Apply PERL to BioInformatics (II)
|
|
|
- Kathryn Fowler
- 10 years ago
- Views:
Transcription
1 Apply PERL to BioInformatics (II) Lecture Note for Computational Biology 1 (LSM 5191) Jiren Wang BioInformatics Institute Singapore
2 Outline Some examples for manipulating biological sequence data. Create Graphical User Interface to BLAST Introduction to BioPerl
3 Concatenating DNA Fragments #!/usr/bin/perl w # Calculating the reverse complement of a strand of DNA $DNA1 = AGCGGGCCAGACGCAGCCGAGTATCTT ; $DNA2 = GTGGAGTTCCGCCGCTGTTCTTCT ; $DNA3 = $DNA1. $DNA2; print The concatenation of the two fragments is: ; print $DNA3\n\n ;
4 Extracting a Subsequence Function substr Three arguments: a string value, a start position, and a length. #!/usr/bin/perl w $sequence = MVLERILLQTIKFDLQVEHPYQFLLKYAKQLK. GDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPE. IIAVAVMYLAGRLCKFEIQEWTSKP ; $start = 8; $length = 10; $subsequence = substr($sequence, $start, $length); print The subsequence is: $subsequence\n\n ; # The subsequence is: QTIKFDLQVE
5 Reversing Complement of Sequence #!/usr/bin/perl w # Calculating the reverse complement of a strand of DNA $DNA = ACGGGAGCGGAAAATTACGGCATTAGC ; $revcom = reverse $DNA; # $revcom =~ s/a/t/g; # $revcom =~ s/t/a/g; # $revcom =~ s/g/c/g; # $revcom =~ s/c/g/g; $revcom =~ tr/acgtacgt/tgcatgca/;
6 Input from STDIN Filehandle A filehandle is just a name you give to a file, device, socket, or pipe to help you remember which one you are talking about. STDIN in Perl is a filehandle for standard input. chomp function removes all trailing newlines from string(s) in paragraph mode ($/ is empty). $a = = <STDIN>;
7 Motifs Motifs are short segments of DNA or protein that are of particular interest. Looking for motifs are one of the most common things in bioinformatics. Motifs may be regulatory elements of DNA or short stretches of protein that are known to conserved across many species. Motifs can often be represented as regular expressions.
8 Finding Motifs #!/usr/bin/perl w print Enter the sequence file name: ; $filename = <STDIN>; chomp $filename; open(in, $filename ) die Cannot open file. = <IN>; close IN; $seq = join(,@seqs); $seq =~ s/\s//g; Print Enter the motif: ; $motif = <STDIN>; chomp $motif; if ($seq =~ /$motif/) { print The motif $motif has been found.\n ; } else { print The motif $motif hasn t been found.\n ; }
9 Stand-alone BLAST Steps for downloading and installing standalone BLAST executables $ ftp ftp.ncbi.nih.gov Name (ftp.ncbi.nih.gov:username): anonymous Password: anonymous ftp>cd blast/executables ftp>bin ftp>get blast.linux.tar.z ftp>quit $gunzip blast.linux.tar.z $tar xvf blast.linux.tar
10 Program blastall Some arguments -p Program Name [String] -d Database [String] default = nr -i Query File [File In] -e Expectation value (E) [Real] default = T Produce HTML output [T/F] default = F
11 Table of BLAST Programs Program blastp blastn blastx tblastn tblastx Description compares an amino acid query sequence against a protein sequence database. compares a nucleotide query sequence against a nucleotide sequence database. compares a nucleotide query sequence translated in all reading frames against a protein sequence database. compares a protein query sequence against a nucleotide sequence database dynamically translated in all reading frames. compares the six-frame translations of a nucleotide query sequence against the six-frame translations of a nucleotide sequence database.
12 Program formatdb Some arguments -i Input file(s) for formatting -p Type of file T protein, F nucleotide. -o Parse options: T - True: Parse SeqId and create indexes. F - False: Do not parse SeqId. Do not create indexes. -n Base name for BLAST files [String] formatdb -i testdb.txt p F o T n testdb
13 Package and Module Package A package is simply a set of Perl statements assigned to a user defined name space. Package declaration: package NAMESPACE Module A module is just a reusable package that is defined in a library file whose name is the same as the name of the package (with a.pm on the end). Include Perl modules in your program: use Module.
14 Introduction to CGI The CGI.pm module CGI Common Gateway Interface CGI.pm is a module for programming interactive web pages. Its functions are geared toward formatting web pages and creating and processing forms in which user enter information.
