Delivering a Healthy Start for pregnant women, new mums, babies and young children

Size: px
Start display at page:

Download "Delivering a Healthy Start for pregnant women, new mums, babies and young children"

Transcription

1 HS52A Delivering a Healthy Start for pregnant women, new mums, babies and young children Read more A guide for health professionals 1

2 Contents What is Healthy Start? Who qualifies? What do Healthy Start beneficiaries receive? What beneficiaries can spend Healthy Start vouchers on Healthy Start: recommendations and evidence What to do next Who can give out the application leaflet? Nutrition, health and inequality:healthinequalities;howhealthy Startgivesyoutheopportunitytohelpdisadvantagedwomen;Therole ofhealthprofessionalsiscrucial Nutrition in pregnancy:obesityandpregnancy;whatpregnant womenshouldeat...andcutdownon;healthysnackstorecommend; Foodstoavoidduringpregnancy;Caffeine;Physicalactivity Dangers in pregnancy:toxoplasmosis;smoking;alcoholand pregnancy;breastfeedingandalcohol;illegaldrugs Healthy Start vitamins for pregnant women and breastfeeding mothers:howhealthystartbeneficiariesclaimtheirfreevitamins; What sinhealthystartvitaminsforwomen? The early postnatal period:breastfeeding;maintainingahealthydiet; Infantformulamilk;Follow-onformulas;Non-milk-basedformulas Nutrition for growing babies:whentostartintroducingsolidfoods; Adviceformotherswhochoosetointroducesolidfoodsbeforesix months;vegetarianbabies;foodstoavoid;milk;otherdrinks;food allergies;peanutsandallergiesinthefamily Nutrition for young children:everydayeating;fat;ricedrink; Fussyeaters;Childrenoverfive;Vegetarianandveganchildren;Iron. Vitamin supplements for children Find out more:healthystartresources General resources Breastfeeding organisations References 2 / 3

3 Welcome ThisHealthyStartguidehasbeencreatedtoassisthealthprofessionals insignpostingtheschemeandgivingnutritionaladvicetoapplicants andbeneficiaries.italsosummarisesthecorehealthadvicefor pregnantwomenandyoungchildrenasagreedbythefouruk HealthDepartments:England,NorthernIreland,ScotlandandWales. What is Healthy Start? Healthy Start is a UK-wide government scheme which aims to improve the health of pregnant women and families on benefits or low incomes. Beneficiariesaresentvouchersthatcanbeusedtobuyliquidcow s milk,plainfreshorfrozenfruitandvegetables,andinfantformulamilk, pluscouponsthatcanbeexchangedforfreevitamins(forpregnant women,newmumsandchildren). Ongoingnutritionandhealthinformationrelevanttotheageoftheir oldestchildissentwiththevoucherstoreinforcethescheme srole asapublichealthmeasureandtohelpbeneficiariesmakethemost ofthescheme. HealthyStartisalsoagreatopportunityforallhealthprofessionalsand othersworkingwithpregnantwomenandyoungfamiliestoprovide encouragement,informationandsupportaboutsubjectssuchashealthy eating,breastfeeding,vitaminsupplementsandnutritionforpregnant women,newmums,babiesandyoungchildren. TheHealthyStartapplicationformhastobesupportedbyahealth professional(usuallyamidwifeorhealthvisitor,butitcanbeany registerednurseordoctor),soitalsoencourageslow-incomewomen andfamiliestomakecontactwithlocalhealthservices.

4 Who qualifies? Women more than 10 weeks pregnant, and families with children under four years old, qualify for Healthy Start if the family is receiving: IncomeSupport,or Income-basedJobseeker sallowance,or Income-relatedEmploymentandSupportAllowance,or ChildTaxCredit(butnotWorkingTaxCreditunlessthefamilyis receivingworkingtaxcreditrun-ononly*)andanannualfamily incomeof 16,190orlessin2011/12. Womenalsoqualifyforthewholeoftheirpregnancyiftheyareunder 18whentheyapply,eveniftheydon tgetanyoftheabovebenefits ortaxcredits. * WorkingTaxCreditrun-onistheWorkingTaxCreditreceivedinthefourweeksimmediately afterapersonhasstoppedworkingfor16hoursormoreperweek. 4 / 5

5 What do Healthy Start beneficiaries receive? Healthy Start vouchers Pregnantwomenreceiveone voucheraweekworth Babiesundertheageofoneget twovouchersaweekwortha totalof Eachchildagedoveroneand underfourreceivesonevoucher aweekworth Vouchersarepostedouteveryfourweeks.Theycanbespentinawide rangeofparticipatinglocalshopsandgreengrocersaswellassupermarkets. Foralistofshopsbypostcode,visitwww.healthystart.nhs.ukanduse thepostcodecheckertofindlocalshops. Healthy Start vitamins Everyeightweeksbeneficiariesalsoreceivevitamincoupons,which theycanexchangeforvitaminsintheirlocalarea.theircouponswillbe validforeitherthewomen stabletsorchildren sdrops,dependingon thecircumstances. Trustsandboardsmustensurethatarrangementsareinplacetosupply bothkindsofvitaminsupplements.maternityunitscanalsosupplythem iftheywish.moreinformationonhowtoordervitaminsandreclaimthe costofthosegivenoutthroughtheschemeisavailableonthehealthy Startwebsitewww.healthystart.nhs.uk

6 What beneficiaries can spend Healthy Start vouchers on HealthyStartvoucherscanbeacceptedaspaymentorpartpaymentfor milk, plain fresh or frozen fruit and vegetables,andinfant formula milk.therearemoredetailsbelow. Milk Plaincow smilk whole,semi-skimmedorskimmed.itcanbe pasteurised,sterilised,long-lifeoruht. Beneficiariescan tspendtheirvouchersonflavouredmilk,colouredmilk, evaporatedmilk,condensedmilk,goat smilk,soyamilkorpowdered milk exceptinfantformulamilk. Plain fresh or frozen fruit and veg Anykindofplainfreshorfrozenfruitorvegetables,wholeor chopped,packagedorloose. Beneficiariescan tspendtheirvouchersonanyfreshorfrozenfruitandveg whichhasaddedsalt,fat,sugaroranyotheringredient.theyalsocan tspend themonpre-cooked,driedortinnedfruitandvegetables,fruitjuiceorsmoothies. Infant formula milk Infantformulamilkthatsaysonthepacketitcanbeusedfrombirth. Beneficiariescan tspendtheirvouchersoninfantformulasthataren t basedoncow smilk,suchassoyaformula.theyalsocan tspendthem onfollow-onformulasthataremadeforbabiesagedsixmonthsorolder. 6 / 7

7 Frozen foods Includingplainfrozenfruitandvegetablesintheschemefrom6April 2011meansthatfamiliesontheschemecanspendtheirvoucherson productssuchasfrozenpeasorcarrotsaswellasfreshfruitand vegetablesandmilk. Plainfrozenfruitandvegetablesarebeingincludedtohelplow-income familieseatmorefruitandvegetablesbygivingthemmorechoiceabout thekindstheycanspendvoucherson.

8 Healthy Start Recommendations and evidence Healthy Start replaced the means tested elements of the Welfare Food Scheme throughout the UK in Proposals for reform of the previous scheme were based on recommendations made by the Committee on Medical Aspects of Food and Nutrition Policy (COMA) (DH 2002). The National Institute for Health and Clinical Excellence (NICE) has a number of recommendations for health professionals working with women and young children that relate to Healthy Start. You can see them in full at They include: For pregnant women or those who may become pregnant Advisethemtotakeasupplementcontaining400micrograms(mcg) offolicaciddailypre-conceptionanduptothe12thweekofpregnancy; alsoprovideadviceonsuitablevitaminsupplementssuchashealthystart vitaminsforwomen. EnsurethateligiblewomenreceiveaHealthyStartapplicationleaflet(HS01) assoonaspossibleinpregnancy. ForwomenreceivingHealthyStartvouchers,providepracticaladviceon howtoincreasetheirintakeoffruitandvegetables. Provideinformationonfoodsanddrinksrichinfolicacid,e.g.fortified breakfastcerealsandyeastextract,andfoodanddrinkrichinfolate (thenaturalfromoffolicacid)e.g.peas,beansandorangejuice. Duringthebookingappointment,offeradviceandinformationtoall womenaboutthebenefitsoftakingvitamindduringpregnancyandwhile breastfeeding;checkthatwomenatthegreatestriskofvitaminddeficiency (thosewhoarenotexposedtomuchsun,forexamplethosewhocoverup theirskinforculturalreasonsandpeoplewithdarkerskin,suchaspeople ofafrican-caribbeanandsouthasianorigin)arefollowingtheadvice. ProvideinformationonsourcesofvitaminD,includingthemainsource (sunlight)andfoodshighinvitamind,e.g.oilyfish,eggsandfortifiedfoods suchasbreakfastcerealsandmargarine. 8 / 9

9 For mums and babies AdvisemothersaboutsuitablevitaminDsupplementssuchasHealthy StartvitaminsforwomenofvitaminDdeficiency;checkthatwomen atthegreatestriskofdeficiency(asbefore)arefollowingtheadvice. ForwomenreceivingHealthyStartvouchers,providepracticaladvice onhowtoincreasetheirintakeoffruitandvegetables. For families and carers of babies over six months and pre-school children OfferHealthyStartvitamindrops(A,CandD)toallchildrenaged fromsixmonthstotheirfourthbirthdaywhosefamiliesareeligible forhealthystart. Provideparentsandcarerswithpracticaladviceonhowtheycan introducebabiestoavarietyofsolidfoods. AswellastheNICEguidance,theNational Service Framework for Children, Young People and Maternity Services(DH2004b)statesthat maternityserviceprovidersshouldensurethatallpregnantwomenare offeredclearinformationontheavailabilityofhealthystart.

