodstoavoid;milk;otherdrinks;food allergies;peanutsandallergiesinthefamily Nutrition for young children:everydayeating;fat;ricedrink; Fussyeaters;Childrenoverfive;Vegetarianandveganchildren;Iron. Vitamin supplements for children Find out more:healthystartresources General resources Breastfeeding organisations References 2 / 3
3 Welcome ThisHealthyStartguidehasbeencreatedtoassisthealthprofessionals insignpostingtheschemeandgivingnutritionaladvicetoapplicants andbeneficiaries.italsosummarisesthecorehealthadvicefor pregnantwomenandyoungchildrenasagreedbythefouruk HealthDepartments:England,NorthernIreland,ScotlandandWales. What is Healthy Start? Healthy Start is a UK-wide government scheme which aims to improve the health of pregnant women and families on benefits or low incomes. Beneficiariesaresentvouchersthatcanbeusedtobuyliquidcow s milk,plainfreshorfrozenfruitandvegetables,andinfantformulamilk, pluscouponsthatcanbeexchangedforfreevitamins(forpregnant women,newmumsandchildren). Ongoingnutritionandhealthinformationrelevanttotheageoftheir oldestchildissentwiththevoucherstoreinforcethescheme srole asapublichealthmeasureandtohelpbeneficiariesmakethemost ofthescheme. HealthyStartisalsoagreatopportunityforallhealthprofessionalsand othersworkingwithpregnantwomenandyoungfamiliestoprovide encouragement,informationandsupportaboutsubjectssuchashealthy eating,breastfeeding,vitaminsupplementsandnutritionforpregnant women,newmums,babiesandyoungchildren. TheHealthyStartapplicationformhastobesupportedbyahealth professional(usuallyamidwifeorhealthvisitor,butitcanbeany registerednurseordoctor),soitalsoencourageslow-incomewomen andfamiliestomakecontactwithlocalhealthservices.
4 Who qualifies? Women more than 10 weeks pregnant, and families with children under four years old, qualify for Healthy Start if the family is receiving: IncomeSupport,or Income-basedJobseeker sallowance,or Income-relatedEmploymentandSupportAllowance,or ChildTaxCredit(butnotWorkingTaxCreditunlessthefamilyis receivingworkingtaxcreditrun-ononly*)andanannualfamily incomeof 16,190orlessin2012/13. Womenalsoqualifyforthewholeoftheirpregnancyiftheyareunder 18whentheyapply,eveniftheydon tgetanyoftheabovebenefits ortaxcredits. * WorkingTaxCreditrun-onistheWorkingTaxCreditreceivedinthefourweeksimmediately afterapersonhasstoppedworkingfor16hoursormoreperweek. 4 / 5
5 What do Healthy Start beneficiaries receive? Healthy Start vouchers Pregnantwomenreceiveone voucheraweekworth Babiesundertheageofoneget twovouchersaweekwortha totalof Eachchildagedoveroneand underfourreceivesonevoucher aweekworth Vouchersarepostedouteveryfourweeks.Theycanbespentinawide rangeofparticipatinglocalshopsandgreengrocersaswellassupermarkets. Foralistofshopsbypostcode,visitwww.healthystart.nhs.ukanduse thepostcodecheckertofindlocalshops. Healthy Start vitamin coupons Everyeightweeksbeneficiariesalsoreceivevitamincoupons,which theycanexchangeforvitaminsintheirlocalarea.theircouponswillbe validforwomen stabletsand/orchildren sdrops,dependingontheir circumstances. Trustsandboardsmustensurethatarrangementsareinplacetosupply bothkindsofvitaminsupplements.maternityunitscanalsosupplythem iftheywish.moreinformationonhowtoordervitaminsandreclaimthe costofthosegivenoutthroughtheschemeisavailableonthehealthy Startwebsitewww.healthystart.nhs.uk
6 What beneficiaries can spend Healthy Start vouchers on HealthyStartvoucherscanbeacceptedaspaymentorpartpaymentfor milk, plain fresh or frozen fruit and vegetables,andinfant formula milk.therearemoredetailsbelow. Milk Plaincow smilk whole,semi-skimmedorskimmed.itcanbe pasteurised,sterilised,long-lifeoruht. Beneficiariescan tspendtheirvouchersonflavouredmilk,colouredmilk, evaporatedmilk,condensedmilk,goat smilk,soyamilkorpowdered milk exceptinfantformulamilk. Plain fresh or frozen fruit and veg Anykindofplainfreshorfrozenfruitorvegetables,wholeor chopped,packagedorloose. Beneficiariescan tspendtheirvouchersonanyfreshorfrozenfruitandveg whichhasaddedsalt,fat,sugaroranyotheringredient.theyalsocan tspend themonpre-cooked,driedortinnedfruitandvegetables,fruitjuiceorsmoothies. Infant formula milk Infantformulamilkthatsaysonthepacketitcanbeusedfrombirth. Beneficiariescan tspendtheirvouchersoninfantformulasthataren t basedoncow smilk,suchassoyaformula.theyalsocan tspendthem onfollow-onformulasthataremadeforbabiesagedsixmonthsorolder. 6 / 7
7
8 Healthy Start Recommendations and evidence Healthy Start replaced the means-tested elements of the Welfare Food Scheme throughout the UK in Proposals for reform of the previous scheme were based on recommendations made by the Committee on Medical Aspects of Food and Nutrition Policy (COMA) (DH 2002). The National Institute for Health and Clinical Excellence (NICE) has a number of recommendations for health professionals working with women and young children that relate to Healthy Start. You can see them in full at They include: For pregnant women or those who may become pregnant Advisethemtotakeasupplementcontaining400micrograms(mcg) offolicaciddailypre-conceptionanduptothe12thweekofpregnancy; alsoprovideadviceonsuitablevitaminsupplementssuchashealthystart vitaminsforwomenandadvisethemtoeatfoodsrichinfolateandfolic acid. EnsurethateligiblewomenreceiveaHealthyStartapplicationleaflet (HS01)assoonaspossibleinpregnancy. ForwomenreceivingHealthyStartvouchers,providepracticaladviceon howtoincreasetheirintakeoffruitandvegetables. Duringthebookingappointment,offeradviceandinformationtoall womenaboutthebenefitsoftakingvitamindduringpregnancyand whilebreastfeedingandadvisethemofasuitablesupplementsuchas HealthyStartvitaminsforwomen;checkthatwomenatthegreatestrisk ofvitaminddeficiency(thosewhoarenotexposedtomuchsun,for examplethosewhocoveruptheirskinforculturalreasonsandpeople withdarkerskin,suchaspeopleofafrican-caribbeanandsouthasian origin)arefollowingtheadvice. 8 / 9
9 For mums and babies AdvisemothersaboutsuitablevitaminDsupplementssuchasHealthy Startvitaminsforwomen;checkthatwomenatthegreatestriskof deficiency(asbefore)arefollowingtheadvice. ForwomenreceivingHealthyStartvouchers,providepracticaladvice onhowtoincreasetheirintakeoffruitandvegetables. For families and carers of babies over six months and pre-school children OfferHealthyStartvitamindrops(A,CandD)toallchildrenaged fromsixmonthstotheirfourthbirthday,whoarehavinglessthan 500ml(apint)ofinfantformulaadayandwhosefamiliesareeligible forhealthystart. Provideparentsandcarerswithpracticaladviceonhowtheycan introducebabiestoavarietyofsolidfoods. AswellastheNICEguidance,theNational Service Framework for Children, Young People and Maternity Services(DH2004)statesthat maternityserviceprovidersshouldensurethatallpregnantwomenare offeredclearinformationontheavailabilityofhealthystart.