15 How a CGI Application Is Executed?
16 Forms and CGI HTML forms Provide input to your CGI scripts. The <form> tag <form action= /cgi-bin/test.cgi method= post > </form>
17 Quick Reference to Form Tags <FORM ACTION= /cgi-bin/test.cgi METHOD= POST <INPUT TYPE= text NAME= name VALUE= value SIZE= size > <INPUT TYPE= password NAME= name VALUE=value SIZE= size > <INPUT TYPE= hidden NAME= name VALUE= value > <INPUT TYPE= checkbox NAME= name VALUE= value > <INPUT TYPE= radio NAME= name VALUE= value > <SELECT NAME= name SIZE=1> <OPTION SELECTED>Item One</OPTION> <OPTION>Item Two</OPTION> </SELECT> <TEXTAREA ROWS=yy COLS=xx NAME= name > </TEXTAREA> <INPUT TYPE= submit NAME= name VALUE= value > <INPUT TYPE= reset VALUE= value > </FORM> Form Tag Description Start the form Text field Password field Hidden field Checkbox Radio button Menu (drop-down) Multiline text field Submit button Reset button End the form
18 Form Action and Method Action Specifies the URL of the CGI script that should receive the HTTP request made by the CGI script. HTTP HyperText Transfer Protocol. Method Specifies the HTTP request method used when calling the CGI script. GET is the standard request method for retrieving a document via HTTP on the Web. POST is used with HTML forms to submit information that alters data stored on the web server.
19 Example of HTML <HTML> <TITLE>BLAST Search </TITLE> <H1><CENTER>BLAST <FORM ACTION="/cgi-bin/blast/blast.pl" METHOD = POST NAME="MainBlastForm" ENCTYPE= "multipart/form-data"> <B>Choose program to use and database to search:</b> <P> <a href="docs/blast_program.html">program</a> <select name = "PROGRAM"> <option> blastn <option> blastp <option> blastx <option> tblastn <option> tblastx </select> <a href="docs/blast_databases.html">database</a>
20 Example of HTML (cont d) <select name = "DATALIB"> <option VALUE = "nr"> nr <option VALUE = "swissprot"> swissprot <option VALUE = "pat"> pat <option VALUE = "yeast"> yeast <option VALUE = "ecoli"> ecoli <option VALUE = "pdb"> pdb <option VALUE = "drosoph"> Drosophila genome <option VALUE = "month"> month <option VALUE = "est"> est <option VALUE = "est_human"> est_human <option VALUE = "est_mouse"> est_mouse <option VALUE = "est_others"> est_others <option VALUE = "htg"> htgs <option VALUE = "gss"> gss <option VALUE = "sts"> dbsts <option VALUE = "mito"> mito <option VALUE = "vector"> vector </select>
21 Example of HTML (cont d) <P> Enter sequence below in <a href="docs/fasta.html">fasta</a> format <BR> <textarea name="sequence" rows=6 cols=60> </textarea> <BR> Set subsequence From: <INPUT TYPE="text" NAME="FROM" SIZE=6> To: <INPUT TYPE="text" NAME="TO" SIZE=6> <P> <INPUT TYPE="button" VALUE="Clear sequence" onclick="mainblastform.sequence.value='';mainblastform.sequence.focus();"> <INPUT TYPE="reset" VALUE="Reset"> <INPUT TYPE="submit" VALUE="Search"> </FORM> </HTML> Note: focus() moving cursor back to a field.
22 Screenshot of GUI for BLAST
23 Process Filehandle Using processes as filehandles Create a process-filehandle that either captures the output from the process or provides input to the process. Open a process-filehandle for reading by putting the vertical bar on the right of the command. #!/usr/bin/perl open(lsproc, "ls = <LSPROC>; close(lsproc);
24 CGI Program #!/usr/bin/perl -w use strict; use CGI; my ($form, $program, $datalib, $sequence, $from, $to); my ($length); my my ($state, $line, $title, $seq); my ($seqfilename, $options); print "Content-type: text/html\n\n"; $form = new CGI; $program = $form->param('program'); $datalib = $form->param('datalib'); $sequence = $form->param('sequence'); $from = $form->param('from'); $to = $form->param('to');
25 CGI Program (cont d) if ($sequence ne ) { $state = 0; $seq = ""; my (@lines) = split /\n/, $sequence; foreach $line (@lines) { if ($line =~ /^>/) { $state++; if ($state == 1) { $title = $line; $title =~ s/^[\s]+//; $title =~ s/[\s]+$//; } } else { if ($state == 1) { $seq.= $line; } } } $seq =~ s/[\s]+//g; $seq =~ tr/a-z/a-z/; $length = length($seq);
26 CGI Program (cont d) if (($to > $from) && ($from < $length) && ($to > 1)) { if ($from < 0) { $from = 0; } if ($to > $length) { $to = $length; } $seq = substr($seq, $from - 1, $to - $from + 1); } $seqfilename = /tmp/seq ; open(out, ">$seqfilename"); print OUT "$title\n$seq"; close(out); $options = "-T -p $program -d /ncbi/blast/db/$datalib -i $seqfilename"; open(in, /ncbi/blast/executables/blastall $options "); while(<in>) { print $_; } close(in); } else { print Please enter the query sequence in FASTA format.<br> ; }
27 Introduction to BioPerl BioPerl An important collection of Perl code for bioinformatics that has been in development since Dedicate to the creation of an open source Perl tools for bioinformatics, genomics and life science research.