10 The Scientific Advisory Committee on Nutrition (SACN) has made a number of recommendations: In1991theCommitteeonMedicalAspectsofFoodandNutritionPolicy (COMA SACN spredecessor)recommendedthatcertainat-risk individuals,orgroupsatriskofvitaminddeficiency,shouldtake supplementsof7 10mcgofvitaminDdaily(DH1991).TheChiefMedical Officer(CMO)subsequentlyendorsedtheserecommendationsfor vulnerablegroupsin2005(cmo2005).comahadalsorecommended thatallchildrenagedonetofiveyearsshouldbegivenasupplement containingvitaminsa,candd(dh1994),andtheukhealth Departmentshavesincerecommendedthatallchildrenhavesupplements fromsixmonthsuntilfiveyearsofage. In2007,SACNspecificallyreiteratedCOMA soriginalrecommendations onvitamindinitspositionstatementupdate on Vitamin D(SACN2007), recommendingthatallpregnantandbreastfeedingwomenshouldtake adailysupplementofvitamindinordertoensuretheirownrequirement forvitamindismetandtobuildadequatefetalstoresforearlyinfancy, andallyoungchildrenshouldbegivenavitamindsupplementuntilfive yearsofageaspreviouslyrecommendedbycoma. NICE(2008)hasalsohighlightedtheimportanceofvitaminD supplementsforpregnantandbreastfeedingwomen. 10 / 11

11 SACNhasalsorecommendedthatallwomenwhocouldbecome pregnantshouldtake400mcgoffolicaciddailyasamedicinalorfood supplementpriortoconceptionanduntilthe12thweekofpregnancy. Womenwithahistoryofneuraltubedefect(NTD)affectedpregnancyare advisedtotake5mgperdaypriortoconceptionanduntilthe12thweek ofpregnancy(sacn2006). Intheirreviewofthekeyfindingsfromthe2005InfantFeedingSurvey, SACNincludedthefollowingrecommendations: Increasetheawarenessofbreastfeedingamongyoungandlow-income mothersbydiscussinginfantfeedingduringpregnancyandproviding supportintacklingpracticalbarrierstobreastfeeding.theprofileof HealthyStartshouldberaisedandhealthprofessionals,atevery opportunity,shouldofferpracticalsupportandadvicetothoseeligible forthescheme(sacn2008b,paragraph125). Inequalitiesinaccesstoantenatalandpostnatalcareareapparent. Identifyingsub-groupsofwomenwhodonotusematernalhealthservices iskeytoimprovingpolicyadherence.thereisaneedtomakeantenatal andpostnatalservicesmoreaccessibleforwomenfromhard-to-reach groupsandencouragethemtousetheseservicesmorefrequently.in addition,thetopicofbreastfeedingshouldberaisedwheneverpossible duringantenatalconsultationsandencouragementshouldfocusonthose leastlikelytobreastfeed(sacn2008b,paragraph128).

12 What to do next FindouthowHealthyStartvitaminsaredistributedbyyourtrustor boardandroutinelytellpregnantwomenandfamiliesonthescheme aboutthevitamins,whythey reimportantandhowtogetthem. OrderHealthyStartapplicationleaflets(HS01)andotherresourcesat MakesureHealthyStartisembeddedinyourlocalpoliciestopromote breastfeedingandhealthyeating. UseHealthyStartasanopportunitytosignpostlocalinitiativesfor pregnantwomenandyoungfamilies. VisittheHealthyStartwebsitewww.healthystart.nhs.ukformore informationabouttheschemeandyourrole,andtoviewtheinformation thatissentdirectlytobeneficiarieswiththeirvouchers. 12 / 13

13 Who can give out the application leaflet? Anyonecanorderbulksuppliesoftheapplicationleaflet(HS01)andgive themout,butitisespeciallyimportanttomakethemavailablewherever servicesforpregnantwomenandfamiliesarebeingprovided. Anymemberofthepubliccanalsorequesttheirowncopydirectlyfrom thehealthystarthelplineon ,ordownloadthe applicationleafletfromwww.healthystart.nhs.uk Bookingandhealthandsocialcareassessmentappointmentsareagood opportunitytoprovidetheapplicationleafletinpersonbecausepregnant womencanreceivevouchersfromthe10thweekofpregnancy.many maternityunitsincludeacopyintheirmaternityinformationpack.it salso agoodideatorecordtheuptakeofhealthystartinthewoman snotes. Countersigning the form WhensomeoneappliesforHealthyStart,aregisteredmidwife,nurseor medicalpractitionerhastocompleteandsignpartboftheapplication leaflettoconfirmtheexpecteddateofdelivery(edd)and/orthedate(s) ofbirthofanychildrenunderfouryearsold.it s important that Part B is fully completed, or the application cannot be processed. Pleasenote:healthprofessionalsaren trequiredtocheckthatan applicantisgettingthebenefitstheyclaimtobe we lldothat.nordo healthprofessionalsneedtoreportanysubsequentchangesinpeople s circumstancesoncethey reonthescheme it sthebeneficiary s responsibility.however,healthprofessionalsareaskedtoofferappropriate adviceonbreastfeedingandhealthyeatingandtoindicatethattheyhave donethisontheapplicationleaflet.it salsoagoodideatousethe opportunitytotalkaboutotherrelevantservicesandtoexplainwhy HealthyStartvitaminsareimportant.

14 Nutrition, health and inequality There s growing evidence to suggest that nutrition during pregnancy and in the early years of a child s life can help prepare them for healthy adulthood. A healthy diet can also help reduce the risk of obesity and chronic diseases such as heart disease and some cancers later in life. COMA spanelonchildandmaternalnutritionproducedascientific Review of the Welfare Food Scheme(nowHealthyStart),acknowledging thatmaternalandchildnutritionmayaffectlong-termhealthoutcomes (DH2002). 14 / 15

15 Health inequalities Manypeoplefollowahealthybalanceddiet,butalargenumberdon t, particularlyamongthemoredisadvantagedandvulnerableinsociety (DH2004a).TheIndependent Inquiry into Inequalities in Health(Acheson 1998)emphasisedtheinfluenceofpoverty,educationandpoorearly nutritiononhealthinequalities.thereportrecommendedpoliciesto improvenutrition,reducefoodpovertyandpreventchildhoodobesity. Morerecently,recommendationshavebeenmadebySACNinanumber ofitsreportsincludingthe Nutritional Wellbeing of the British Population (SACN2008a) anditsreviewofthekeyfindingsfromtheinfantfeeding Survey2005,Infant Feeding Survey 2005: A commentary on infant feeding practices in the UK (SACN2008b). Women in disadvantaged groups are significantly less likely to: accessmaternityservicesearly stayintouchwithhealthservicesthroughouttheirpregnancies haveawell-balanceddiet breastfeedtheirbabies giveupsmokinginpregnancy introducesolidfoodsattherecommendedage. Women from disadvantaged, vulnerable or excluded groups including pregnant teenagers are more likely to have poorer maternal and neonatal outcomes, for example: infantmortality lowbirthweight postnataldepression.

16 How Healthy Start gives you the opportunity to help disadvantaged women Becausepregnantwomenandfamiliesneedtogettheirapplication leafletcountersignedbyahealthprofessional,theapplicationprocess offersanopportunitytoidentifythosewhoaremorelikelytobe disadvantaged,youngandlivinginvulnerablesituations;toengagewith themandreferthemontorelevantservicesforadditionalsupportif required.forexample,awomanwhoqualifiesforhealthystartmaybe lesslikelytobreastfeed.asahealthprofessionalyoumaybeabletodirect hertobreastfeedingeducationandsupport,peersupportandthelocal SureStartChildren scentreorfamilycentre. It sachancetodiscussbreastfeedingandnutritionandgivewomen generalhealthadviceatatimewhentheyarelikelytobemostreceptive toit.forinstance,youmightbeabletosuggestwhattheyspendtheir voucherson. TheUKHealthDepartmentsbelievethatmaternityservicesshouldbe proactiveinengagingallwomen,butparticularlythosewomenfrom disadvantagedgroupsandcommunities,earlyinpregnancyandmaintaining contactuptoandafterbirth(dh2004b;welshassemblygovernment 2005).SACNhasalsorecommendedthatadviceoninfantfeedingneedsto betailoredaccordingtosocialgroup(sacn2008a).seepages30and31. The role of health professionals is crucial Recentresearchhasshownthattheroleofhealthprofessionalsinintroducing HealthyStartisincrediblyimportant.ParentswhoareintroducedtoHealthy Startthroughahealthprofessionalaremorelikelytoseethemselvesworking inpartnershipwithhealthystartforthebenefitoftheirchildrenasopposed toviewingtheschemesimplyasfinancialsupport(dhqualitativeresearch October2009,unpublished). 16 / 17

17 Nutrition in pregnancy HealthyStartencouragespregnantwomenfromdisadvantagedgroups toincludemilkandavarietyoffreshfruitandvegetablesintheirdiet. Teenagegirls,whohaveincreasednutritionalrequirements,areatgreater riskofnutrientdeficienciesduringpregnancy,whichiswhyevery pregnant woman under 18 years old is eligible for Healthy Start. Healthyeatingduringpregnancyisimportantforboththehealthofthe motherandthedevelopmentandgrowthofthebaby.also,womenare mostlikelytoinfluencethedietarydecisionsofthewholefamilyandare centraltothefuturehealthyeatingoftheirchildren. Ahealthybalanceddietthatincludesatleastfiveportionsoffruitand vegetablesadaycanhelpreducetheriskofheartdiseaseandsomecancers. Obesity and pregnancy It simportantthatwomenaregivenadviceaboutweightgainduring pregnancy.there sanincreasedriskofcomplicationsiftheirbodymass index(bmi)isabove35(orlessthan18),suchasincreasedbloodpressure whichcanleadto,amongotherconditions,gestationaldiabetes. Dieticiansmaybeabletoprovidesupport. Womendon tneedto eatfortwo whenthey arepregnant.evenwith multiplepregnancies, it sthequalityandnot thequantityofthediet thatisimportant.

18 What pregnant women should eat Theeatwellplate 1 shows howmuchofeachtype offoodisneededtohavea healthy,well-balanceddiet. Plenty of fruit and vegetables(fresh,frozen,tinned,driedoraglass of100%unsweetenedfruitjuice) avariety,atleastfiveportionsaday. Plenty of starchy foods,suchaswholemealbread,potatoes,rice,pasta, chapatis,yamsandbreakfastcereals,asthemainpartofeverymeal. Some protein,suchasleanmeatandchicken,fish,eggsandpulses suchasbeansandlentils,whicharealsogoodsourcesofiron.please note:pregnantwomenshouldtrytoeatatleasttwoportionsoffish aweek,butshouldnothavemorethantwoportionsofoilyfishaweek. Plenty of fibre,whichhelpspreventconstipation it sinwholegrain bread,wholegraincereals,pasta,rice,pulsesandfruitandvegetables. Some dairy foods,includinglower-fatversionsofmilk,cheeseand yoghurt,whichcontaincalciumandarealsoagoodsourceofprotein. There are some foods that pregnant women should avoid seepage19. and cut down on Foodssuchascakesandbiscuitsbecausethey rehighinfatandsugars andcancauseunnecessaryweightgaininpregnancy. Healthy snacks to recommend instead include: Maltloaf,lower-fatyoghurts,fruit includingfresh,tinnedor100% unsweetenedfruitjuice,andsmallhandfulsofdriedfruitsuchasraisins orapricots. 18 / 19 1 DepartmentofHealthinassociationwiththeWelshAssemblyGovernment, thescottishgovernmentandthefoodstandardsagencyinnorthernireland

19 Foods to avoid during pregnancy Some types of cheese:mould-ripenedsoftcheesesandblue-veined varieties(suchasbrie,camembertordanishblue).thesemaycontain listeria,whichcancausemiscarriage,stillbirthorsevereillnessinthe newbornbaby. Paté:alltypesofpaté,includingvegetablepatés,astheycan containlisteria. Uncooked or undercooked ready meals,includingraworpartially cookedmeat,especiallypoultry. Raw or partially cooked eggstoavoidtheriskofsalmonella. Raw or undercooked meat. Liver, liver products, fish liver oil supplements and supplements containing vitamin A (retinol)(seepage24). Some types of fish:pregnantwomenshouldavoideatingshark, marlinandswordfishandlimittheamountoftunatheyeattono morethantwotunasteaks(170geachraw)orfourcans(140gdrained weight)perweek;thesetypesoffishcontainhighlevelsofmercury, whichcandamagethebaby sdevelopingnervoussystem. Raw shellfish. Unpasteurised milk. Alcohol(seepage27). A note on peanuts Previousadvicehasbeenthatwomenmaychoosetoavoideating peanutsduringpregnancyifthereisahistoryofallergyintheirchild s immediatefamily(suchasasthma,eczema,hayfever,foodallergiesetc). Thisadvicehasnowchangedaslatestresearchshowsthatthereisno clearevidencethateatingpeanutsduringpregnancyaffectsthechances ofababydevelopingapeanutallergy.so,pregnantwomenarenow advisedthattheycaneatpeanutsaspartofahealthybalanceddiet iftheychoosetoandarenotallergicthemselves.