10 The Scientific Advisory Committee on Nutrition (SACN) has made a number of recommendations: In1991theCommitteeonMedicalAspectsofFoodandNutritionPolicy (COMA SACN spredecessor)recommendedthatcertainat-risk individuals,orgroupsatriskofvitaminddeficiency,shouldtake supplementsof7 10mcgofvitaminDdaily(DH1991).TheChiefMedical Officer(CMO)subsequentlyendorsedtheserecommendationsfor vulnerablegroupsin2005(cmo2005).comahadalsorecommended thatallchildrenagedonetofiveyearsshouldbegivenasupplement containingvitaminsa,candd(dh1994),andtheukhealth Departmentshavesincerecommendedthatallchildrenhavesupplements fromsixmonthsuntilfiveyearsofageunlesstheyaregettingmorethan 500mlofinfantformulaaday. In2007,SACNspecificallyreiteratedCOMA soriginalrecommendations onvitamindinitspositionstatementupdate on Vitamin D(SACN2007), recommendingthatallpregnantandbreastfeedingwomenshouldtake adailysupplementofvitamindinordertoensurethattheirown requirementforvitamindismetandtobuildadequatefetalstores forearlyinfancy,andallyoungchildrenshouldbegivenavitamind supplementuntilfiveyearsofageaspreviouslyrecommendedbycoma. NICE(2008)hasalsohighlightedtheimportanceofvitaminD supplementsforpregnantandbreastfeedingwomen. 10 / 11
11 SACNhasalsorecommendedthatallwomenwhocouldbecome pregnantshouldtake400mcgoffolicaciddailyasamedicinalorfood supplementpriortoconceptionanduntilthe12thweekofpregnancy. Womenwithahistoryofneuraltubedefect(NTD)affectedpregnancyare advisedtotake5mgperdaypriortoconceptionanduntilthe12thweek ofpregnancy(sacn2006). Intheirreviewofthekeyfindingsfromthe2005InfantFeedingSurvey, SACNincludedthefollowingrecommendations: Increasetheawarenessofbreastfeedingamongyoungandlow-income mothersbydiscussinginfantfeedingduringpregnancyandproviding supportintacklingpracticalbarrierstobreastfeeding.theprofileof HealthyStartshouldberaisedandhealthprofessionals,atevery opportunity,shouldofferpracticalsupportandadvicetothoseeligible forthescheme(sacn2008b,paragraph125). Inequalitiesinaccesstoantenatalandpostnatalcareareapparent. Identifyingsub-groupsofwomenwhodonotusematernalhealthservices iskeytoimprovingpolicyadherence.thereisaneedtomakeantenatal andpostnatalservicesmoreaccessibleforwomenfromhard-to-reach groupsandencouragethemtousetheseservicesmorefrequently.in addition,thetopicofbreastfeedingshouldberaisedwheneverpossible duringantenatalconsultationsandencouragementshouldbegivento thoseleastlikelytobreastfeed(sacn2008b,paragraph128).
12 What to do next FindouthowHealthyStartvitaminsaredistributedbyyourtrustor boardandroutinelytellpregnantwomenandfamiliesonthescheme aboutthevitamins,whythey reimportantandhowtogetthem. OrderHealthyStartapplicationleaflets(HS01)andotherresourcesat MakesureHealthyStartisembeddedinyourlocalpoliciestopromote breastfeedingandhealthyeating. UseHealthyStartasanopportunitytosignpostlocalinitiativesfor pregnantwomenandyoungfamilies. VisittheHealthyStartwebsitewww.healthystart.nhs.ukformore informationabouttheschemeandyourrole,andtoviewtheinformation thatissentdirectlytobeneficiarieswiththeirvouchers. 12 / 13
13 Who can give out the application leaflet? Anyonecanorderbulksuppliesoftheapplicationleaflet(HS01)andgive themout,butitisespeciallyimportanttomakethemavailablewherever servicesforpregnantwomenandfamiliesarebeingprovided. Anymemberofthepubliccanalsorequesttheirowncopydirectlyfrom thehealthystarthelplineon ,ordownloadthe applicationleafletfromwww.healthystart.nhs.uk Bookingandhealthandsocialcareassessmentappointmentsaregood opportunitiestoprovidetheapplicationleafletinpersonbecausepregnant womencanreceivevouchersfromthe10thweekofpregnancy.many maternityunitsincludeacopyintheirmaternityinformationpack.it salso agoodideatorecordtheuptakeofhealthystartinthewoman snotes. Countersigning the form WhensomeoneappliesforHealthyStart,aregisteredmidwife,nurseor medicalpractitionerhastocompleteandsignpartboftheapplication leaflettoconfirmtheexpecteddateofdelivery(edd)and/orthedate(s) ofbirthofanychildrenunderfouryearsold.it s important that Part B is fully completed, or the application cannot be processed. Pleasenote:healthprofessionalsaren trequiredtocheckthatan applicantisgettingthebenefitstheyclaimtobe we lldothat.nordo healthprofessionalsneedtoreportanysubsequentchangesinpeople s circumstancesoncethey reonthescheme it sthebeneficiary s responsibility.however,healthprofessionalsareaskedtoofferappropriate adviceonbreastfeedingandhealthyeatingandtoindicatethattheyhave donethisontheapplicationleaflet.it salsoagoodideatousethe opportunitytotalkaboutotherrelevantservicesandtoexplainwhy HealthyStartvitaminsareimportant.
14 Nutrition, health and inequality There s growing evidence to suggest that nutrition during pregnancy and in the early years of a child s life can help prepare them for healthy adulthood. A healthy diet can also help reduce the risk of obesity and chronic diseases such as heart disease and some cancers later in life. COMA spanelonchildandmaternalnutritionproducedascientific Review of the Welfare Food Scheme(nowHealthyStart),acknowledging thatmaternalandchildnutritionmayaffectlong-termhealthoutcomes (DH2002). SACNalsorecentlypublisheditsreportThe Influence of Maternal, Fetal and Child Nutrition on the Development of Chronic Disease in Later Life, concludingthatimprovingthenutritionalstatusofwomenofchild-bearing age,infantsandyoungchildrenhasthepotentialtoimprovethehealthof futuregenerations(sacn2011). 14 / 15
15 Health inequalities Manypeoplefollowahealthybalanceddiet,butalargenumberdon t, particularlyamongthemoredisadvantagedandvulnerableinsociety (DH2005).TheIndependent Inquiry into Inequalities in Health(Acheson1998) emphasisedtheinfluenceofpoverty,educationandpoorearlynutritionon healthinequalities.thereportrecommendedpoliciestoimprovenutrition, reducefoodpovertyandpreventchildhoodobesity.the Low Income Diet and Nutrition Survey(2007)assessedthedietaryhabitsandnutritionalstatusofthe UKlowincomepopulation.Theareasofconcernhighlightedweresimilarto thosealreadyidentifiedinthegeneralpopulation,althoughsomeweremore marked.forexample,thesurveyfoundevidenceoflowfruitandvegetable consumptionandpoornutritionalstatusforsomevitaminsandminerals, includingvitamind(nelsonetal.2007).morerecently,recommendations havebeenmadebysacninanumberofitsreportsincludingthe Nutritional Wellbeing of the British Population (SACN2008a) anditsreviewofthekey findingsfromtheinfantfeedingsurvey2005,infant Feeding Survey 2005: A commentary on infant feeding practices in the UK (SACN2008b). Women in disadvantaged groups are significantly less likely to: accessmaternityservicesearly stayintouchwithhealthservicesthroughouttheirpregnancies haveawell-balanceddiet breastfeedtheirbabies giveupsmokinginpregnancy introducesolidfoodsattherecommendedage. Women from disadvantaged, vulnerable or excluded groups including pregnant teenagers are more likely to have poorer maternal and neonatal outcomes, for example: infantmortality lowbirthweight postnataldepression.