28 The Main Focus of Bioperl Modules Perform sequence manipulation. Provide access to various databases (both local and web-based). Parsing of the results of various molecular biology programs.
29 Modules for Typical Tasks Accessing sequence data from local and remote database. Transforming formats of database / file records. Manipulating individual sequences. Searching for "similar" sequences. Creating and manipulating sequence alignments. Searching for genes and other structures on genomic DNA. Developing machine readable sequence annotations.
30 PERL s Objects An object is simply a referenced thingy that happens know which class it belongs to. A class is simply a package that happens to provide methods to deal with objects. A method is simply a subroutine that expects an object reference as its first argument.
31 Method Invocation The object-oriented syntax form looks like this: CLASS_OR_INSTANCE->METHOD(LIST)
32 Sequence File seqa.fasta > seq1 MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS NSSWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAG SLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYS RTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ > seq2 APEAQVSVQPNFQPDKFLGRWFSAGLASNSSWLQEKKAALSMCKSVVAPA ADGGFNLTSTFLRKNQCETRTMLLQPGDSLGSYSYRSPHWGSTYSVSVVE TDYDHYALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEKFTAFCKAQGF TEDSIVFLPQTDKCMTEQ
33 Bio::SeqIO Bio::SeqIO is a handler module for the formats in the SeqIO set (eg, Bio::SeqIO::fasta). #!/usr/bin/perl -w use Bio::SeqIO; $str = Bio::SeqIO->new( -file=>'seqa.fasta', '-format' => 'Fasta'); $input = $str->next_seq(); $input2 = $str->next_seq(); print "Sequence 1\n"; print $input->id, "\n"; print $input->seq, "\n\n"; print "Sequence 2\n"; print $input2->id, "\n"; print $input2->seq, "\n\n";
34 Example: Sequence Data Format Transfer #!/usr/bin/perl -w use Bio::SeqIO; use strict; my $in = Bio::SeqIO->new('-file' => "seqa.fasta", '-format' => 'Fasta'); my $out = Bio::SeqIO->new('-file' => ">seqa.embl", '-format' => 'EMBL'); while ( my $seq = $in->next_seq() ) { $out->write_seq($seq); }
35 Example: Sequence Data Format Transfer (cont d) Output result: ID seq1 standard; AA; UNK; 190 BP. XX AC unknown; XX DE XX FH Key Location/Qualifiers FH XX SQ Sequence 190 BP; 17 A; 4 C; 14 G; 17 T; 138 other; mathhtlwmg lallgvlgdl qaapeaqvsv qpnfqqdkfl grwfsaglas nsswlrekka 60 alsmcksvva patdgglnlt stflrknqce trtmllqpag slgsysyrsp hwgstysvsv 120 vetdydqyal lysqgskgpg edfrmatlys rtqtpraelk ekftafckaq gftedtivfl 180 pqtdkcmteq 190 // ID seq2 standard; AA; UNK; 168 BP. XX AC unknown; XX DE XX FH Key Location/Qualifiers FH XX SQ Sequence 168 BP; 14 A; 4 C; 11 G; 13 T; 126 other; apeaqvsvqp nfqpdkflgr wfsaglasns swlqekkaal smcksvvapa adggfnltst 60 flrknqcetr tmllqpgdsl gsysyrsphw gstysvsvve tdydhyally sqgskgpged 120 frmatlysrt qtpraelkek ftafckaqgf tedsivflpq tdkcmteq 168 //
36 Bio::Tools::Run::StandAloneBlast #!/usr/bin/perl -w use Bio::Tools::Run::StandAloneBlast; # use the following array to input = ('d' => 'swissprot', 'o' => 'blast.out', '_READMETHOD' => 'Blast', 'T' => 'F', 'p' => 'blastp' ); $factory = Bio::Tools::Run::StandAloneBlast->new(@params); # Blast a sequence against a database: $str = Bio::SeqIO->new( -file=>'seqa.fasta', '-format' => 'Fasta'); $input = $str->next_seq(); print "Generate the searching result now: \n"; $blast_report = $factory->blastall($input);
37 Input Sequence for ClustalW >seq1 MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS NSSWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAG SLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYS RTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ >seq2 APEAQVSVQPNFQPDKFLGRWFSAGLASNSSWQEKKAALSMCKSVVAPA ADGGFNLTSTFLKNQCETRTMLLQPGDSLGSYSYRSPHWGSTYSVSVVE TDYDHYALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEKFAFCKAQGF TEDSIVFLPQTDKCMTEQ >seq3 MAALRMLWMGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLAS NSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAG APGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYS RTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE
38 Bio::Tools::Run::Alignment::Clustalw #!/usr/bin/perl -w use strict; use Bio::Tools::Run::Alignment::Clustalw; my $inputfilename = 'seq.txt'; my $outfile = "clustalw_result.txt"; # Build a clustalw alignment factory = ('ktuple' => 2, 'matrix' => 'BLOSUM', 'outfile'=> $outfile); my $factory = Bio::Tools::Run::Alignment::Clustalw->new(@params); my $clustalw_location = $factory->program("/home/webuser/clustalw1.82/clustalw"); print ("\nthe location of clustalw is $clustalw_location.\n"); # Pass the factory a list of sequences to be aligned. my $aln = $factory->align($inputfilename); # $aln is a SimpleAlign object. print " length = ", $aln->length, "\n"; print " no_residues = ", $aln->no_residues, "\n"; print " no_sequences = ", $aln->no_sequences, "\n"; print " percentage_identity = ", $aln->percentage_identity, "\n";
39 Output on Screen The location of clustalw is /home/webuser/clustalw1.82/clustalw. CLUSTAL W (1.82) Multiple Sequence Alignments Sequence format is Pearson Sequence 1: seq1 190 aa Sequence 2: seq2 165 aa Sequence 3: seq3 189 aa Start of Pairwise alignments Aligning... Sequences (1:2) Aligned. Score: 95 Sequences (1:3) Aligned. Score: 72 Sequences (2:3) Aligned. Score: 70 Guide tree file created: [./seq.dnd] Start of Multiple Alignment There are 2 groups Aligning... Group 1: Sequences: 2 Score:2467 Group 2: Sequences: 3 Score:2701 Alignment Score 2488 GCG-Alignment file created [clustalw_result.txt] length = 190 no_residues = 26 no_sequences = 3 percentage_identity =
40 Output: clustalw_result.txt PileUp MSF: 190 Type: P Check: Name: seq1 oo Len: 190 Check: 5441 Weight: 23.3 Name: seq2 oo Len: 190 Check: 3046 Weight: 30.0 Name: seq3 oo Len: 190 Check: 5514 Weight: 46.6 // seq1 MATHHTLWMG LALLGVLGDL QAAPEAQVSV QPNFQQDKFL GRWFSAGLAS seq apeaqvsv QPNFQPDKFL GRWFSAGLAS seq3 MAALRMLWMG LVLLGLLGFP QTPAQGHDTV QPNFQQDKFL GRWYSAGLAS seq1 NSSWLREKKA ALSMCKSVVA PATDGGLNLT STFLRKNQCE TRTMLLQPAG seq2 NSSWQ.EKKA ALSMCKSVVA PAADGGFNLT STFLKN.QCE TRTMLLQPGD seq3 NSSWFREKKA VLYMCKTVVA PSTEGGLNLT STFLRKNQCE TKIMVLQPAG seq1 SLGSYSYRSP HWGSTYSVSV VETDYDQYAL LYSQGSKGPG EDFRMATLYS seq2 SLGSYSYRSP HWGSTYSVSV VETDYDHYAL LYSQGSKGPG EDFRMATLYS seq3 APGHYTYSSP HSGSIHSVSV VEANYDEYAL LFSRGTKGPG QDFRMATLYS seq1 RTQTPRAELK EKFTAFCKAQ GFTEDTIVFL PQTDKCMTEQ seq2 RTQTPRAELK EKF.AFCKAQ GFTEDSIVFL PQTDKCMTEQ seq3 RTQTLKDELK EKFTTFSKAQ GLTEEDIVFL PQPDKCIQE.
Internet Technologies
QAFQAZ UNIVERSITY Computer Engineering Department Internet Technologies HTML Forms Dr. Abzetdin ADAMOV Chair of Computer Engineering Department [email protected] http://ce.qu.edu.az/~aadamov What are forms?
Biological Databases and Protein Sequence Analysis
Biological Databases and Protein Sequence Analysis Introduction M. Madan Babu, Center for Biotechnology, Anna University, Chennai 25, India Bioinformatics is the application of Information technology to
RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison
RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the
BLAST. Anders Gorm Pedersen & Rasmus Wernersson
BLAST Anders Gorm Pedersen & Rasmus Wernersson Database searching Using pairwise alignments to search databases for similar sequences Query sequence Database Database searching Most common use of pairwise
CGI Programming. What is CGI?
CGI Programming What is CGI? Common Gateway Interface A means of running an executable program via the Web. CGI is not a Perl-specific concept. Almost any language can produce CGI programs even C++ (gasp!!)
07 Forms. 1 About Forms. 2 The FORM Tag. 1.1 Form Handlers
1 About Forms For a website to be successful, it is important to be able to get feedback from visitors to your site. This could be a request for information, general comments on your site or even a product
Further web design: HTML forms
Further web design: HTML forms Practical workbook Aims and Learning Objectives The aim of this document is to introduce HTML forms. By the end of this course you will be able to: use existing forms on
Forms, CGI Objectives. HTML forms. Form example. Form example...
The basics of HTML forms How form content is submitted GET, POST Elements that you can have in forms Responding to forms Common Gateway Interface (CGI) Later: Servlets Generation of dynamic Web content
Bioinformatics Grid - Enabled Tools For Biologists.