20 Caffeine Consuminghighlevelsofcaffeine duringpregnancycanresultin babiesbeingbornwithlowbirth weight,whichcanincreasetherisk ofhealthproblemsinlaterlife.too muchcanalsocausemiscarriages, sopregnantwomenshouldlimit theircaffeineintake. Pregnantwomenshouldhaveno morethan200mgofcaffeineper day,i.e.nomorethanapproximately twomugsofinstantcoffeeorone mugoffiltercoffeeortwomugs ofteaortwocansofenergydrink. Physical activity Regularphysicalactivityof moderateintensityforatleast 30minutes,onfiveormoredays oftheweek,isimportantforall women,includingthosewhoare pregnant.pregnantwomenshould stayactiveandkeepuptheir normaldailyexercise(within reason).iftheytakepartingym classestheyshouldmakesurethat theirinstructorknowstheyare pregnant.contactsportsandthose activitieswithariskoffalling shouldbeavoided.womenwho haven tbeenundertakingregular physicalactivitypriortotheir pregnancyshouldconsiderlowimpactexercisetheywillenjoy,such asbriskwalking,swimmingand aquanatalclasseswhicharegentle inmovementandintensity.they shouldbeadvisedtobuildup exercisegradually,forexample in10-minutelotsthroughtheday. 20 / 21

21 Dangers in pregnancy Toxoplasmosis This infection is rare but can have serious consequences. Pregnant women should reduce the risks of contracting toxoplasmosis by: washingfruit,vegetablesandsaladbeforeeating washinghandsbeforehandlingfood washingallsurfacesandutensils washinghandsafterpreparingrawmeat thoroughlycookingrawmeat heatingready-preparedmealsuntiltheyarepipinghotallthe waythrough keepingleftoverscoveredinthefridgeandusingthemwithintwodays avoidingcontaminationwithcatfaecesinthecatlittertrayorsoil they shouldasksomeoneelsetotakecareofit,oratleastweargloves avoidingcontactwithabortedlambs,newbornlambsandafterbirth nothelpingwithlambingormilkingewes. Formoreinformationvisit:

22 Smoking Everytimeawomansmokesduringpregnancyitincreasestheriskof miscarriage,prematurebirth,lowbirthweightandstillbirth.italsotrebles theriskofcotdeathandcanleadtochildrendevelopingasthmaand respiratoryinfectionsinlaterlife. Youshouldaskpregnantwomenwhattheirsmokingstatusis,advise themofthehealthbenefitsofstoppingsmokingandthenprovidethem withinformationandsupporttohelpthemquit,includingreferraltotheir localstopsmokingservice. Asmokefreehomeisbestforpregnantwomen,babiesandyoung childrenasexposuretosecondhandsmokecanbeharmful.youshould providefamilieswithpracticaladviceabouthowtheycancreate asmokefreehome. If women want additional help or advice to stop smoking in pregnancy, direct them to: NHSPregnancySmokingHelpline (England) Smokeline(Scotland) StopSmokingWales SmokersHelpline(Wales) (NorthernIreland) 22 / 23

23 Alcohol and pregnancy Alcoholcanbeharmfultothedevelopingbabyandmayleadtoearly miscarriage.heavydrinkingisparticularlyrisky.pregnantwomenor womentryingtoconceiveshouldavoiddrinkingalcohol. Iftheydochoosetodrink,tominimisetherisktothebabytheyshould notdrinkmorethanonetotwounitsonceortwiceaweek andthey shouldnotgetdrunk.additionaladvicefromnicerecommendsthat womenavoidalcoholinthefirstthreemonthsinparticular,because oftheincreasedriskofmiscarriage. Oneunitofalcohol=asingle (25ml)measureofspiritsat40% ABV(alcoholbyvolume),half apintofbeerat3.5%abv, orhalfa175mlglassofwineat 11.5%ABV.Largerorstronger drinksthanthesewouldcontain morethanoneunitofalcohol. Itcanbeparticularlyeasyto underestimateunitswhendrinks arepouredathome. Formoreadviceonalcohol andunitinformationvisit Orcall: Drinkline Drinkline(Scotland) Breastfeeding and alcohol Alcoholpassesthroughtobreastfed babiesinverysmallamounts.itis unlikelythathavinganoccasionaldrink willharmthemotherorbaby,butit mightaffecthoweasilythebabyfeeds. Breastfeedingwomenshouldbeadvised todrinkverylittle nomorethanone ortwounitsaweek.ifabreastfeeding womanintendstodrinkmorethanthis theycanexpressmilkinadvance. Ifabreastfeedingmotherdrinks alcoholbeforefeeding,itcanaffect thebabyinanumberofways. Themilkmaysmelldifferentandthe babymaynotfeedaswellasnormal. Thebabymaysleeplesswellfor somehoursafterfeeding. Itisnotadvisableforwomentoshare abedorasofawiththeirbabyif theyhavebeendrinking.ifthey sleepheavilytheycouldputtheir babyatrisk.

24 Illegal drugs Useofillegaldrugs,particularlyheavyuse,canbeharmfulforboth motherandbaby.womenwhoarepregnantorbreastfeedingshould normallyaimtobecompletelydrugfree.healthprofessionalscanprovide encouragementtoquit. However,thosedependentonheroinorotheropiatesandsome tranquillisersneedtotakemedicaladvice;itmaybemuchsaferforthem toremainonsomeprescribedreplacementdrugsuntilafterdelivery. Confidential advice for drug users FRANK(UK-wide) KnowtheScore(Scotland) DAN24/7(Wales) / 25

25 Healthy Start vitamins for pregnant women and breastfeeding mothers Women in families supported by Healthy Start can claim free vitamins while they re pregnant and up to their baby s first birthday. They re sent a coupon every eight weeks that can be exchanged for Healthy Start women s vitamin tablets. It simportantthatwomengetallthevitaminsandmineralsthey needforthemselvesandtheirgrowingbabywhilethey repregnant andbreastfeeding.therearecertainsupplementstheyneedwhich willhelppreventthemfrombecomingdeficient. How Healthy Start beneficiaries claim their free vitamins EachNHSorganisationorboardisresponsiblefordistributingvitamins locally.somemayalsochoosetosellorsupplythemfreeofcharge towomenandchildrenwhoarenoteligibleforhealthystart.health professionalsshouldcontacttheirlocalhealthystartleadformoredetails. Beneficiariesreceiveavitamincouponandareadvisedtoasktheir midwife,healthvisitororpublichealthnurseaboutwheretheycan usethecoupon,andtotakeitwiththemtocollecttheirvitamins. So it s essential that health professionals know what the local arrangements are.

26 What s in Healthy Start vitamins for women? Healthy Start vitamins for women contain folic acid, vitamin D and vitamin C. Here s why they re important for pregnant women and new mums. Folic acid Taking400mcg(0.4milligrams)offolicacidbothbeforeandupuntil the12thweekofpregnancycanhelppreventntdsuchasspinabifida, wherethespinedoesn tdevelopproperlyinunbornbabies. Eveniffolicacidisn ttakenbeforeconception,it sworthstartingassoon asthewomanisawareofthepregnancy,anditshouldcontinuetobe takenuntilthe12thweekofpregnancy.folate,thenaturalformoffolic acid,canbefoundinpeas,potatoes,broccoli,orangejuice,brussels sprouts,asparagus,black-eyedbeans,spinachandkale,andit simportant forpregnantwomentoeatplentyofthesefoods.however,it svery difficulttomeetthisincreasedrequirementoffolatefromfoodalone. Thereforetakingfolicacidsupplementsisimportantwhentryingtoget pregnantandintheearlystagesofpregnancy. IfamotherhasalreadyhadapregnancyaffectedbyNTDorhasdiabetes, oristakinganti-epilepticmedicines,sheisadvisedtoseekmedicaladvice fromhergp. Recommendation: all women who are trying to get pregnant or who are pregnant should take 400mcg of folic acid each day up until they are 12 weeks pregnant. Women who have already had a pregnancy affected by NTD need to take 5mg of folic acid each day until the 12th week of their pregnancy. In addition, women who have diabetes and those taking anti-epileptic medicines should consult their GP for advice. (AsrecommendedbyCOMA (2000),SACN(2006)andNICE(2008).) 26 / 27

27 Vitamin D VitaminDisimportantforallpregnantandbreastfeedingmothers. Thebestsourceissummersunlight.Theamountoftimeneededinthe suntomakeenoughvitamindisdifferentforeverypersonanddepends onskintype,timeofdayandtimeofyear.butsunbathingisn tnecessary; ittakeslesstimeinthesunforthebodytomakeenoughvitamindthan itdoestocausetanningorburning.wearingahighfactorsunscreento avoidskinturningredorburningisadvisedforthemajorityofthetime spentoutdoors. VitaminDisfoundinasmallnumberoffoods,includingoilyfish,eggs, fortifiedbreakfastcerealsandmargarines.thosewhoaremostatrisk ofavitaminddeficiencyincludepregnantandbreastfeedingwomen, youngchildren,olderpeopleandthosewhoarenotexposedtomuch sun,forexamplethosewhocoveruptheirskinforculturalreasons,who arehouseboundorconfinedindoorsforlongperiodsandpeoplewith darkerskin,suchaspeopleofafrican-caribbeanandsouthasianorigin. Thoselivingabove52 N(theUKisatalatitudeof50 60 N)maynot getenoughvitamindduringthewintermonths. Takingasupplementduringpregnancyandwhilstbreastfeedingwill ensurethatamother sownrequirementforvitamindismet,plus itwillbuildadequatefetalstoresforearlyinfancy. Recommendation: all women who are pregnant or breastfeeding should take a daily vitamin D supplement of 10mcg. (AsrecommendedbyDH(2004a)andSACN(2007).)