16 How Healthy Start gives you the opportunity to help disadvantaged women Becausepregnantwomenandfamiliesneedtogettheirapplication leafletcountersignedbyahealthprofessional,theapplicationprocess offersanopportunitytoidentifythosewhoaremorelikelytobe disadvantaged,youngandlivinginvulnerablesituationsaswellasto engagewiththemandreferthemontorelevantservicesforadditional supportifrequired.forexample,awomanwhoqualifiesforhealthystart maybelesslikelytobreastfeed.asahealthprofessionalyoumaybeable todirecthertobreastfeedingeducationandsupport,peersupportand thelocalsurestartchildren scentreorfamilycentre. It sachancetodiscussbreastfeedingandnutritionandgivewomen generalhealthadviceatatimewhentheyarelikelytobemostreceptive toit.forinstance,youmightbeabletosuggestwhattheyspendtheir voucherson. TheUKHealthDepartmentsbelievethatmaternityservicesshouldbe proactiveinengagingallwomen,butparticularlythosewomenfrom disadvantagedgroupsandcommunities,earlyinpregnancyandmaintaining contactuptoandafterbirth(dh2004;welshassemblygovernment2005). SACNhasalsorecommendedthatadviceoninfantfeedingneedstobe tailoredaccordingtosocialgroup(sacn2008a).seealsopages30and31. The role of health professionals is crucial Recentresearchhasshownthattheroleofhealthprofessionalsinintroducing HealthyStartisincrediblyimportant.ParentswhoareintroducedtoHealthy Startthroughahealthprofessionalaremorelikelytoseethemselvesworking inpartnershipwithhealthystartforthebenefitoftheirchildrenasopposed toviewingtheschemesimplyasfinancialsupport(dhqualitativeresearch, October2009,unpublished). 16 / 17
17 Nutrition in pregnancy HealthyStartencouragespregnantwomenfromdisadvantagedgroups toincludemilkandavarietyoffruitandvegetablesintheirdiet.teenage girls,whohaveincreasednutritionalrequirements,areatgreaterriskof nutrientdeficienciesduringpregnancy,whichiswhyevery pregnant woman under 18 years old is eligible for Healthy Start. Healthyeatingduringpregnancyisimportantforboththehealthofthe motherandthedevelopmentandgrowthofthebaby.also,womenare mostlikelytoinfluencethedietarydecisionsofthewholefamilyandare centraltothefuturehealthyeatingoftheirchildren. Ahealthybalanceddietthatincludesatleastfiveportionsoffruitand vegetablesadaycanhelpreducetheriskofheartdiseaseandsomecancers. Obesity and pregnancy It simportantthatwomenaregivenadviceaboutweightgainduring pregnancy.there sanincreasedriskofcomplicationsiftheirbodymass index(bmi)isabove35(orlessthan18),suchasincreasedbloodpressure whichcanleadto,amongotherconditions,gestationaldiabetes. Dieticiansmaybeabletoprovidesupport. Womendon tneedto eatfortwo whenthey arepregnant.evenwith multiplepregnancies, it sthequalityandnot thequantityofthediet thatisimportant.
18 What pregnant women should eat Theeatwellplate 1 shows howmuchofeachtype offoodisneededtohavea healthy,well-balanceddiet. Plenty of fruit and vegetables(fresh,frozen,tinned,driedoraglass of100%unsweetenedfruitjuice) avariety,atleastfiveportionsaday. Plenty of starchy foods,suchaswholemealbread,potatoes,rice,pasta, chapatis,yamsandbreakfastcereals,asthemainpartofeverymeal. Some protein,suchasleanmeatandchicken,fish,eggsandpulsessuch asbeansandlentils,whicharealsogoodsourcesofiron.pleasenote: pregnantwomenshouldtrytoeatatleasttwoportionsoffishaweek, butshouldnothavemorethantwoportionsofoilyfishaweek. Plenty of fibre,whichhelpspreventconstipation it sinwholegrain bread,wholegraincereals,pasta,rice,pulsesandfruitandvegetables. Some dairy foods,includinglower-fatversionsofmilk,cheeseand yoghurt,whichcontaincalciumandarealsoagoodsourceofprotein. There are some foods that pregnant women should avoid seepage19. and cut down on Foodssuchascakesandbiscuitsbecausethey rehighinfatandsugars andcancauseunnecessaryweightgaininpregnancy. Healthy snacks to recommend instead include: Maltloaf,lower-fatyoghurts,fruit includingfresh,tinnedor100% unsweetenedfruitjuice,andsmallhandfulsofdriedfruitsuchasraisins orapricots. 18 / 19 1 DepartmentofHealthinassociationwiththeWelshGovernment, thescottishgovernmentandthefoodstandardsagencyinnorthernireland
19 Foods to avoid during pregnancy Some types of cheese:mouldripenedandblue-veinedsoft cheeses(suchasbrie,camembertordanishblue).thesemaycontain listeria,whichcancausemiscarriage,stillbirthorsevereillnessinthe newbornbaby. Pâté:alltypesofpâté,includingvegetablepâtés,astheycan containlisteria. Uncooked or undercooked ready meals,includingraworpartially cookedmeat,especiallypoultry. Raw or partially cooked eggs,toavoidtheriskofsalmonella. Raw or undercooked meat. Liver, liver products, fish liver oil supplements and supplements containing vitamin A (retinol)(seepage28). Some types of fish:pregnantwomenshouldavoideatingshark, marlinandswordfishandlimittheamountoftunatheyeattono morethantwotunasteaks(170geachraw)orfourcans(140gdrained weight)perweek;thesetypesoffishcontainhighlevelsofmercury, whichcandamagethebaby sdevelopingnervoussystem. Raw shellfish. Unpasteurised milk andproductsmadefromunpasteurisedmilk. Alcohol(seepage23). A note on peanuts Previousadvicehasbeenthatwomenmaychoosetoavoideatingpeanuts duringpregnancyandwhenbreastfeedingifthereisahistoryofallergyintheir child simmediatefamily(suchasasthma,eczema,hayfever,foodallergiesetc). Thisadvicehasnowchangedasthelatestresearchshowsthatthereisnoclear evidencethateatingpeanutsduringpregnancyandwhenbreastfeeding affectsthechancesofababydevelopingapeanutallergy.sopregnantand breastfeedingwomenarenowadvisedthattheycaneatpeanutsaspartof ahealthybalanceddietiftheychoosetoandarenotallergicthemselves.