Bioinformatics Grid - Enabled Tools For Biologists. What is Grid-Enabled Tools (GET)? As number of data from the genomics and proteomics experiment increases. Problems arise for the current sequence analysis
Bioinformatics Resources at a Glance
Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences
HTML Forms. Pat Morin COMP 2405
HTML Forms Pat Morin COMP 2405 HTML Forms An HTML form is a section of a document containing normal content plus some controls Checkboxes, radio buttons, menus, text fields, etc Every form in a document
CD-HIT User s Guide. Last updated: April 5, 2010. http://cd-hit.org http://bioinformatics.org/cd-hit/
CD-HIT User s Guide Last updated: April 5, 2010 http://cd-hit.org http://bioinformatics.org/cd-hit/ Program developed by Weizhong Li s lab at UCSD http://weizhong-lab.ucsd.edu [email protected] 1. Introduction
Similarity Searches on Sequence Databases: BLAST, FASTA. Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Basel, October 2003
Similarity Searches on Sequence Databases: BLAST, FASTA Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Basel, October 2003 Outline Importance of Similarity Heuristic Sequence Alignment:
<option> eggs </option> <option> cheese </option> </select> </p> </form>
FORMS IN HTML A form is the usual way information is gotten from a browser to a server HTML has tags to create a collection of objects that implement this information gathering The objects are called widgets
Viewing Form Results
Form Tags XHTML About Forms Forms allow you to collect information from visitors to your Web site. The example below is a typical tech suupport form for a visitor to ask a question. More complex forms
Perl in a nutshell. First CGI Script and Perl. Creating a Link to a Script. print Function. Parsing Data 4/27/2009. First CGI Script and Perl
First CGI Script and Perl Perl in a nutshell Prof. Rasley shebang line tells the operating system where the Perl interpreter is located necessary on UNIX comment line ignored by the Perl interpreter End
HTML Forms and CONTROLS
HTML Forms and CONTROLS Web forms also called Fill-out Forms, let a user return information to a web server for some action. The processing of incoming data is handled by a script or program written in
When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want
1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very
Genome Explorer For Comparative Genome Analysis
Genome Explorer For Comparative Genome Analysis Jenn Conn 1, Jo L. Dicks 1 and Ian N. Roberts 2 Abstract Genome Explorer brings together the tools required to build and compare phylogenies from both sequence
JavaScript and Dreamweaver Examples
JavaScript and Dreamweaver Examples CSC 103 October 15, 2007 Overview The World is Flat discussion JavaScript Examples Using Dreamweaver HTML in Dreamweaver JavaScript Homework 3 (due Friday) 1 JavaScript
Bio-Informatics Lectures. A Short Introduction
Bio-Informatics Lectures A Short Introduction The History of Bioinformatics Sanger Sequencing PCR in presence of fluorescent, chain-terminating dideoxynucleotides Massively Parallel Sequencing Massively
Pairwise Sequence Alignment
Pairwise Sequence Alignment [email protected] SS 2013 Outline Pairwise sequence alignment global - Needleman Wunsch Gotoh algorithm local - Smith Waterman algorithm BLAST - heuristics What
2- Forms and JavaScript Course: Developing web- based applica<ons
2- Forms and JavaScript Course: Cris*na Puente, Rafael Palacios 2010- 1 Crea*ng forms Forms An HTML form is a special section of a document which gathers the usual content plus codes, special elements
A Tutorial in Genetic Sequence Classification Tools and Techniques
A Tutorial in Genetic Sequence Classification Tools and Techniques Jake Drew Data Mining CSE 8331 Southern Methodist University [email protected] www.jakemdrew.com Sequence Characters IUPAC nucleotide
Getting started in Bio::Perl 1) Simple script to get a sequence by Id and write to specified format
BIOPERL TUTORIAL (ABREV.) Getting started in Bio::Perl 1) Simple script to get a sequence by Id and write to specified format use Bio::Perl; # this script will only work if you have an internet connection
Real SQL Programming 1
Real 1 We have seen only how SQL is used at the generic query interface an environment where we sit at a terminal and ask queries of a database. Reality is almost always different: conventional programs
XHTML Forms. Form syntax. Selection widgets. Submission method. Submission action. Radio buttons
XHTML Forms Web forms, much like the analogous paper forms, allow the user to provide input. This input is typically sent to a server for processing. Forms can be used to submit data (e.g., placing an
HTML Tables. IT 3203 Introduction to Web Development
IT 3203 Introduction to Web Development Tables and Forms September 3 HTML Tables Tables are your friend: Data in rows and columns Positioning of information (But you should use style sheets for this) Slicing
Introduction to XHTML. 2010, Robert K. Moniot 1