28 Vitamin C VitaminCprotectscellsandhelpskeepthemhealthy.Inabalanceddiet mostofthevitamincrequiredcanbesourcedfromfruitandvegetables, includingbroccoli,orangesandstrawberries,butasupplementwillhelp ensurethatpregnantandbreastfeedingmumsgetenough particularly asitisn tstoredbythebody. Vitamin A A vitamin to avoid during pregnancy Pregnantwomenandwomentryingtoconceiveshouldavoid supplementscontainingvitamina(retinol)astoomuchcanhaveharmful anddamagingeffectsontheunbornbaby(sacn2005).theyshouldnot consumeliverorliverproducts,includingfishliveroil,becausethey haveahighvitaminacontent.vitaminaisnotincludedinhealthy Startwomen svitamintablets. 28 / 29

29 The early postnatal period Breastfeeding Breastfeedingcandeliversignificanthealthbenefitsforboththemother andherbaby. Exclusive breastfeeding (with no other food or drink) is all a baby needs for around the first six months (26 weeks), continuing thereafter alongside a variety of other healthy foods. It provides all the nutrients a baby needs and helps to protect them from a range of infections. Evidencesuggeststhatinfantswhoarenotbreastfedaremorelikelyto becomeobeseinlaterchildhood,developtype2diabetes,andtendtohave slightlyhigherlevelsofbloodpressureandbloodcholesterolinadulthood. Breastfeedingmothershavereducedriskofbreastandovariancancers. Allpregnantwomenshouldhavetheopportunitytodiscussthebenefitsand managementofbreastfeeding.tailoringthisinformationtotheneedsofthe mother,alongwithsourcesofpracticalhelpandsupport,willraiseawareness ofbreastfeedingamongyoungandlow-incomewomen,helpingthemto anticipateandovercomedifficultiessotheycanconsideritarealoption. Anyamountofbreastfeedingmakesadifferenceandthelongerababyis breastfedthelongertheprotectionlasts evenafterbreastfeedingceases. Infantformulamilkcan tprovideallthesameingredientsorprotection. Allmothersshouldbesupportedtocarryonbreastfeedingforaslong astheywish,alongsidetheintroductionofavarietyofotherhealthy foodsataroundsixmonths.theworldhealthorganization recommendsbreastfeedingfortwoyearsorbeyond.however,the majorityofmothersstopbreastfeedingmuchearlier,withyounger, moredisadvantagedmothersbeingleastlikelytofeedbeyondthefirst fewweeks,ifatall.

30 Mothersfromdisadvantagedgroupsarelesslikelytostartbreastfeeding andmorelikelytostop.bysixweeks,73%ofmothersfrommanagerial andprofessionaloccupationswerestillbreastfeeding,comparedwith 58%ofmotherswhohadneverworkedand49%ofmothersfrom routineandmanualoccupations.thisdifferencebysocio-economic grouppersistedatsixmonths(bollingetal.2007). Womenshouldn tbeexpectedtodecidewhetherornotthey llbreastfeed untilafterthebirth.however,there sclearevidencethatacombination ofinterventionsbyhealthprofessionalsduringpregnancyisthemost effectivewaytoencouragewomentostartbreastfeedingandcarry onforlonger(fairbanketal.2001). Interventions include: informingallwomenaboutthebenefitsofbreastfeeding involvingofpeersupporterswithpregnantwomen supportingandencouragingattendanceatantenatalgroupsand breastfeedingeducationclassestomeetwithothermothersand shareinformationandsupport WhereatrustorboardisworkingtowardstheUNICEFBabyFriendly Initiative,womenwillbesupportedtoinitiateandcontinue breastfeedingthroughasetofevidence-basedbestpracticestandards / 31

31 Mothers who breastfeed: naturallyuseupto 500caloriesaday arelesslikelytodevelop breastcancer arelesslikelytodevelop ovariancancer. Maintaining a healthy diet Breastfeedingmothersdon tneed tofollowaspecialdiet,like everyone,theyshouldbeencouraged toeatahealthybalanceddiet consistingofplentyoffruitand vegetablesandstarchyfoods, preferablywholegrains,andsome proteinrichfoodssuchasmilkand dairyfoods,meat,fish,eggs,beans andpulses. Certainvitaminsupplementsare alsoimportant(seepages21 24). Healthprofessionalsshoulddiscuss freehealthystartsupplements orreferwomentoagpforan appropriateprescription. Breastfed babies are less likely to: beadmittedtohospitalinthe firstyearoflifewithinfections suchasgastroenteritis developrespiratorytract infections developurinarytract infections developeczema beconstipated becomeobeseastheyget older,whichmeanstheyare lesslikelytodeveloptype2 diabetesorheartdisease befussyaboutnewfoods.

32 Infant formula milk Babiesfedoninfantformulamilkhaveagreaterriskofillhealththan breastfedbabies.it sveryimportanttoensurethatpowderedinfant formulamilkispreparedinthesafestwaypossible.it snotsterile,and eventhoughtinsandpacketsaresealed,theycontainbacteriasuchas Enterobacter sakazakii (nowalsoknownascronobacter)and,morerarely, salmonella. Make sure that all mothers who choose to feed their babies with infant formula milk are told about: theimportanceofsterilisationofthefeedingequipment howtomakeupabottleofinfantformulamilk thestorageandhandlingofinfantformulamilkoncereconstituted. To reduce the microbiological risks when making up feeds in the home, advise mothers to: preparefreshinfantformulamilkforeachfeed reconstituteformulapowderinwaterhotterthan70 Cbyfillingthe kettlewithfreshtapwater(notbottledwater)and,afterithasboiled, coolingfornolongerthanhalfanhourbeforeusing ifafeedisrequiredforlater,keepfreshlyboiledwaterinasealedflask andmakeupfreshformulawhenneeded ensurethatwaterisstillhotwhentheyuseittomakeuptheformula, otherwisethebacteriaintheinfantformulamilkmaynotbedestroyed. 32 / 33

33 Follow-on formulas: haveahigherconcentrationof proteinthaninfantformulamilk andthereforearenotsuitabletobe giventoinfantsundersixmonths (DH1994) aren tincludedinthehealthy Startschemebecausethereare noclearbenefitsfortheiruseas alternativestobreastmilkorinfant formulamilk(dh2002). Non-milk-based formulas: soya-basedinfantformulasshould onlybeusedontheadviceof agpandcanbeprescribed milksbasedongoat smilk proteinarenotsuitableforinfants astheyhaven tbeenlegally approvedforuseineurope. Neither can be purchased with Healthy Start vouchers.

34 Nutrition for growing babies Infancyisaperiodofveryrapidgrowthandthereforegoodnutritionis paramount.thequalityofdietintheearlyyearsofachild slifemayaffect thebaby slong-termhealth. When to start introducing solid foods TheUKHealthDepartmentsrecommendintroducingsolidfoodsataround sixmonths(26weeks)(dh2003a).therearethreeclearsignsthatababy isreadytostartonsolidfoods. Theywillbeableto: stayinasittingpositionandholdtheirheadsteady co-ordinatetheireyes,handandmouthandlookatfood,pickitupand putitintheirmouthallbythemselves swallowfood babieswhoarenotreadytotakesolidfoodswilluse theirtonguestopushbackfoodintheirmouths. Beforethisagethebaby sdigestivesystemisstilldeveloping,sostarting themonsolidfoodtoosoonmayincreasetheriskofinfectionorallergies. Babiesnotreadytotakesolidswillusetheirtonguestopushbackfood placedintheirmouths. Babieswhoarebornprematurelyshouldn tbeintroducedtosolidfoods justbecausetheyhavereachedacertainageorweight.theywillneed individualassessmentbyaregistereddieticianbeforebeingintroduced tosolidfoods. 34 / 35

35 Advice for mothers who choose to introduce solid foods before six months Therearesomefoodsmothersshouldavoidgivingtheirbaby.Theseinclude: peanutsandpeanutproducts othernutsandseeds foodscontaininggluten,whichis inwheat,rye,barleyandoats eggs fishandshellfish softorunpasteurisedcheeses liverandliverproducts cow smilk. Vegetarian babies Ifparentswouldrathernotincludemeatandfishinababy sdiet,that s fine.it simportanttomakesurethatbabiesonavegetariandietare gettingenoughenergyandironandaren tgettingtoomuchfibre.itis alsoespeciallyimportanttogivevitamindropstobabieswhoareona vegetariandiet.aschildrengetolder,parentsmayneedtomakesure theygetenoughproteinandiron(seepage41).avegandietisnot suitableforbabiesastheycannoteasilygetalltheenergyandnutrients theyneed.

36 Foods to avoid Nuts and peanuts Wholenuts,includingpeanuts, shouldnotbegiventochildren underfiveyearsincasethey choke,buttheycanbegiven tochildrenearlieriftheyare crushedorgroundup. Seepage38formoreinformation onfoodallergies. Sugar Mothersshouldbeadvisednot toaddsugartotheirbaby sfood orgivethemsugarysnacksin ordertohelppreventtoothdecay. Honey Babiesunderoneyearoldshould notbegivenhoneybecauseit containsatypeofbacteriathat cansometimesproducetoxins thatcauseinfantbotulism. Salt TheGovernmentrecommendsthat infantsundertheageofoneyear shouldn thavemorethan1gof saltperday.advisemothersnotto addanysalttotheirbaby sfood. Mothersshouldalsoavoidgiving theirbabiesprocessedfoodsthat aren tmadespecificallyforbabies, suchasgravyandothersauces, foodstinnedinbrineandcrispsand othersaltysnacks theycanall containhighlevelsofsalt. Shark, swordfish and marlin Thelevelofmercuryinthesecanaffectagrowingbaby snervoussystem. Raw fish and shellfish Rawfishcanincreasetheriskoffoodpoisoning,soshouldnotbegiven tobabies. Low-fat foods Fatisanimportantsourceofcaloriesandsomevitaminsforbabiesand youngchildren.it sbetterforbabiesandyoungchildrenundertwotohave full-fatmilk,yoghurtorfromagefrais. 36 / 37

37 Milk Babieswillneedbreastmilkorinfantformulamilkalongsidesolidfood fromaroundsixmonthsuntiltheyareatleastoneyearold.amilk puddingormilkfeedcanbeofferedattheendofthemeal. Cow smilk,asadrink,isnotsuitableforbabiesunderoneyearas itdoesn tcontainsufficientironandothernutrients,althoughsmall amountscanbeusedinthecookingandpreparationoffoods. Afteroneyear,babiescancontinuetobreastfeedorchangetodrinking wholecow smilk.aftertwoyearstheycandrinksemi-skimmedcow s milkifthey reeatingwell.skimmedmilkand1%fatmilksarenot suitableforchildrenunderfiveyears. Other drinks Onceinfantshaveestablishedaneatingpattern,theycanbeoffered waterwithmeals.fruitjuiceshouldnotbegiventochildrenunder sixmonthsofage.aftersixmonths,ifjuiceisgivenitshouldbediluted andonlygivenatmealtimes. Cupsshouldbeintroducedfromsixmonthssobabiescantransferstraight frombreasttocup.ifformulafeeding,theaimistohaveababyoffthe bottlebytheirfirstbirthday.cupsarebetterforababy steethand comfortsuckingonabottlecanbecomeahabitthatishardtobreak.