20 Caffeine Consuminghighlevelsofcaffeine duringpregnancycanresultinbabies beingbornwithlowbirthweight, whichcanincreasetheriskofhealth problemsinlaterlife.toomuchcan alsocausemiscarriages,sopregnant womenshouldlimittheircaffeine intake. Pregnantwomenshouldhaveno morethan200mgofcaffeineper day,i.e.nomorethanapproximately twomugsofinstantcoffeeorone mugoffiltercoffeeortwomugsof teaortwocansofenergydrink. Physical activity Regularphysicalactivityisimportant forallwomenanditisrecommended thattheyhave150minutesof moderateintensityactivityaweek, suchasbriskwalking.pregnant womenshouldaimtostayasactiveas possible,bearinginmindthestageof pregnancytheyareat.iftheytake partingymclassestheyshouldmake surethattheirinstructorknowsthey arepregnantandtaketheiradviceon appropriateactivity.contactsports andthoseactivitieswithariskof fallingshouldbeavoided.women whohaven tbeenundertakingregular physicalactivitypriortotheir pregnancyshouldconsiderlow-impact exercisetheywillenjoy,suchasbrisk walking,swimmingandaqua-natal classes,whicharegentleinmovement andintensity.theyshouldbeadvised tobuildupexercisegradually,for examplein10-minutelotsthroughout theday,andtoavoidsittingforlong periodsoftime. Physical activity for children Beforetheybegintocrawl,babies shouldbeencouragedtobephysically activebyreachingandgrasping, pullingandpushing,movingtheir head,bodyandlimbsduringdaily routines,andduringsupervisedfloor play,includingtummytime.once babiescanmovearound,theyshould beencouragedtobeasactiveas possibleinasafe,supervisedand nurturingplayenvironment. Childrenwhocanwalkontheirown shouldbephysicallyactiveeveryday foratleast180minutes(3hours).this shouldbespreadthroughouttheday, indoorsoroutside.the180minutes canincludelightactivitysuchas standingup,movingaround,rolling andplaying,aswellasmoreenergetic activitylikeskipping,hopping,running andjumping.activeplay,suchas usingaclimbingframe,ridingabike, playinginwater,chasinggamesand ballgames,isthebestwayforthisage grouptobephysicallyactive. 20 / 21
21 Under5sshouldnotbeinactivefor longperiods,exceptwhenthey re asleep.watchingtv,travellingbycar, busortrainorbeingstrappedintoa buggyforlongperiodsarenotgood forachild shealthanddevelopment. There sgrowingevidencethatsuch behaviourcanincreasetheirriskof poorhealth.allchildrenunderfive whoareoverweightcanimprovetheir healthbymeetingtheseactivity guidelines.toachieveandmaintaina healthyweight,theymayneedtodo additionalactivityandmakechanges totheirdiet. Dangers in pregnancy Toxoplasmosis This infection is rare but can have serious consequences. Pregnant women should reduce the risks of contracting toxoplasmosis by: washingfruit,vegetablesandsaladbeforeeating washinghandsbeforehandlingfood washingallsurfacesandutensils washinghandsafterpreparingrawmeat thoroughlycookingrawmeat heatingready-preparedmealsuntiltheyarepipinghotallthe waythrough keepingleftoverscoveredinthefridgeandusingthemwithintwodays avoidingcontaminationwithcatfaecesinthecatlittertrayorsoil they shouldasksomeoneelsetotakecareofit,oratleastweargloves avoidingcontactwithabortedlambs,newbornlambsandafterbirth nothelpingwithlambingormilkingewes. Formoreinformationvisit:
22 Smoking Everytimeawomansmokesduringpregnancyitincreasestheriskof miscarriage,prematurebirth,lowbirthweightandstillbirth.italsotrebles theriskofcotdeathandcanleadtochildrendevelopingasthmaand respiratoryinfectionsinlaterlife. Youshouldaskpregnantwomenwhattheirsmokingstatusis,advise themofthehealthbenefitsofstoppingsmokingandthenprovidethem withinformationandsupporttohelpthemquit,includingreferraltotheir localstopsmokingservice. Asmokefreehomeisbestforpregnantwomen,babiesandyoung childrenasexposuretosecondhandsmokecanbeharmful.youshould providefamilieswithpracticaladviceabouthowtheycancreate asmokefreehome. If women want additional help or advice to stop smoking in pregnancy, direct them to: NHSPregnancySmokingHelpline (England) Smokeline(Scotland) StopSmokingWales SmokersHelpline(Wales) (NorthernIreland) 22 / 23
23 Alcohol and pregnancy Alcoholcanbeharmfultothedevelopingbabyandmayleadtoearly miscarriage.heavydrinkingisparticularlyrisky.itisadvisedthatpregnant womenorwomentryingtoconceiveshouldavoiddrinkingalcohol. Iftheydochoosetodrink,tominimisetherisktothebabytheyshouldnot drinkmorethanoneortwounitsonceortwiceaweek andshouldnotget drunk.additionally,nicerecommendsthatwomenshouldavoidalcoholinthe firstthreemonthsinparticular,becauseoftheincreasedriskofmiscarriage. Oneunitofalcohol=asingle (25ml)measureofspiritsat40% ABV(alcoholbyvolume),half apintofbeerat3.5%abv, orhalfa175mlglassofwineat 11.5%ABV.Largerorstronger drinksthanthesewouldcontain morethanoneunitofalcohol. Itcanbeparticularlyeasyto underestimateunitswhendrinks arepouredathome. Formoreadviceonalcohol andunitinformationvisit Orcall: Drinkline Drinkline(Scotland) Breastfeeding and alcohol Alcoholcanpassthroughthemother s milktobreastfedbabiesinverysmall amounts.itisunlikelythathavingan occasionaldrinkwillharmthemother orbaby,butitmightaffecthoweasily thebabyfeeds.breastfeedingwomen shouldbeadvisedtodrinkverylittle,for examplenomorethanoneortwounits onceortwiceaweek.ifabreastfeeding womanintendstodrinkmorethanthis, theycanexpressmilkinadvance. Ifabreastfeedingmotherdrinks alcoholbeforefeeding,itcanaffect thebabyinanumberofways: Themilkmaysmelldifferentandthe babymaynotfeedaswellasnormal. Thebabymaysleeplesswellfor somehoursafterfeeding. Itisnotadvisableforwomentoshare abedorasofawiththeirbabyif theyhavebeendrinking.ifthey sleepheavilytheycouldputtheir babyatrisk.