Chapter 4 Introduction to XHTML 2010, Robert K. Moniot 1 OBJECTIVES In this chapter, you will learn: Characteristics of XHTML vs. older HTML. How to write XHTML to create web pages: Controlling document
By Glenn Fleishman. WebSpy. Form and function
Form and function The simplest and really the only method to get information from a visitor to a Web site is via an HTML form. Form tags appeared early in the HTML spec, and closely mirror or exactly duplicate
LabVIEW Internet Toolkit User Guide
LabVIEW Internet Toolkit User Guide Version 6.0 Contents The LabVIEW Internet Toolkit provides you with the ability to incorporate Internet capabilities into VIs. You can use LabVIEW to work with XML documents,
?<BACBC;@@A=2(?@?;@=2:;:%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%
NGS data format NGS data format @SRR031028.1708655 GGATGATGGATGGATAGATAGATGAAGAGATGGATGGATGGGTGGGTGGTATGCAGCATACCTGAAGTGC BBBCB=ABBB@BA=?BABBBBA??B@BAAA>ABB;@5=@@@?8@:==99:465727:;41'.9>;933!4 @SRR031028.843803
HTML Form Widgets. Review: HTML Forms. Review: CGI Programs
HTML Form Widgets Review: HTML Forms HTML forms are used to create web pages that accept user input Forms allow the user to communicate information back to the web server Forms allow web servers to generate
PHP Form Handling. Prof. Jim Whitehead CMPS 183 Spring 2006 May 3, 2006
PHP Form Handling Prof. Jim Whitehead CMPS 183 Spring 2006 May 3, 2006 Importance A web application receives input from the user via form input Handling form input is the cornerstone of a successful web
Perl/CGI. CS 299 Web Programming and Design
Perl/CGI CGI Common: Gateway: Programming in Perl Interface: interacts with many different OSs CGI: server programsprovides uses a well-defined users with a method way to to gain interact access with to
PHP Tutorial From beginner to master
PHP Tutorial From beginner to master PHP is a powerful tool for making dynamic and interactive Web pages. PHP is the widely-used, free, and efficient alternative to competitors such as Microsoft's ASP.
10CS73:Web Programming
10CS73:Web Programming Question Bank Fundamentals of Web: 1.What is WWW? 2. What are domain names? Explain domain name conversion with diagram 3.What are the difference between web browser and web server
SGI. High Throughput Computing (HTC) Wrapper Program for Bioinformatics on SGI ICE and SGI UV Systems. January, 2012. Abstract. Haruna Cofer*, PhD
White Paper SGI High Throughput Computing (HTC) Wrapper Program for Bioinformatics on SGI ICE and SGI UV Systems Haruna Cofer*, PhD January, 2012 Abstract The SGI High Throughput Computing (HTC) Wrapper
org.rn.eg.db December 16, 2015 org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank accession numbers.
org.rn.eg.db December 16, 2015 org.rn.egaccnum Map Entrez Gene identifiers to GenBank Accession Numbers org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank
CS412 Interactive Lab Creating a Simple Web Form
CS412 Interactive Lab Creating a Simple Web Form Introduction In this laboratory, we will create a simple web form using HTML. You have seen several examples of HTML pages and forms as you have worked
GenBank, Entrez, & FASTA
GenBank, Entrez, & FASTA Nucleotide Sequence Databases First generation GenBank is a representative example started as sort of a museum to preserve knowledge of a sequence from first discovery great repositories,
Communication. Container-Exchange
Communication Container-Exchange By its so-called container system, OnyxCeph³ supports a synchronized data exchange between multiple separate Onyx databases for the same or for different licensees. By
Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011
Sequence Formats and Sequence Database Searches Gloria Rendon SC11 Education June, 2011 Sequence A is the primary structure of a biological molecule. It is a chain of residues that form a precise linear
BIOINFORMATICS TUTORIAL
Bio 242 BIOINFORMATICS TUTORIAL Bio 242 α Amylase Lab Sequence Sequence Searches: BLAST Sequence Alignment: Clustal Omega 3d Structure & 3d Alignments DO NOT REMOVE FROM LAB. DO NOT WRITE IN THIS DOCUMENT.
FORM-ORIENTED DATA ENTRY
FORM-ORIENTED DATA ENTRY Using form to inquire and collect information from users has been a common practice in modern web page design. Many Web sites used form-oriented input to request customers opinions
UGENE Quick Start Guide
Quick Start Guide This document contains a quick introduction to UGENE. For more detailed information, you can find the UGENE User Manual and other special manuals in project website: http://ugene.unipro.ru.
REGULATIONS FOR THE DEGREE OF BACHELOR OF SCIENCE IN BIOINFORMATICS (BSc[BioInf])
820 REGULATIONS FOR THE DEGREE OF BACHELOR OF SCIENCE IN BIOINFORMATICS (BSc[BioInf]) (See also General Regulations) BMS1 Admission to the Degree To be eligible for admission to the degree of Bachelor
CGI.pm Tutorial. Table of content. What is CGI? First Program
CGI.pm Tutorial This is a tutorial on CGI.pm which include scripts to let you see the effects. CGI.pm is a Perl module to facilitate the writing of CGI scripts. Click here to see the details. This tutorial
CSCI110: Examination information.