38 Food allergies Babiesaremorelikelytodevelopallergieswhenthere safamilyhistory ofeczema,asthmaorhayfever.exclusivebreastfeedingisrecommended forthefirstsixmonthsforallbabies,includingthosewithafamilyhistory ofallergy. Foodsthatareknowntocauseallergicreactionsinclude: peanuts othernuts wheat-basedfoodsandotherscontaininggluten seeds fishandshellfish soya eggs cow smilk. Ifparentsareconcernedthattheirbabymaydevelopanallergyit sagood ideatointroducethesefoodsoneatatime,startingwithasmallamount, soanyreactioncanbeeasilyidentified.theyshouldnotbeintroduced beforeababyissixmonthsold. Peanuts and allergies in the family Childrenwithknownallergiessuchaseczemaorfoodallergies,orwitha historyofallergyintheimmediatefamily,haveahigherriskofdeveloping apeanutallergy.parentsofthesechildrenshouldtalktotheirgp,health visitorormidwifebeforegivingpeanutsorpeanut-containingfoods totheirchildforthefirsttime. 38 / 39

39 Nutrition for young children Nutritioncanhaveafundamentalinfluenceonchildhealth,bothinthe shortandlongterm.havingahealthydietteacheschildrengoodeating habitsthattheycanuseasyoungadultsandparentsthemselves. Everyday eating Youngchildrenshouldbeofferedawidevarietyofhealthyfoodsto introducethemtodifferenttastesandtexturesandshouldincludefoods fromthefollowingfoodgroups: fruitandvegetables bread,rice,potatoes,pastaandotherstarchyfoods milkanddairyfoods meat,fish,eggs,beansandothernon-dairysourcesofprotein.

40 Fat Childrenundertwoyearsoldneedfull-fatdairyproductsbecausethey providecaloriesandessentialvitaminssuchasa,dande.lower-fat foods,suchassemi-skimmedmilk,lower-fatyoghurt,lower-fatcheese orspreads,arenotsuitableforbabiesandchildrenundertwoyearsold. Everyday,aftertheageofone,childrenshouldhaveaboutthreeservings ofdairyproductssuchasmilk,cheeseandyoghurt.forexample,aserving couldinclude: about120ml(4floz)ofmilkinacup(notabottle) aservingofamilk-baseddishsuchasyoghurt,fromagefrais orricepudding. Rice drink Youngchildrenagedonetofiveyearsshouldnotbegivenricedrinks, inordertominimisetheirexposuretonaturallyoccurringinorganic arsenic.ifparentsarealreadyprovidingricedrinks,theyshouldstop inordertoreducefurtherexposuretoinorganicarsenic. Fussy eaters It snormalforchildrenbetweentheagesofoneandfivetogothrough aphaseoffussyeating.theyusuallygrowoutofit,though,andwillbe helpedbyeatingwiththefamilyasoftenaspossible,aswellaswithother children,e.g.atnursery. 40 / 41

41 Children over five Childrenneedawiderangeofnutrientsforgrowthanddevelopment. Fromtheageoffive,parentsshouldofferthemadietthatcaninclude reduced-fatandmorewholegrainfoods,asrecommendedforadults andolderchildrenintheeatwellplate.fruitandvegetablesshouldbe offeredateachmeal,sothatatleastfivesmallportionsadayareeaten (DaveySmith1998). TheLowIncomeDietandNutritionSurvey(2007)foundthatfruitand vegetableintakewaspooramongchildrengrowingupindisadvantaged families(1.6portionsforboysand2portionsforgirlsaged2 18years) (FoodStandardsAgency2007).Researchhasfoundthatsocio-economic statusinchildhoodcorrelatestotheriskofdevelopmentof cardiovasculardiseaseinadulthood(rogersandsharp1997).

42 Vegetarian and vegan children Children who don t eat meat or fish need to eat two or three portions of vegetable protein or nuts every day to ensure that they are getting enough protein: pulses,suchaslentilsandbeans tofu soyapieces seedsandgroundorcrushednuts. However,asthechildgetsolderthereisariskthattheirdietmaybelow inironanditisimportantthattheyeatfoodscontainingiron(seepage43). VitamindropscontainingvitaminsA,CandDareespeciallyimportantfor veganandvegetarianchildrenandshouldbegiventothemuntiltheyare fiveyearsold. Avegandietcanbebulkyandhighinfibre,whichcanmeanthatchildren getfullupbeforetheyhavetakeninenoughcalories.becauseofthisthe childmayneedextrasupplements.energy-dense,high-calorieveganfood shouldbeincludedinthediet,forinstance: tofu nutandseedbutters(allergyadviceshouldbeconsideredbefore includingtheseinanydiet) pulses fortifiedsoyadrinksandyoghurts fortifiedbreakfastcereals flaxseedandrapeseedoil(whichcontainsomeomega-3fattyacidsbut notthesameasthosefoundinfish). 42 / 43

43 Iron Childrenneedironandparentsshouldmakesuretheyaregettingenough byencouragingthemtoeatavarietyofthefollowingfoods: greenvegetables,suchaswatercress,broccoli,springgreensandokra pulses,suchaslentilsandbeans driedfruits,suchasapricots,figsandprunes darkgreenvegetables wholemealbread fortifiedbreakfastcereals redmeat. It sthoughtthatit seasiertoabsorbironifeatenwithfoodsthatcontain vitaminc,sochildrenshouldbeofferedvegetablesandfruitthatarerich inthis,suchascitrusfruit,tomatoes,peppersandstrawberriesordiluted 100%unsweetenedfruitjuices. VitamindropsforchildrencontainingvitaminsA,CandDareespecially importantandshouldbeincludedwithinthediet.

44 Vitamin supplements for children Growingchildren,especiallythosenoteatingavarieddiet,oftendon tget enoughvitamina,vitamincand,especially,vitamind asitisdifficult togetenoughthroughfoodalone. TheUKHealthDepartmentsrecommendthatchildrenfromsixmonths tofiveyearsoldaregivensupplementscontainingvitaminsa,candd. FamilieswithbabiesorchildrensupportedbyHealthyStartaresent couponseveryeightweekstoexchangeforhealthystartchildren s vitamindrops.couponsareissuedfrombirthsothatthedropscanalso beclaimedforbabiesundersixmonthsoldifthereisanydoubtaboutthe mother svitamindstatus. Vitamin Dhasanumberofimportantfunctions.Forexample, ithelpstoregulatetheamountofcalciumandphosphateinthebody. Theseareneededtohelpkeepbonesandteethhealthy;infantswhodon t getenoughcangetsoftenedboneswhichcanleadtorickets.thebest sourceofvitamindissummersunlight,butmostpeopleintheukhave limitedexposuretoit. Vitamin A helpswithvisionindimlightandhelpsimmunity, aswellassupportinghealthyskin. 44 / 45

45 Vitamin Cprotectscells,helpskeepthemhealthyandmayassist thebodytoabsorbironfromfood.inabalanceddietmostofitcanbe sourcedfromfruitandvegetablessuchasbroccoli,orangesandkiwifruit. However,asupplementwillhelpensurethatchildrengetenough particularlyasitisn tstoredbythebody. Recommendation: All children aged from six months to five years should take a vitamin supplement which contains vitamins A, C and D unless they are having 500ml (a pint) or more of formula a day. Wherethereisanydoubtaboutamother svitamindstatusinpregnancy, breastfedbabiescanbenefitfromhealthystartvitaminsfromonemonthold. Babieshavingformuladonotneedtohavevitaminsuntiltheyarehaving lessthan500ml(apint)offormulaaday.(asrecommendedbydh(1994) andsacn(2007).) Formoreinformationvisitwww.healthystart.nhs.uk

46 Find out more Healthy Start resources AllHealthyStartresourcesareavailabletoorderordownloadat Youcanalso downloadthematwww.healthystart.nhs.uk HealthyStartapplicationleafletHS01 HealthyStartvitaminbookletHS52BE(Englandonly) HealthyStartgeneralposterHS50(orderonly) HealthyStartvitaminsformumsposterHS504(orderonly) HealthyStartvitaminsforchildrenposterHS505(orderonly) Quickguideforfirst-timemumsHS507 Quickguideforpregnantunder-18sHS / 47

47 General resources England NHSBirthtofive: planners/birthtofive/pages/ Birthtofivehome.aspx NHSbreastfeedingwebsite: NHSChoices: NHSDirect: ADAY: DepartmentofHealth: Start4Life: Change4Life: Publications OfftotheBestStart BottleFeeding IntroducingSolidFood Ifyouwanttoordertheseleaflets pleasecall orvisitwww.orderline.dh.gov.uk Scotland ReadySteadyBaby!: NHSHealthScotlandwebsite: NHS24: Breastfeeding Thefeedgoodfactor: Publications OfftoaGoodStart Allyouneedto knowaboutbreastfeedingyourbaby BreastfeedingandReturningtoWork FunFirstFoods Aneasyguideto introducingsolidfoods Wales WelshAssemblyGovernment Breastfeeding: NHSDirectWales: Publications FeedingYourBaby Startingoffwell Breastfeeding Thebeststartfor yourbaby SaferBottlefeeding EasytoCookFamilyFoodsfor yourbaby BreastfeedingandReturningtoWork Northern Ireland PublicHealthAgency BreastFedBabies.org: breastfedbabies.org Publications The Pregnancy Book Birth to Five OfftoaGoodStart FeedingYourBaby BottleFeeding WeaningMadeEasy NutritionMattersforEarlyYears UK HealthyStart:

48 Breastfeeding organisations The following organisations and websites provide further resources and examples of service improvement and innovation which can support local breastfeeding initiatives. TheAssociationofBreastfeedingMothersisacharity runbymothersformothers,givingfriendlysupportandsupplyingaccurate informationtoallwomenwishingtobreastfeed.italsosupportsthenational BreastfeedingHelpline. breastfeedingactivityintheuk,andinformationforcommissionersonhow todelivertheunicefukbabyfriendlyinitiative(bfi).userscansubscribe to updates. aimstosavelivesandendavoidablesufferingcausedbyinappropriateinfant feeding.itworksgloballytostrengthencontrolsonmarketingbythebaby feedingindustry. 48 / 49

49 supportingpeoplethroughpregnancy,birthandearlyparenthood. fromthenationalinstituteforhealthandclinicalexcellencesiteaspdffiles. Furtherinformationrelatingtothetopicareawillbesignpostedfortheuser. informationtotheukmidwiferysector,bothnhsandprivate. encouragesthestudyandadvancementofthescienceandthepracticeofobstetrics andgynaecology. amajorroleinpostgraduatemedicaleducationandprofessionalstandards. TheScientificAdvisoryCommitteeonNutritionis acommitteeofindependentexpertsthatprovidesadvicetothedepartment ofhealth,aswellasothergovernmentagenciesanddepartments. aregisteredcharitythatsupportshumanmilkbankingintheuk.thecharity givespracticalsupporttomilkbankstaff,whoco-ordinatetheprovisionof donorbreastmilktoprematurebabies.thecharitysharesexpertiseandgood practicewithmilkbanksandbreastmilkdonors. visitors,schoolnurses,nurserynursesandothercommunitynursesworking inprimarycare.