24 Illegal drugs Useofillegaldrugscanbeharmfultobothmotherandbaby.Women whomaygetpregnant,whoarepregnantorwhoarebreastfeeding shouldnormallyaimtobecompletelydrugfree.however,regulardaily usersofsomeillegaldrugsassociatedwithwithdrawalproblemsshould notstopusingabruptlywithoutseekingadvice. Mostnon-dependentdruguserswillcertainlybeabletostopusingillegal drugsontheirownwithlittleornodifficulty.forthosewomenwhoneedit, primarycareandspecialistdrugsservices canprovideadviceandsupportabout quitting.nicehasproducedguidance onthecarethatpregnantwomenwith complexsocialfactors,includingthose misusingdrugs,shouldreceive Womenatriskofdevelopingmarked withdrawalsymptoms,particularlydaily usersofdepressantdrugssuchas opiatesorbenzodiazepines,should obtainveryearlymedicaladvicebefore makinganylargeorabruptreductions intheirdruguse.whenmedically supportedwithdrawalisneeded,this Confidential advice for drug users FRANK(UK-wide) KnowtheScore(Scotland) DAN24/7(Wales) canthenbeproperlyplannedtobeassafeaspossibleforbothmother andbaby.somewomenwithmarkedheroindependencedoneedtostay onsomesubstitutemedicationthroughoutthefirsttrimester,andfor someforthewholepregnancy. 24 / 25
25 Healthy Start vitamins for pregnant women and breastfeeding mothers Women in families supported by Healthy Start can claim free vitamins while they re pregnant and up to their baby s first birthday. They re sent a coupon every eight weeks that can be exchanged for Healthy Start women s vitamin tablets. It simportantthatwomengetallthevitaminsandmineralsthey needforthemselvesandtheirgrowingbabywhilethey repregnant andbreastfeeding.therearecertainsupplementstheyshouldtakewhich willhelppreventthemfrombecomingdeficient. How Healthy Start beneficiaries claim their free vitamins EachNHSorganisationorboardisresponsiblefordistributingvitamins locally.somemayalsochoosetosellorsupplythemfreeofcharge towomenandchildrenwhoarenoteligibleforhealthystart.formore informationaboutvitamindistributionineachukcountry,visit Beneficiariesreceiveavitamincouponandareadvisedtoasktheir midwife,healthvisitororpublichealthnurseaboutwheretheycan usethecoupon,andtotakeitwiththemtocollecttheirvitamins. So it s essential that health professionals know what the local arrangements are.
26 What s in Healthy Start vitamins for women? Healthy Start vitamins for women contain folic acid, vitamin D and vitamin C. Here s why they re important for pregnant women and new mums. Folic acid Taking400mcg(0.4milligrams)offolicacidperdaybothbeforeandup untilthe12thweekofpregnancycanhelppreventntdssuchasspina bifida,wherethespinedoesn tdevelopproperlyinunbornbabies. Eveniffolicacidisn ttakenbeforeconception,it sworthstartingassoon asthewomanisawareofthepregnancy,anditshouldcontinuetobe takenuntilthe12thweekofpregnancy.folate,thenaturalformoffolic acid,canbefoundinpeas,potatoes,broccoli,orangejuice,brussels sprouts,asparagus,black-eyedbeans,spinachandkale,andit simportant forpregnantwomentoeatplentyofthesefoods.however,it svery difficulttomeetthisincreasedrequirementoffolatefromfoodalone. Therefore,takingfolicacidsupplementsisimportantwhentryingtoget pregnantandintheearlystagesofpregnancy. IfamotherhasalreadyhadapregnancyaffectedbyanNTDorhas diabetesoristakinganti-epilepticmedicines,sheisadvisedtoseek medicaladvicefromhergp. Recommendation: all women who are trying to get pregnant or who are pregnant should take 400mcg of folic acid each day up until they are 12 weeks pregnant. Women who have already had a pregnancy affected by an NTD need to take 5mg of folic acid each day until the 12th week of their pregnancy. In addition, women who have diabetes and those taking anti-epileptic medicines should consult their GP for advice as they will need to take a higher dose of folic acid. (AsrecommendedbyCOMA (2000),SACN(2006)andNICE(2008).) 26 / 27
Delivering a Healthy Start for pregnant women, new mums, babies and young children
HS52A Delivering a Healthy Start for pregnant women, new mums, babies and young children Read more A guide for health professionals www.healthystart.nhs.uk 1 Contents What is Healthy Start? Who qualifies?
More informationHS58A. Healthy Start vitamins and why you need them
HS58A Healthy Start vitamins and why you need them Folic acid Taking a folic acid supplement before you re pregnant and until the 12th week of your pregnancy is really important because it reduces the
More informationInfant Feeding Survey 2010: Summary
Infant Feeding Survey 2010: Summary Authors: Fiona McAndrew, Jane Thompson, Lydia Fellows, Alice Large, Mark Speed and Mary J. Renfrew A survey carried out on behalf of the Health and Social Care Information
More informationProtecting and improving the nation s health. Vitamin D. Information for healthcare professionals
Protecting and improving the nation s health Vitamin D Information for healthcare professionals 1 Vitamin D: Information for healthcare professionals Why is vitamin D important? Some of the UK population
More informationVitamin supplements and you
Vitamin supplements and you Guidance for pregnant or breastfeeding women, babies and young children Health Improvement About this leaflet Vitamins are really important they are essential nutrients that
More informationDiet, activity and your risk of prostate cancer
Diet, activity and your risk of prostate cancer Prostate cancer is the most common cancer in men in the UK. About one in eight men (12.5 per cent) will get prostate cancer at some point in their lives.
More informationsimple steps give you for good bowel health
simple steps give you for good bowel health This booklet contains simple steps you can take to help achieve good bowel health. This is important to everyone, as these small changes will help your digestive
More informationWhat can happen if you have low iron levels?
Iron in your diet Iron in your diet Why is iron important? Iron is important because it helps your body to make haemoglobin. Haemoglobin, or Hb, is the protein found in red blood cells that carries oxygen
More informationFACTSHEET. Weaning your baby
FACTSHEET Weaning your baby This factsheet gives you information on introducing your baby to solid food. It covers: The recommendation for exclusive breastfeeding for the first 6 months The introduction
More informationCHILD CARE DIPLOMA. Course Sample
CHILD CARE DIPLOMA Course Sample Unit CHP2 Providing for children s physical needs inclusive of health and safety The Statutory framework for the EYFS is a requirement for all registered early years providers.
More informationMaternal and child nutrition
Maternal and child nutrition Issued: March 2008 last modified: November 2014 NICE public health guidance 11 guidance.nice.org.uk/ph11 NICE 2008 Contents Introduction... 6 1 Key priorities... 7 Healthy
More informationWeaning learning to like new tastes and textures
Complementary feeding or weaning is introducing solid foods in addition to your baby s milk feeds. Babies develop at different rates so begin when your baby is ready by six months, but not before four
More informationWeaning. Starting solid food
Weaning Starting solid food What is weaning? The information in this leaflet will help you wean your baby onto solid foods. Your baby s development from breast or formula milk feeding to sharing in the
More informationThe meaning of. When is it best to start?