CSCI110: Examination information. The exam for CSCI110 will consist of short answer questions. Most of them will require a couple of sentences of explanation of a concept covered in lectures or practical
Introduction to GCG and SeqLab
Oxford University Bioinformatics Centre Introduction to GCG and SeqLab 31 July 2001 Oxford University Bioinformatics Centre, 2001 Sir William Dunn School of Pathology South Parks Road Oxford, OX1 3RE Contents
600-152 People Data and the Web Forms and CGI. HTML forms. A user interface to CGI applications
HTML forms A user interface to CGI applications Outline A simple example form. GET versus POST. cgi.escape(). Input controls. A very simple form a simple form
Clone Manager. Getting Started
Clone Manager for Windows Professional Edition Volume 2 Alignment, Primer Operations Version 9.5 Getting Started Copyright 1994-2015 Scientific & Educational Software. All rights reserved. The software
PDG Software. Site Design Guide
PDG Software Site Design Guide PDG Software, Inc. 1751 Montreal Circle, Suite B Tucker, Georgia 30084-6802 Copyright 1998-2007 PDG Software, Inc.; All rights reserved. PDG Software, Inc. ("PDG Software")
Database manager does something that sounds trivial. It makes it easy to setup a new database for searching with Mascot. It also makes it easy to
1 Database manager does something that sounds trivial. It makes it easy to setup a new database for searching with Mascot. It also makes it easy to automate regular updates of these databases. 2 However,
A Multiple DNA Sequence Translation Tool Incorporating Web Robot and Intelligent Recommendation Techniques
Proceedings of the 2007 WSEAS International Conference on Computer Engineering and Applications, Gold Coast, Australia, January 17-19, 2007 402 A Multiple DNA Sequence Translation Tool Incorporating Web
c. Write a JavaScript statement to print out as an alert box the value of the third Radio button (whether or not selected) in the second form.
Practice Problems: These problems are intended to clarify some of the basic concepts related to access to some of the form controls. In the process you should enter the problems in the computer and run
Dynamic Web-Enabled Data Collection
Dynamic Web-Enabled Data Collection S. David Riba, Introduction Web-based Data Collection Forms Error Trapping Server Side Validation Client Side Validation Dynamic generation of web pages with Scripting
Module 1. Sequence Formats and Retrieval. Charles Steward
The Open Door Workshop Module 1 Sequence Formats and Retrieval Charles Steward 1 Aims Acquaint you with different file formats and associated annotations. Introduce different nucleotide and protein databases.
Now that we have discussed some PHP background
WWLash02 6/14/02 3:20 PM Page 18 CHAPTER TWO USING VARIABLES Now that we have discussed some PHP background information and learned how to create and publish basic PHP scripts, let s explore how to use
7 Why Use Perl for CGI?
7 Why Use Perl for CGI? Perl is the de facto standard for CGI programming for a number of reasons, but perhaps the most important are: Socket Support: Perl makes it easy to create programs that interface
Web Development 1 A4 Project Description Web Architecture
Web Development 1 Introduction to A4, Architecture, Core Technologies A4 Project Description 2 Web Architecture 3 Web Service Web Service Web Service Browser Javascript Database Javascript Other Stuff:
InternetVista Web scenario documentation
InternetVista Web scenario documentation Version 1.2 1 Contents 1. Change History... 3 2. Introduction to Web Scenario... 4 3. XML scenario description... 5 3.1. General scenario structure... 5 3.2. Steps
How To Use The Assembly Database In A Microarray (Perl) With A Microarcode) (Perperl 2) (For Macrogenome) (Genome 2)
The Ensembl Core databases and API Useful links Installation instructions: http://www.ensembl.org/info/docs/api/api_installation.html Schema description: http://www.ensembl.org/info/docs/api/core/core_schema.html
Using Form Tools (admin)
EUROPEAN COMMISSION DIRECTORATE-GENERAL INFORMATICS Directorate A - Corporate IT Solutions & Services Corporate Infrastructure Solutions for Information Systems (LUX) Using Form Tools (admin) Commission
(A GUIDE for the Graphical User Interface (GUI) GDE)
The Genetic Data Environment: A User Modifiable and Expandable Multiple Sequence Analysis Package (A GUIDE for the Graphical User Interface (GUI) GDE) Jonathan A. Eisen Department of Biological Sciences
Client-side Web Engineering From HTML to AJAX
Client-side Web Engineering From HTML to AJAX SWE 642, Spring 2008 Nick Duan 1 What is Client-side Engineering? The concepts, tools and techniques for creating standard web browser and browser extensions
Web Design and Development ACS-1809. Chapter 13. Using Forms 11/30/2015 1
Web Design and Development ACS-1809 Chapter 13 Using Forms 11/30/2015 1 Chapter 13: Employing Forms Understand the concept and uses of forms in web pages Create a basic form Validate the form content 11/30/2015