50 References AchesonD(Chairman)(1998)Independent Inquiry into Inequalities in Health Report. TheStationeryOfficeLondon:(TSO). BollingKetal.(2007)Infant Feeding Survey 2005.London:TheInformationCentre forhealthandsocialcrae. CMO(2005)MeetingtheneedforvitaminD.CMO Update42:6. COMA(2000)Folic Acid and the Prevention of Disease: Report of the Committee on Medical Aspects of Food and Nutrition Policy.ReportonHealthandSocial SubjectsNo.50.London:TSO. DaveySmithG(1998)Influencesthroughthelifecourse:fromearlylifeto adulthood,insharpi(ed)social Inequalities in Coronary Heart Disease: Opportunities for action.nationalheartforum.london:tso. DH(1991)Dietary Reference Values for Food Energy and Nutrients for the United Kingdom.ReportofthePanelonDietaryReferenceValuesofthe CommitteeonMedicalAspectsofFoodPolicy.ReportonHealthandSocial SubjectsNo.41.London:HerMajesty sstationeryoffice(hmso). DH(1994)Weaning and the Weaning Diet: Report of the Working Group on the Weaning Diet of the Committee on Medical Aspects of Food Policy.London:HMSO. DH(2002)Scientific Review of the Welfare Food Scheme: Report of the Panel on Child and Maternal Nutrition of the Committee on Medical Aspects of Food and Nutrition Policy.ReportonHealthandSocialSubjectsNo.51.London:TSO. DH(2003a)Infant Feeding Recommendation.London:DH. DH(2004a)Choosing a Better Diet: A food and health action plan.london:dh. DH(2004b)National Service Framework for Children, Young People and Maternity Services, Standard 11: Maternity Services.London:DH. FairbankLetal.(2001)Promotingtheinitiationofbreastfeeding. Quality in Healthcare 10(2): FoodStandardsAgency(2007)Low Income Diet and Nutrition Survey, London:TSO. WelshAssemblyGovernment(2005)The National Service Framework for Children, Young People and Maternity Services in Wales,Chapter3:Maternity Services.Cardiff:WelshAssemblyGovernment. 50 / 51

Delivering a Healthy Start for pregnant women, new mums, babies and young children

Delivering a Healthy Start for pregnant women, new mums, babies and young children HS52A Delivering a Healthy Start for pregnant women, new mums, babies and young children Read more A guide for health professionals www.healthystart.nhs.uk 2012/13 Contents What is Healthy Start? Who qualifies?

More information

HS58A. Healthy Start vitamins and why you need them

HS58A. Healthy Start vitamins and why you need them HS58A Healthy Start vitamins and why you need them Folic acid Taking a folic acid supplement before you re pregnant and until the 12th week of your pregnancy is really important because it reduces the

More information

Infant Feeding Survey 2010: Summary

Infant Feeding Survey 2010: Summary Infant Feeding Survey 2010: Summary Authors: Fiona McAndrew, Jane Thompson, Lydia Fellows, Alice Large, Mark Speed and Mary J. Renfrew A survey carried out on behalf of the Health and Social Care Information

More information

Protecting and improving the nation s health. Vitamin D. Information for healthcare professionals

Protecting and improving the nation s health. Vitamin D. Information for healthcare professionals Protecting and improving the nation s health Vitamin D Information for healthcare professionals 1 Vitamin D: Information for healthcare professionals Why is vitamin D important? Some of the UK population

More information

Diet, activity and your risk of prostate cancer

Diet, activity and your risk of prostate cancer Diet, activity and your risk of prostate cancer Prostate cancer is the most common cancer in men in the UK. About one in eight men (12.5 per cent) will get prostate cancer at some point in their lives.

More information

Vitamin supplements and you

Vitamin supplements and you Vitamin supplements and you Guidance for pregnant or breastfeeding women, babies and young children Health Improvement About this leaflet Vitamins are really important they are essential nutrients that

More information

What can happen if you have low iron levels?

What can happen if you have low iron levels? Iron in your diet Iron in your diet Why is iron important? Iron is important because it helps your body to make haemoglobin. Haemoglobin, or Hb, is the protein found in red blood cells that carries oxygen

More information

CHILD CARE DIPLOMA. Course Sample

CHILD CARE DIPLOMA. Course Sample CHILD CARE DIPLOMA Course Sample Unit CHP2 Providing for children s physical needs inclusive of health and safety The Statutory framework for the EYFS is a requirement for all registered early years providers.

More information

FACTSHEET. Weaning your baby

FACTSHEET. Weaning your baby FACTSHEET Weaning your baby This factsheet gives you information on introducing your baby to solid food. It covers: The recommendation for exclusive breastfeeding for the first 6 months The introduction

More information

Weaning learning to like new tastes and textures

Weaning learning to like new tastes and textures Complementary feeding or weaning is introducing solid foods in addition to your baby s milk feeds. Babies develop at different rates so begin when your baby is ready by six months, but not before four

More information

simple steps give you for good bowel health

simple steps give you for good bowel health simple steps give you for good bowel health This booklet contains simple steps you can take to help achieve good bowel health. This is important to everyone, as these small changes will help your digestive

More information

your eatwell Feeding your baby in the first year eatwell.gov.uk

your eatwell Feeding your baby in the first year eatwell.gov.uk baby your Feeding your baby in the first year eatwell eatwell.gov.uk This booklet gives practical advice about feeding your baby. It takes you from the early months when your baby is fed only with breast

More information

The meaning of. When is it best to start?

The meaning of. When is it best to start? 1 2 The meaning of When is it best to start? There comes a time when a baby needs more nourishment than breast milk or infant formula alone can provide. Government guidelines strongly encourage mothers

More information

Weaning. Starting solid food

Weaning. Starting solid food Weaning Starting solid food What is weaning? The information in this leaflet will help you wean your baby onto solid foods. Your baby s development from breast or formula milk feeding to sharing in the

More information

Maternal and child nutrition

Maternal and child nutrition Maternal and child nutrition Issued: March 2008 last modified: November 2014 NICE public health guidance 11 guidance.nice.org.uk/ph11 NICE 2008 Contents Introduction... 6 1 Key priorities... 7 Healthy

More information

Healthy Eating During Pregnancy

Healthy Eating During Pregnancy Healthy Eating During Pregnancy Pregnancy is a time of great change. Your body is changing to allow your baby to grow and develop. Good nutrition will help you meet the extra demands of pregnancy while

More information

Off to the best start. Important information about feeding your baby

Off to the best start. Important information about feeding your baby Off to the best start Important information about feeding your baby mum s milk the best start for your baby What happens in your baby s first years has a big effect on how healthy he or she will be in

More information

Nutrition: a guide for feeding infants with cystic fibrosis

Nutrition: a guide for feeding infants with cystic fibrosis Nutrition: a guide for feeding infants with cystic fibrosis Factsheet April 2013 Nutrition: a guide for feeding infants with cystic fibrosis Introduction Feeding a baby with cystic fibrosis (CF) is similar

More information

The meaning of. When is it best to start?

The meaning of. When is it best to start? 1 2 The meaning of When is it best to start? There comes a time when a baby needs more nourishment than breast or infant alone can provide. Government guidelines strongly encourage mothers to breast-feed

More information

Introduction to WIC. Objectives

Introduction to WIC. Objectives Objectives Introduction to WIC After completing this lesson, you will be able to: Describe the participants served by WIC. Describe how WIC improves the health of participants. Identify the history and

More information

HS40. Healthy Start A guide for retailers

HS40. Healthy Start A guide for retailers HS40 Healthy Start A guide for retailers Information in this leaflet is valid from 6 April 2011 1 Welcome to Healthy Start Healthy Start is a UK-wide government scheme that helps pregnant women, new mums

More information

How has your view of healthy eating changed during pregnancy? B Y A T H A R K H A L I D A N D D A F I N A N I S H O R I

How has your view of healthy eating changed during pregnancy? B Y A T H A R K H A L I D A N D D A F I N A N I S H O R I How has your view of healthy eating changed during pregnancy? B Y A T H A R K H A L I D A N D D A F I N A N I S H O R I Hypothesis Decisions based on eating choices would shift towards the healthy alternative

More information

Calcium and Vitamin D: Important at Every Age

Calcium and Vitamin D: Important at Every Age Calcium and Vitamin D: Important at Every Age National Institutes of Health Osteoporosis and Related Bone Diseases ~ National Resource Center 2 AMS Circle Bethesda, MD 20892-3676 Tel: (800) 624-BONE or

More information

Introducing Solid Foods. Giving your baby a better start in life

Introducing Solid Foods. Giving your baby a better start in life Introducing Solid Foods Giving your baby a better start in life Starting your baby on solids Often called weaning, introducing solid foods should start when your baby is around 6 months old. Gradually,

More information

INFANTS AND YOUNG CHILD FEEDING (UPTO 2 YEARS)

INFANTS AND YOUNG CHILD FEEDING (UPTO 2 YEARS) INFANTS AND YOUNG CHILD FEEDING (UPTO 2 YEARS) Breastfeeding is the best way to satisfy the nutritional and psychological needs of the baby. Mother s milk (breast milk, human milk) contains all nutrients

More information

Nutrition Requirements

Nutrition Requirements Who is responsible for setting nutrition requirements in the UK? In the UK we have a set of Dietary Reference Values (DRVs). DRVs are a series of estimates of the energy and nutritional requirements of

More information

CENTRAL SURREY HEALTH BREASTFEEDING POLICY

CENTRAL SURREY HEALTH BREASTFEEDING POLICY CENTRAL SURREY HEALTH BREASTFEEDING POLICY PRINCIPLES To ensure that all children receive a chance to grow and develop to their fullest potential, it is not enough simply to make breastfeeding possible;

More information

Baby Steps To A Healthy Pregnancy

Baby Steps To A Healthy Pregnancy Preconception Middlesex-London Health Unit 50 King Street, London, ON N6A 5L7 519-663-5317 Published 2015. Copyright of the Middlesex London Health Unit. All rights reserved. Baby Steps To A Healthy Pregnancy

More information

Preconception Care: Things to Do before You Become Pregnant

Preconception Care: Things to Do before You Become Pregnant Preconception Care: Things to Do before You Become Pregnant Planning a pregnancy with someone that you love can be exciting and rewarding. There are many things for you and your partner to consider before

More information

REDUCING YOUR RISK OF BREAST CANCER

REDUCING YOUR RISK OF BREAST CANCER REDUCING YOUR RISK OF BREAST CANCER Breast cancer is the most common cancer in the UK. One in eight women develop the disease at some stage in their lifetimes. Breast cancer is rare in men, with around

More information

F r e q u e n t l y As k e d Qu e s t i o n s

F r e q u e n t l y As k e d Qu e s t i o n s page 1 Folic Acid Q: What is folic acid? A: Folic (FOH-lik) acid is a B vitamin. It helps the body make healthy new cells. Folic acid and folate mean the same thing. Folic acid is a manmade form of folate.