1 2 The meaning of When is it best to start? There comes a time when a baby needs more nourishment than breast milk or infant formula alone can provide. Government guidelines strongly encourage mothers
More informationyour eatwell Feeding your baby in the first year eatwell.gov.uk
baby your Feeding your baby in the first year eatwell eatwell.gov.uk This booklet gives practical advice about feeding your baby. It takes you from the early months when your baby is fed only with breast
More informationHealthy Eating During Pregnancy
Healthy Eating During Pregnancy Pregnancy is a time of great change. Your body is changing to allow your baby to grow and develop. Good nutrition will help you meet the extra demands of pregnancy while
More informationNutrition: a guide for feeding infants with cystic fibrosis
Nutrition: a guide for feeding infants with cystic fibrosis Factsheet April 2013 Nutrition: a guide for feeding infants with cystic fibrosis Introduction Feeding a baby with cystic fibrosis (CF) is similar
More informationNutrition Requirements
Who is responsible for setting nutrition requirements in the UK? In the UK we have a set of Dietary Reference Values (DRVs). DRVs are a series of estimates of the energy and nutritional requirements of
More informationHow has your view of healthy eating changed during pregnancy? B Y A T H A R K H A L I D A N D D A F I N A N I S H O R I
How has your view of healthy eating changed during pregnancy? B Y A T H A R K H A L I D A N D D A F I N A N I S H O R I Hypothesis Decisions based on eating choices would shift towards the healthy alternative
More informationNutrition Information from My Plate Guidelines
Nutrition Information from My Plate Guidelines Note: This information was compiled from the website: http://www.choosemyplate.gov/ for participants in the 4-H Food Prep Contest 1/12/16. The information
More informationCalcium and Vitamin D: Important at Every Age
Calcium and Vitamin D: Important at Every Age National Institutes of Health Osteoporosis and Related Bone Diseases ~ National Resource Center 2 AMS Circle Bethesda, MD 20892-3676 Tel: (800) 624-BONE or
More informationSection C. Diet, Food Production, and Public Health
This work is licensed under a Creative Commons Attribution-NonCommercial-ShareAlike License. Your use of this material constitutes acceptance of that license and the conditions of use of materials on this
More informationThe meaning of. When is it best to start?
1 2 The meaning of When is it best to start? There comes a time when a baby needs more nourishment than breast or infant alone can provide. Government guidelines strongly encourage mothers to breast-feed
More informationIntroduction to WIC. Objectives
Objectives Introduction to WIC After completing this lesson, you will be able to: Describe the participants served by WIC. Describe how WIC improves the health of participants. Identify the history and
More informationINFANTS AND YOUNG CHILD FEEDING (UPTO 2 YEARS)
INFANTS AND YOUNG CHILD FEEDING (UPTO 2 YEARS) Breastfeeding is the best way to satisfy the nutritional and psychological needs of the baby. Mother s milk (breast milk, human milk) contains all nutrients
More informationPreconception Care: Things to Do before You Become Pregnant
Preconception Care: Things to Do before You Become Pregnant Planning a pregnancy with someone that you love can be exciting and rewarding. There are many things for you and your partner to consider before
More informationIf a child or adult needs to avoid cows milk, remember that it may be present in many foods, such as:
Milk Allergy Cows milk allergy affects around 3 6% of (3 6 in every 100) infants and young children who usually start to have symptoms in their first few months. This causes many health problems and is
More informationNutrient Reference Values for Australia and New Zealand
Nutrient Reference Values for Australia and New Zealand Questions and Answers 1. What are Nutrient Reference Values? The Nutrient Reference Values outline the levels of intake of essential nutrients considered,
More informationOff to the best start. Important information about feeding your baby
Off to the best start Important information about feeding your baby mum s milk the best start for your baby What happens in your baby s first years has a big effect on how healthy he or she will be in
More informationCENTRAL SURREY HEALTH BREASTFEEDING POLICY
CENTRAL SURREY HEALTH BREASTFEEDING POLICY PRINCIPLES To ensure that all children receive a chance to grow and develop to their fullest potential, it is not enough simply to make breastfeeding possible;
More informationDIABETES & HEALTHY EATING
DIABETES & HEALTHY EATING Food gives you the energy you need for healthy living. Your body changes most of the food you eat into a sugar called glucose. (glucose) Insulin helps your cells get the sugar
More informationPERINATAL NUTRITION. Nutrition during pregnancy and lactation. Nutrition during infancy.
PERINATAL NUTRITION Nutrition during pregnancy and lactation Nutrition during infancy. Rama Bhat, MD. Department of Pediatrics, University of Illinois Hospital Chicago, Illinois. Nutrition During Pregnancy
More informationMaking Healthy Food Choices. Section 2: Module 5
Making Healthy Food Choices Section 2: Module 5 1 Nutrition For Health What is healthy Tips on planning meals Making a shopping list/ Bulk orders Using WIC foods Cook and freeze What foods to choose How
More informationCORPORATE HEALTH LOWERING YOUR CHOLESTEROL & BLOOD PRESSURE
CORPORATE HEALTH LOWERING YOUR CHOLESTEROL & BLOOD PRESSURE What is Cholesterol? What s wrong with having high cholesterol? Major risk factor for cardiovascular disease Higher the cholesterol higher the
More informationIntroducing Solid Foods. Giving your baby a better start in life
Introducing Solid Foods Giving your baby a better start in life Starting your baby on solids Often called weaning, introducing solid foods should start when your baby is around 6 months old. Gradually,
More informationThe Bronx Health Link
Monthly Newsletter The Bronx Health Link MARCH 2007 Gestational Diabetes Y ou are 28 weeks pregnant. Your health care provider has just told you that you have gestational (ges-tay-shun-all) diabetes. Should
More informationHealthy eating for breastfeeding mothers
Healthy eating for breastfeeding mothers Healthy eating is important when you are breastfeeding. Your body has a greater need for most nutrients. Some of the extra energy required for breastfeeding comes
More informationPresentation Prepared By: Jessica Rivers, BASc., PTS
Presentation Prepared By: Jessica Rivers, BASc., PTS Presentation Outline Why should we care about our eating habits? Why is nutrition so important as we age? How do we know if we are eating healthy? What
More informationF r e q u e n t l y As k e d Qu e s t i o n s
page 1 Folic Acid Q: What is folic acid? A: Folic (FOH-lik) acid is a B vitamin. It helps the body make healthy new cells. Folic acid and folate mean the same thing. Folic acid is a manmade form of folate.
More informationWomen and Children s Directorate
Women and Children s Directorate Gestational diabetes mellitus Milton Keynes Hospital NHS Foundation Trust Standing Way, Eaglestone, Milton Keynes, MK6 5LD Telephone: 01908 660033 Page 1 of 8 What is gestational
More informationHS40. Healthy Start A guide for retailers
HS40 Healthy Start A guide for retailers Information in this leaflet is valid from 6 April 2011 1 Welcome to Healthy Start Healthy Start is a UK-wide government scheme that helps pregnant women, new mums
More informationhealthy eating for gestational diabetes
Talking diabetes No.19 healthy eating for gestational diabetes Gestational diabetes occurs in 5 8% of Australian women during pregnancy. It happens because the changing hormone levels in the body have
More informationDIET AND ECZEMA IN CHILDREN
DIET AND ECZEMA IN CHILDREN It has been known for many years that what children eat may have an effect on their eczema. There has been an ever-increasing interest in the part that diet plays in the development
More informationHealth visiting programme external webinar. 21 st November 2014 09.00-10.00. Health Visiting Week of Action: Get involved! #HVPWofAction #PHPCYPWeek
Health visiting programme external webinar 21 st November 2014 09.00-10.00 Health Visiting Week of Action: Get involved! #HVPWofAction #PHPCYPWeek Health Visiting Programme Team Sabrina Fuller- Head of
More informationDeciding whether to become a parent
Deciding whether to become a parent This information is an extract from the booklet, Relationships, sex and fertility for young people affected by cancer. You may find the full booklet helpful. We can
More informationPregnancy Planning. Eat a nutritious, well-balanced diet
Pregnancy Planning Your health and habits affect a baby from the earliest days of a pregnancy. Before you find out for sure that you are pregnant, a great deal has already happened. Your baby's major organs
More informationBaby Steps To A Healthy Pregnancy
Preconception Middlesex-London Health Unit 50 King Street, London, ON N6A 5L7 519-663-5317 Published 2015. Copyright of the Middlesex London Health Unit. All rights reserved. Baby Steps To A Healthy Pregnancy
More informationInsulin Dependent Diabetes Trust
Insulin Dependent Diabetes Trust Type 2 and You April 2010 Registered Company Number 3148360 Registered Charity No 1058284 Welcome to the third issue of Type 2 and You. In this issue we look at healthy
More informationFACT SHEET N 394 UPDATED MAY 2015. Healthy diet
FACT SHEET N 394 UPDATED MAY 2015 Healthy diet KEY FACTS n A healthy diet helps protect against malnutrition in all its forms, as well as noncommunicable diseases (NCDs), including diabetes, heart disease,
More informationPosition Statement on Breastfeeding
ABN 64 005 081 523 RTO 21659 Applies to All ABA staff and volunteers Position statement The Australian Breastfeeding Association (ABA) endorses the following statement from the Joint WHO/ UNICEF Meeting
More informationSelf-care guide for people with diabetes
Self-care guide for people with diabetes English Version Supported by an unrestricted grant from 1 When the diagnosis is diabetes..................03 What is diabetes?............................04 What
More informationYour Results. For more information visit: www.sutton.gov.uk/healthchecks. Name: Date: In partnership with
Your Results Name: Date: For more information visit: www.sutton.gov.uk/healthchecks In partnership with Introduction Everyone is at risk of developing diabetes, heart disease, kidney disease, stroke and
More informationIs there a baby in your future? Plan for it.
Is there a baby in your future? Plan for it. You plan for school, work, holidays and even your retirement. What about your baby? Parenting begins long before your baby is conceived. Babies begin to develop
More informationREDUCING YOUR RISK OF BREAST CANCER
REDUCING YOUR RISK OF BREAST CANCER Breast cancer is the most common cancer in the UK. One in eight women develop the disease at some stage in their lifetimes. Breast cancer is rare in men, with around
More informationHomework Help Heart Disease & Stroke
Preventing Heart Disease & Stroke What causes heart disease and stroke? high blood pressure high cholesterol diabetes smoking stress drinking too much alcohol not being physically active being overweight
More informationSave Time and Money at the Grocery Store
Save Time and Money at the Grocery Store Plan a Grocery List Making a list helps you recall items you need and also saves you time. Organize your list according to the layout of the grocery store. For
More informationWhy your weight matters during pregnancy and after birth
Information for you Published in November 2011 (next review date: 2015) Why your weight matters during pregnancy and after birth Most women who are overweight have a straightforward pregnancy and birth
More informationDiet and Arthritis. Dr Áine O Connor Nutrition Scientist. British Nutrition Foundation. 2011 The British Nutrition Foundation
Diet and Arthritis Dr Áine O Connor Nutrition Scientist British Nutrition Foundation Outline Background What is arthritis? What are the common forms? Body weight and arthritis Diet and arthritis Nutrients
More informationNutrition for Family Living
Susan Nitzke, Nutrition Specialist; susan.nitzke@ces.uwex.edu Sherry Tanumihardjo, Nutrition Specialist; sherry.tan@ces.uwex.edu Amy Rettammel, Outreach Specialist; arettamm@facstaff.wisc.edu Betsy Kelley,
More informationVitamin D. Why Vitamin D is important and how to get enough
Vitamin D Why Vitamin D is important and how to get enough Why is vitamin D vital for health? Vitamin D is needed by the body for both physical and mental health, but is best known for making sure bones
More informationFlorida Department of Health WIC Program. This institution is an equal opportunity provider. 1/2016 1
Florida Department of Health WIC Program This institution is an equal opportunity provider. 1/2016 1 EBT stands for Electronic Benefits Transfer. EBT is a simple, secure, and convenient way to buy your
More informationA healthy cholesterol. for a happy heart
A healthy cholesterol for a happy heart cholesterol A healthy cholesterol for a happy heart You probably already know that cholesterol has something to do with heart disease. But like many people, you
More informationCanada s Food Guide Jeopardy
Canada s Food Guide Jeopardy Drafted: July 2008 Revised: December 2012 Eating Well with Canada s Food Guide Veg & Fruit Grain Products Milk & Alternatives Meat & Alternatives Physical Activity Miscellaneous
More informationIt is important to know that some types of fats, like saturated and trans fat, can raise blood cholesterol levels.
Healthy Eating You are what you eat! So before you even shop for food, it is important to become a well informed, smart food consumer and have a basic understanding of what a heart healthy diet looks like.
More informationMaternal and pre-school child nutrition guidelines
Maternal and pre-school child nutrition guidelines October 2012 Table of Contents Page Acknowledgements 6 1. Introduction 7 2. Aims and Objectives 9 SECTION 1: Pre Conception and Ante Natal Nutrition 10
More informationSelection and Preparation of Foods Management of the Food Budget*
Selection and Preparation of Foods Management of the Food Budget* Healthy meals on a limited budget! How can you serve healthy meals on a limited budget? It takes some time and planning, but you and your
More informationScientific Recommendations for Healthy Eating Guidelines in Ireland
Scientific Recommendations for Healthy Eating Guidelines in Ireland 2011 Scientific Recommendations for Healthy Eating Guidelines in Ireland Published by: Food Safety Authority of Ireland Abbey Court,
More informationUnit 1.1 Support healthy lifestyles for children through the provision of food and nutrition
Theme 1: Health and well-being Unit 1.1 Support healthy lifestyles for children through the provision of food and nutrition This unit provides the learner with the knowledge, understanding and skills to
More information6 Steps to Lipo-Light and/or Lipo-Light Pro Success
6 Steps to Lipo-Light and/or Lipo-Light Pro Success Optimize your Lipo-Light and/or Lipo-Light Pro results by: 1. Maintaining youy workout regimen. If you do not workout, walk for 30 minutes each day throughout
More informationThe affordability of healthy eating for low-income households
Policy Briefing October 2009 The affordability of healthy eating for low-income households Introduction Healthy Food for All is an all-island multiagency initiative which seeks to combat food poverty by
More informationMaintaining Nutrition as We Age
SS-207-06 For more information, visit the Ohio Department of Aging web site at: http://www.goldenbuckeye.com and Ohio State University Extension s Aging in Ohio web site at: http://www.hec.ohio-state.edu/famlife/aging
More informationFood Poverty and Health
Briefing Statement Introduction In the UK, the poorer people are, the worse their diet, and the more diet-related diseases they suffer from. This is food poverty. 1 Poor diet is a risk factor for the UK
More informationDiet and haemodialysis
Diet and haemodialysis This leaflet is for patients with kidney disease who are receiving haemodialysis treatment. If you have any further questions, please contact us using the details below and on the
More information25. CONTROLLING DIABETES DURING / BEFORE PREGNANCY
Health Administrator Vol: XXII Number 1& 2-2009 : 118-122 25. CONTROLLING DIABETES DURING / BEFORE PREGNANCY Phyllis Ring Many doctors once discouraged women with diabetes from having children at all,
More informationFEEDING YOUR BABY. From Six Months to One Year. Your guide to help you introduce solid food to your baby
FEEDING YOUR BABY From Six Months to One Year Your guide to help you introduce solid food to your baby ACKNOWLEDGEMENTS The Best Start Resource Centre would like to thank the Nutrition Resource Centre
More information1. What are anti-epileptic drugs? Anti-epileptic drugs (AEDs) are prescribed to control seizures. They do not cure epilepsy.