More information

Women and Children s Directorate

Women and Children s Directorate Women and Children s Directorate Gestational diabetes mellitus Milton Keynes Hospital NHS Foundation Trust Standing Way, Eaglestone, Milton Keynes, MK6 5LD Telephone: 01908 660033 Page 1 of 8 What is gestational

More information

If a child or adult needs to avoid cows milk, remember that it may be present in many foods, such as:

If a child or adult needs to avoid cows milk, remember that it may be present in many foods, such as: Milk Allergy Cows milk allergy affects around 3 6% of (3 6 in every 100) infants and young children who usually start to have symptoms in their first few months. This causes many health problems and is

More information

PERINATAL NUTRITION. Nutrition during pregnancy and lactation. Nutrition during infancy.

PERINATAL NUTRITION. Nutrition during pregnancy and lactation. Nutrition during infancy. PERINATAL NUTRITION Nutrition during pregnancy and lactation Nutrition during infancy. Rama Bhat, MD. Department of Pediatrics, University of Illinois Hospital Chicago, Illinois. Nutrition During Pregnancy

More information

The Bronx Health Link

The Bronx Health Link Monthly Newsletter The Bronx Health Link MARCH 2007 Gestational Diabetes Y ou are 28 weeks pregnant. Your health care provider has just told you that you have gestational (ges-tay-shun-all) diabetes. Should

More information

Deciding whether to become a parent

Deciding whether to become a parent Deciding whether to become a parent This information is an extract from the booklet, Relationships, sex and fertility for young people affected by cancer. You may find the full booklet helpful. We can

More information

CORPORATE HEALTH LOWERING YOUR CHOLESTEROL & BLOOD PRESSURE

CORPORATE HEALTH LOWERING YOUR CHOLESTEROL & BLOOD PRESSURE CORPORATE HEALTH LOWERING YOUR CHOLESTEROL & BLOOD PRESSURE What is Cholesterol? What s wrong with having high cholesterol? Major risk factor for cardiovascular disease Higher the cholesterol higher the

More information

Nutrient Reference Values for Australia and New Zealand

Nutrient Reference Values for Australia and New Zealand Nutrient Reference Values for Australia and New Zealand Questions and Answers 1. What are Nutrient Reference Values? The Nutrient Reference Values outline the levels of intake of essential nutrients considered,

More information

Your Results. For more information visit: www.sutton.gov.uk/healthchecks. Name: Date: In partnership with

Your Results. For more information visit: www.sutton.gov.uk/healthchecks. Name: Date: In partnership with Your Results Name: Date: For more information visit: www.sutton.gov.uk/healthchecks In partnership with Introduction Everyone is at risk of developing diabetes, heart disease, kidney disease, stroke and

More information

Healthy eating for breastfeeding mothers

Healthy eating for breastfeeding mothers Healthy eating for breastfeeding mothers Healthy eating is important when you are breastfeeding. Your body has a greater need for most nutrients. Some of the extra energy required for breastfeeding comes

More information

Is there a baby in your future? Plan for it.

Is there a baby in your future? Plan for it. Is there a baby in your future? Plan for it. You plan for school, work, holidays and even your retirement. What about your baby? Parenting begins long before your baby is conceived. Babies begin to develop

More information

6 Steps to Lipo-Light and/or Lipo-Light Pro Success

6 Steps to Lipo-Light and/or Lipo-Light Pro Success 6 Steps to Lipo-Light and/or Lipo-Light Pro Success Optimize your Lipo-Light and/or Lipo-Light Pro results by: 1. Maintaining youy workout regimen. If you do not workout, walk for 30 minutes each day throughout

More information

DIABETES & HEALTHY EATING

DIABETES & HEALTHY EATING DIABETES & HEALTHY EATING Food gives you the energy you need for healthy living. Your body changes most of the food you eat into a sugar called glucose. (glucose) Insulin helps your cells get the sugar

More information

Pregnancy Planning. Eat a nutritious, well-balanced diet

Pregnancy Planning. Eat a nutritious, well-balanced diet Pregnancy Planning Your health and habits affect a baby from the earliest days of a pregnancy. Before you find out for sure that you are pregnant, a great deal has already happened. Your baby's major organs

More information

Presentation Prepared By: Jessica Rivers, BASc., PTS

Presentation Prepared By: Jessica Rivers, BASc., PTS Presentation Prepared By: Jessica Rivers, BASc., PTS Presentation Outline Why should we care about our eating habits? Why is nutrition so important as we age? How do we know if we are eating healthy? What

More information

Nutrition Information from My Plate Guidelines

Nutrition Information from My Plate Guidelines Nutrition Information from My Plate Guidelines Note: This information was compiled from the website: http://www.choosemyplate.gov/ for participants in the 4-H Food Prep Contest 1/12/16. The information

More information

Florida Department of Health WIC Program. This institution is an equal opportunity provider. 1/2016 1

Florida Department of Health WIC Program. This institution is an equal opportunity provider. 1/2016 1 Florida Department of Health WIC Program This institution is an equal opportunity provider. 1/2016 1 EBT stands for Electronic Benefits Transfer. EBT is a simple, secure, and convenient way to buy your

More information

Section C. Diet, Food Production, and Public Health

Section C. Diet, Food Production, and Public Health This work is licensed under a Creative Commons Attribution-NonCommercial-ShareAlike License. Your use of this material constitutes acceptance of that license and the conditions of use of materials on this

More information

Insulin Dependent Diabetes Trust

Insulin Dependent Diabetes Trust Insulin Dependent Diabetes Trust Type 2 and You April 2010 Registered Company Number 3148360 Registered Charity No 1058284 Welcome to the third issue of Type 2 and You. In this issue we look at healthy

More information

Self-care guide for people with diabetes

Self-care guide for people with diabetes Self-care guide for people with diabetes English Version Supported by an unrestricted grant from 1 When the diagnosis is diabetes..................03 What is diabetes?............................04 What

More information

DIET AND ECZEMA IN CHILDREN

DIET AND ECZEMA IN CHILDREN DIET AND ECZEMA IN CHILDREN It has been known for many years that what children eat may have an effect on their eczema. There has been an ever-increasing interest in the part that diet plays in the development

More information

Homework Help Heart Disease & Stroke

Homework Help Heart Disease & Stroke Preventing Heart Disease & Stroke What causes heart disease and stroke? high blood pressure high cholesterol diabetes smoking stress drinking too much alcohol not being physically active being overweight

More information

Making Healthy Food Choices. Section 2: Module 5

Making Healthy Food Choices. Section 2: Module 5 Making Healthy Food Choices Section 2: Module 5 1 Nutrition For Health What is healthy Tips on planning meals Making a shopping list/ Bulk orders Using WIC foods Cook and freeze What foods to choose How

More information

Save Time and Money at the Grocery Store

Save Time and Money at the Grocery Store Save Time and Money at the Grocery Store Plan a Grocery List Making a list helps you recall items you need and also saves you time. Organize your list according to the layout of the grocery store. For

More information

Unit 1.1 Support healthy lifestyles for children through the provision of food and nutrition

Unit 1.1 Support healthy lifestyles for children through the provision of food and nutrition Theme 1: Health and well-being Unit 1.1 Support healthy lifestyles for children through the provision of food and nutrition This unit provides the learner with the knowledge, understanding and skills to

More information

Vitamin D. Why Vitamin D is important and how to get enough

Vitamin D. Why Vitamin D is important and how to get enough Vitamin D Why Vitamin D is important and how to get enough Why is vitamin D vital for health? Vitamin D is needed by the body for both physical and mental health, but is best known for making sure bones

More information

Nutrition for Family Living

Nutrition for Family Living Susan Nitzke, Nutrition Specialist; susan.nitzke@ces.uwex.edu Sherry Tanumihardjo, Nutrition Specialist; sherry.tan@ces.uwex.edu Amy Rettammel, Outreach Specialist; arettamm@facstaff.wisc.edu Betsy Kelley,

More information

Canada s Food Guide Jeopardy

Canada s Food Guide Jeopardy Canada s Food Guide Jeopardy Drafted: July 2008 Revised: December 2012 Eating Well with Canada s Food Guide Veg & Fruit Grain Products Milk & Alternatives Meat & Alternatives Physical Activity Miscellaneous

More information

Position Statement on Breastfeeding

Position Statement on Breastfeeding ABN 64 005 081 523 RTO 21659 Applies to All ABA staff and volunteers Position statement The Australian Breastfeeding Association (ABA) endorses the following statement from the Joint WHO/ UNICEF Meeting

More information

A healthy cholesterol. for a happy heart

A healthy cholesterol. for a happy heart A healthy cholesterol for a happy heart cholesterol A healthy cholesterol for a happy heart You probably already know that cholesterol has something to do with heart disease. But like many people, you

More information

healthy eating for gestational diabetes

healthy eating for gestational diabetes Talking diabetes No.19 healthy eating for gestational diabetes Gestational diabetes occurs in 5 8% of Australian women during pregnancy. It happens because the changing hormone levels in the body have

More information

Health visiting programme external webinar. 21 st November 2014 09.00-10.00. Health Visiting Week of Action: Get involved! #HVPWofAction #PHPCYPWeek

Health visiting programme external webinar. 21 st November 2014 09.00-10.00. Health Visiting Week of Action: Get involved! #HVPWofAction #PHPCYPWeek Health visiting programme external webinar 21 st November 2014 09.00-10.00 Health Visiting Week of Action: Get involved! #HVPWofAction #PHPCYPWeek Health Visiting Programme Team Sabrina Fuller- Head of

More information

Selection and Preparation of Foods Management of the Food Budget*

Selection and Preparation of Foods Management of the Food Budget* Selection and Preparation of Foods Management of the Food Budget* Healthy meals on a limited budget! How can you serve healthy meals on a limited budget? It takes some time and planning, but you and your

More information

Scientific Recommendations for Healthy Eating Guidelines in Ireland

Scientific Recommendations for Healthy Eating Guidelines in Ireland Scientific Recommendations for Healthy Eating Guidelines in Ireland 2011 Scientific Recommendations for Healthy Eating Guidelines in Ireland Published by: Food Safety Authority of Ireland Abbey Court,

More information

Maternal and pre-school child nutrition guidelines

Maternal and pre-school child nutrition guidelines Maternal and pre-school child nutrition guidelines October 2012 Table of Contents Page Acknowledgements 6 1. Introduction 7 2. Aims and Objectives 9 SECTION 1: Pre Conception and Ante Natal Nutrition 10

More information

Diabetes and stroke. What is diabetes? What are the symptoms of diabetes? Stroke Helpline: 0303 3033 100 Website: stroke.org.uk

Diabetes and stroke. What is diabetes? What are the symptoms of diabetes? Stroke Helpline: 0303 3033 100 Website: stroke.org.uk Stroke Helpline: 0303 3033 100 Website: stroke.org.uk Diabetes and stroke Diabetes is a condition caused by too much sugar in your blood. There are over three million people in the UK who have diabetes.