14 FREQUENTLY ASKED QUESTIONS ON ANTI- EPILEPTIC DRUGS 1. What are anti-epileptic drugs? Anti-epileptic drugs (AEDs) are prescribed to control seizures. They do not cure epilepsy. 2. When should treatment
More informationA guide to infant formula for parents who are bottle feeding
A guide to infant formula for parents who are bottle feeding Introduction This document is designed to help parents who are not breastfeeding decide which infant formula to use to feed their baby. There
More informationDietary advice for people starting treatment for Hepatitis C. Information for patients Sheffield Dietetics
Dietary advice for people starting treatment for Hepatitis C Information for patients Sheffield Dietetics Do I need to follow a special diet? You don t need to have a special diet but you should try and
More informationHealthy Food for All. Submission on Budget 2014 to the Minister for Social Protection
Healthy Food for All Submission on Budget 2014 to the Minister for Social Protection Theme: Improve food and nutrition consumption for children and families in poverty 1. Enhance low-income household s
More informationHealthy Eating during Pregnancy and Breastfeeding
WORLD HEALTH ORGANIZATION Regional Office for Europe Nutrition and Food Security Healthy Eating during Pregnancy and Breastfeeding Booklet for mothers 2001 EUR/01 5028598 ORIGINAL: ENGLISH UNEDITED E73182
More informationBreastfeeding vs. Formula Feeding
KidsHealth.org The most-visited site devoted to children's health and development Breastfeeding vs. Formula Feeding A Personal Decision Choosing whether to breastfeed or formula feed your baby is one of
More informationEating Guidelines for Diabetes
Eating Guidleines Chronic Nutrition Fact Sheets Introduction If you have both diabetes and Chronic (CKD), it may seem that the diabetes and kidney diets don t fit well together. However, with careful planning,
More informationNHS GGC Vitamin D Supplementation Frequently asked Questions
Pharmacy & Prescribing Support Unit NHS GGC Vitamin D Supplementation Frequently asked Questions In February 2012 the Scottish Government issued advice on supplements for groups at risk of vitamin D deficiency.
More informationEven though diet can influence your risk of developing cancer, there is little evidence that special foods can be used to cure existing cancers.
Cancer and food Summary High-fat, low-fibre diets may increase the risk of many cancers including bowel, lung, prostate and uterine cancers. You can reduce your risk of developing cancer by eating a wide
More informationPhysical health & nutrition
Physical health & nutrition RET0254 Key points People with severe mental illness are at higher risk of some physical health problems, such as diabetes, heart disease, obesity and stroke. People with severe
More informationWhat s on the menu at the Ministry?
What s on the menu at the Ministry? Dr Harriette Carr Public Health Medicine Specialist Ministry of Health PREPARED BY Dr Harriette Carr, Louise McIntyre, Diana O Neill, Virginia Mills, Martin Dutton,
More informationDiabetes and stroke. What is diabetes? What are the symptoms of diabetes? Stroke Helpline: 0303 3033 100 Website: stroke.org.uk
Stroke Helpline: 0303 3033 100 Website: stroke.org.uk Diabetes and stroke Diabetes is a condition caused by too much sugar in your blood. There are over three million people in the UK who have diabetes.
More informationNutrition During Pregnancy
Nutrition During Pregnancy A balanced diet is a basic part of good health at all times in your life. During pregnancy, your diet is even more important. The foods you eat are the main source of nutrients
More informationThe Basics of Nutrition: Understanding Nutrition Facts, Servings Sizes, & Adequate Portions
The Basics of Nutrition: Understanding Nutrition Facts, Servings Sizes, & Adequate Portions K AT I E L. H O W E H E A LT H E D U C AT O R D I V I S I O N O F S T U D E N T A F FA I R S U S C U P S TAT
More informationPrenatal Programming. The Ten Principles of Prenatal Planning
THE PRENATAL PRESCRIPTION The prevailing scientific consensus is that nutritional health during pregnancy imprints us for the rest of our life, and that the chronic diseases we may experience later, either
More informationU.S. Cholesterol Guidelines and Government Food Programs
U.S. Cholesterol Guidelines and Government Food Programs Jay Hirschman, M.P.H., C.N.S. Director, Special Nutrition Staff Office of Research and Analysis Food and Nutrition Service, USDA Life Science Research
More informationCarbohydrate Counting for Patients with Diabetes. Lauren Dorman, MS RD CDE Registered Dietitian & Certified Diabetes Educator
Carbohydrate Counting for Patients with Diabetes Lauren Dorman, MS RD CDE Registered Dietitian & Certified Diabetes Educator Program Purpose To increase knowledge of carbohydrate counting skills for nurses
More informationGestational Diabetes
Gestational Diabetes DCMDP100244 Supported by an educational grant from Acknowledgements Ms. Yvonne Moloney - Diabetes Midwife Specialist Ms Sheila Bowers - Dietitian Manager Mid Western Regional Maternity
More informationHealthy Eating for people at risk of diabetes or with prediabetes
Healthy Eating for people at risk of diabetes or with prediabetes WHAT IS PREDIABETES / AT RISK OF DIABETES Some patients have a blood sugar level which is higher than normal but not high enough to be
More informationHealth Maintenance: Controlling Cholesterol
Sacramento Heart & Vascular Medical Associates February 18, 2012 500 University Ave. Sacramento, CA 95825 Page 1 What is cholesterol? Cholesterol is a fatty substance. It has both good and bad effects
More informationTackling overweight and obesity
B Tackling overweight and obesity Government action on overweight and obesity Children: healthy growth and healthy weight Promoting healthier food choices Building physical activity into our lives Creating
More informationgestational diabetes my pregnancy, my baby, and me
gestational diabetes my pregnancy, my baby, and me What is Gestational Diabetes? Gestational diabetes occurs when your body cannot make adequate use of sugar in the blood. It is first found during pregnancy.
More informationTake Control Nutrition Tools for Diabetes. 50/50 plate Portions Servings
Take Control Nutrition Tools for Diabetes 50/50 plate Portions Servings Eat more Vegetables Especially non starchy vegetables Choosing Foods to manage blood glucose Select a variety of colors and types
More informationFood Allergy Gluten & Diabetes Dr Gary Deed Mediwell 314 Old Cleveland Road Coorparoo 4151 3421 7488
Food Allergy Gluten & Diabetes Dr Gary Deed Mediwell 314 Old Cleveland Road Coorparoo 4151 3421 7488 SUMMARY Type 1 diabetes Onset common in Children Insulin requiring Immune origins with attack on the
More informationFEEDING YOUR BABY. From Six Months to One Year. Your guide to help you introduce solid food to your baby
FEEDING YOUR BABY From Six Months to One Year Your guide to help you introduce solid food to your baby ACKNOWLEDGEMENTS The Best Start Resource Centre would like to thank the Nutrition Resource Centre
More information