More information

Off to the best start

Off to the best start Off to the best start Important information about feeding your baby existing In this leaflet What is Start4Life? 3 The best start for your baby 4 What does breastfeeding help protect against? 5 After your

More information

gestational diabetes my pregnancy, my baby, and me

gestational diabetes my pregnancy, my baby, and me gestational diabetes my pregnancy, my baby, and me What is Gestational Diabetes? Gestational diabetes occurs when your body cannot make adequate use of sugar in the blood. It is first found during pregnancy.

More information

pregnant pregnant pregnant pregnant pregnan pregnant ant pregnant pregnant pregnant egnant pregnant pregnant pregnant pregnant pregna

pregnant pregnant pregnant pregnant pregnan pregnant ant pregnant pregnant pregnant egnant pregnant pregnant pregnant pregnant pregna Pregnant and don t know what to do? A guide to your options pregna regnant ant pregnan egnant 2 3 Are you but not sure you want to have the baby? Do you need more information about the options available

More information

Why your weight matters during pregnancy and after birth

Why your weight matters during pregnancy and after birth Information for you Published in November 2011 (next review date: 2015) Why your weight matters during pregnancy and after birth Most women who are overweight have a straightforward pregnancy and birth

More information

Breastfeeding vs. Formula Feeding

Breastfeeding vs. Formula Feeding KidsHealth.org The most-visited site devoted to children's health and development Breastfeeding vs. Formula Feeding A Personal Decision Choosing whether to breastfeed or formula feed your baby is one of

More information

A guide to infant formula for parents who are bottle feeding

A guide to infant formula for parents who are bottle feeding A guide to infant formula for parents who are bottle feeding Introduction This document is designed to help parents who are not breastfeeding decide which infant formula to use to feed their baby. There

More information

Physical health & nutrition

Physical health & nutrition Physical health & nutrition RET0254 Key points People with severe mental illness are at higher risk of some physical health problems, such as diabetes, heart disease, obesity and stroke. People with severe

More information

Alcohol and Reproduction

Alcohol and Reproduction The facts about... Alcohol and Reproduction Five key things you need to know Even small amounts of alcohol can interfere with our reproductive systems. The more you drink, the greater the effect it can

More information

Diet and haemodialysis

Diet and haemodialysis Diet and haemodialysis This leaflet is for patients with kidney disease who are receiving haemodialysis treatment. If you have any further questions, please contact us using the details below and on the

More information

25. CONTROLLING DIABETES DURING / BEFORE PREGNANCY

25. CONTROLLING DIABETES DURING / BEFORE PREGNANCY Health Administrator Vol: XXII Number 1& 2-2009 : 118-122 25. CONTROLLING DIABETES DURING / BEFORE PREGNANCY Phyllis Ring Many doctors once discouraged women with diabetes from having children at all,

More information

BENEFITS OF BREASTFEEDING

BENEFITS OF BREASTFEEDING BENEFITS OF BREASTFEEDING There are many benefits to breastfeeding. Even if you are able to do it for only a short time, your baby's immune system can benefit from breast milk. Here are many other benefits

More information

Nutrition and Exercise During Pregnancy

Nutrition and Exercise During Pregnancy Nutrition and Exercise During Pregnancy Introduction Healthy eating and exercising are important for a healthy pregnancy. This reference summary will give you tips on eating and exercising during pregnancy.

More information

FEEDING YOUR BABY. From Six Months to One Year. Your guide to help you introduce solid food to your baby

FEEDING YOUR BABY. From Six Months to One Year. Your guide to help you introduce solid food to your baby FEEDING YOUR BABY From Six Months to One Year Your guide to help you introduce solid food to your baby ACKNOWLEDGEMENTS The Best Start Resource Centre would like to thank the Nutrition Resource Centre

More information

1. What are anti-epileptic drugs? Anti-epileptic drugs (AEDs) are prescribed to control seizures. They do not cure epilepsy.

1. What are anti-epileptic drugs? Anti-epileptic drugs (AEDs) are prescribed to control seizures. They do not cure epilepsy. 14 FREQUENTLY ASKED QUESTIONS ON ANTI- EPILEPTIC DRUGS 1. What are anti-epileptic drugs? Anti-epileptic drugs (AEDs) are prescribed to control seizures. They do not cure epilepsy. 2. When should treatment

More information

There are a wide range of factors that can impact on the health of the hair and hair growth.

There are a wide range of factors that can impact on the health of the hair and hair growth. Welcome to Viviscal Viviscal, one of the best selling hair growth supplement in the US, is now available with TVSN. The Viviscal brand of hair care products is enjoying rapid and substantial growth in

More information

Dietary advice for people starting treatment for Hepatitis C. Information for patients Sheffield Dietetics

Dietary advice for people starting treatment for Hepatitis C. Information for patients Sheffield Dietetics Dietary advice for people starting treatment for Hepatitis C Information for patients Sheffield Dietetics Do I need to follow a special diet? You don t need to have a special diet but you should try and

More information

To provide support and advice for young women who are pregnant and young parents.

To provide support and advice for young women who are pregnant and young parents. Teenage Pregnancy Description To provide support and advice for young women who are pregnant and young parents. Different approaches/programmes/interventions The Isle of Wight Integrated Sexual Health

More information

Take Control Nutrition Tools for Diabetes. 50/50 plate Portions Servings

Take Control Nutrition Tools for Diabetes. 50/50 plate Portions Servings Take Control Nutrition Tools for Diabetes 50/50 plate Portions Servings Eat more Vegetables Especially non starchy vegetables Choosing Foods to manage blood glucose Select a variety of colors and types

More information

The affordability of healthy eating for low-income households

The affordability of healthy eating for low-income households Policy Briefing October 2009 The affordability of healthy eating for low-income households Introduction Healthy Food for All is an all-island multiagency initiative which seeks to combat food poverty by

More information

Diet and Arthritis. Dr Áine O Connor Nutrition Scientist. British Nutrition Foundation. 2011 The British Nutrition Foundation

Diet and Arthritis. Dr Áine O Connor Nutrition Scientist. British Nutrition Foundation. 2011 The British Nutrition Foundation Diet and Arthritis Dr Áine O Connor Nutrition Scientist British Nutrition Foundation Outline Background What is arthritis? What are the common forms? Body weight and arthritis Diet and arthritis Nutrients

More information

Income is the most common measure

Income is the most common measure Income Goal A healthy standard of living for all Income is the most common measure of socioeconomic status, and a strong predictor of the health of an individual or community. When assessing the health

More information

Food Poverty and Health

Food Poverty and Health Briefing Statement Introduction In the UK, the poorer people are, the worse their diet, and the more diet-related diseases they suffer from. This is food poverty. 1 Poor diet is a risk factor for the UK

More information

Are you worried about prostate cancer? 1

Are you worried about prostate cancer? 1 Are you worried about prostate cancer? 1 Are you worried about prostate cancer? This information is from the leaflet Are you worried about prostate cancer? You may find the full leaflet helpful. We can

More information

Breast cancer risk assessment: high risk

Breast cancer risk assessment: high risk Breast cancer risk assessment: high risk This leaflet is for women with a high risk of breast cancer (following a family history risk assessment). It gives information on how common breast cancer is, screening,

More information

Maintaining Nutrition as We Age

Maintaining Nutrition as We Age SS-207-06 For more information, visit the Ohio Department of Aging web site at: http://www.goldenbuckeye.com and Ohio State University Extension s Aging in Ohio web site at: http://www.hec.ohio-state.edu/famlife/aging

More information

Healthy Eating during Pregnancy and Breastfeeding

Healthy Eating during Pregnancy and Breastfeeding WORLD HEALTH ORGANIZATION Regional Office for Europe Nutrition and Food Security Healthy Eating during Pregnancy and Breastfeeding Booklet for mothers 2001 EUR/01 5028598 ORIGINAL: ENGLISH UNEDITED E73182

More information

Spotlight: Improved Services for Clients with Qualifying Conditions

Spotlight: Improved Services for Clients with Qualifying Conditions Spotlight: Improved Services for Clients with Qualifying Conditions The new food package for clients with s provides a unique opportunity to coordinate better services for clients. Not only does it improve

More information

Building blocks for a better start in life

Building blocks for a better start in life 6 Building blocks for a better start in life baby moves sweet as they are 5 taste for life no rush to mush 3 every day counts 2 mum s milk 1 Welcome......to start4life start4life Happy, healthy babies

More information

Your child s heart problem and dental care

Your child s heart problem and dental care Your child s heart problem and dental care Contents p.3 Why is dental health important for my child? p.3 What is tooth decay and what causes it? p.4 How can I prevent this from happening to my child? p.6

More information

It is important to know that some types of fats, like saturated and trans fat, can raise blood cholesterol levels.

It is important to know that some types of fats, like saturated and trans fat, can raise blood cholesterol levels. Healthy Eating You are what you eat! So before you even shop for food, it is important to become a well informed, smart food consumer and have a basic understanding of what a heart healthy diet looks like.

More information

FACT SHEET N 394 UPDATED MAY 2015. Healthy diet

FACT SHEET N 394 UPDATED MAY 2015. Healthy diet FACT SHEET N 394 UPDATED MAY 2015 Healthy diet KEY FACTS n A healthy diet helps protect against malnutrition in all its forms, as well as noncommunicable diseases (NCDs), including diabetes, heart disease,

More information

Tackling overweight and obesity

Tackling overweight and obesity B Tackling overweight and obesity Government action on overweight and obesity Children: healthy growth and healthy weight Promoting healthier food choices Building physical activity into our lives Creating

More information

Nutrition During Pregnancy

Nutrition During Pregnancy Nutrition During Pregnancy A balanced diet is a basic part of good health at all times in your life. During pregnancy, your diet is even more important. The foods you eat are the main source of nutrients

More information

Prenatal Programming. The Ten Principles of Prenatal Planning

Prenatal Programming. The Ten Principles of Prenatal Planning THE PRENATAL PRESCRIPTION The prevailing scientific consensus is that nutritional health during pregnancy imprints us for the rest of our life, and that the chronic diseases we may experience later, either

More information