IBM Tivoli Access Manager for e-business 6.1: Writing External Authentication Interface Servers
IBM Tivoli Access Manager for e-business 6.1: Writing External Authentication Interface Servers White Paper Ori Pomerantz ([email protected]) July 2010 Copyright Notice Copyright 2010 IBM Corporation, including
Novell Identity Manager
AUTHORIZED DOCUMENTATION Manual Task Service Driver Implementation Guide Novell Identity Manager 4.0.1 April 15, 2011 www.novell.com Legal Notices Novell, Inc. makes no representations or warranties with
Lecture 2, Introduction to Python. Python Programming Language
BINF 3360, Introduction to Computational Biology Lecture 2, Introduction to Python Young-Rae Cho Associate Professor Department of Computer Science Baylor University Python Programming Language Script
Web Services for Management Perl Library VMware ESX Server 3.5, VMware ESX Server 3i version 3.5, and VMware VirtualCenter 2.5
Technical Note Web Services for Management Perl Library VMware ESX Server 3.5, VMware ESX Server 3i version 3.5, and VMware VirtualCenter 2.5 In the VMware Infrastructure (VI) Perl Toolkit 1.5, VMware
TCP/IP Networking, Part 2: Web-Based Control
TCP/IP Networking, Part 2: Web-Based Control Microchip TCP/IP Stack HTTP2 Module 2007 Microchip Technology Incorporated. All Rights Reserved. Building Embedded Web Applications Slide 1 Welcome to the next
Designing and Implementing Forms 34
C H A P T E R 34 Designing and Implementing Forms 34 You can add forms to your site to collect information from site visitors; for example, to survey potential customers, conduct credit-card transactions,
Version 5.0 Release Notes
Version 5.0 Release Notes 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) +1.734.769.7249 (elsewhere) +1.734.769.7074 (fax) www.genecodes.com
InPost UK Limited GeoWidget Integration Guide Version 1.1
InPost UK Limited GeoWidget Integration Guide Version 1.1 Contents 1.0. Introduction... 3 1.0.1. Using this Document... 3 1.0.1.1. Document Purpose... 3 1.0.1.2. Intended Audience... 3 1.0.2. Background...
Sequence Database Administration
Sequence Database Administration 1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases
When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want
1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very
Geneious 4.0.2. Biomatters Ltd
Geneious 4.0.2 Biomatters Ltd 17th September 2008 2 Contents 1 Getting Started 7 1.1 Downloading & Installing Geneious.......................... 7 1.2 Using Geneious for the first time............................
This document presents the new features available in ngklast release 4.4 and KServer 4.2.
This document presents the new features available in ngklast release 4.4 and KServer 4.2. 1) KLAST search engine optimization ngklast comes with an updated release of the KLAST sequence comparison tool.
Intell-a-Keeper Reporting System Technical Programming Guide. Tracking your Bookings without going Nuts! http://www.acorn-is.
Intell-a-Keeper Reporting System Technical Programming Guide Tracking your Bookings without going Nuts! http://www.acorn-is.com 877-ACORN-99 Step 1: Contact Marian Talbert at Acorn Internet Services at
Inserting the Form Field In Dreamweaver 4, open a new or existing page. From the Insert menu choose Form.
Creating Forms in Dreamweaver Modified from the TRIO program at the University of Washington [URL: http://depts.washington.edu/trio/train/howto/page/dreamweaver/forms/index.shtml] Forms allow users to
Regular Expressions and Pattern Matching [email protected]
Regular Expressions and Pattern Matching [email protected] Regular Expression (regex): a separate language, allowing the construction of patterns. used in most programming languages. very powerful
EUROPEAN COMPUTER DRIVING LICENCE / INTERNATIONAL COMPUTER DRIVING LICENCE WEB EDITING
EUROPEAN COMPUTER DRIVING LICENCE / INTERNATIONAL COMPUTER DRIVING LICENCE WEB EDITING The European Computer Driving Licence Foundation Ltd. Portview House Thorncastle Street Dublin 4 Ireland Tel: + 353
Tutorial 6 Creating a Web Form. HTML and CSS 6 TH EDITION
Tutorial 6 Creating a Web Form HTML and CSS 6 TH EDITION Objectives Explore how Web forms interact with Web servers Create form elements Create field sets and legends Create input boxes and form labels
JavaScript: Arrays. 2008 Pearson Education, Inc. All rights reserved.
1 10 JavaScript: Arrays 2 With sobs and tears he sorted out Those of the largest size... Lewis Carroll Attempt the end, and never stand to doubt; Nothing s so hard, but search will find it out. Robert
JAVASCRIPT AND COOKIES
JAVASCRIPT AND COOKIES http://www.tutorialspoint.com/javascript/javascript_cookies.htm Copyright tutorialspoint.com What are Cookies? Web Browsers and Servers use HTTP protocol to communicate and HTTP
Dynamic Content. Dynamic Web Content: HTML Forms CGI Web Servers and HTTP
Dynamic Web Content: HTML Forms CGI Web Servers and HTTP Duncan Temple Lang Dept. of Statistics UC Davis Dynamic Content We are all used to fetching pages from a Web server. Most are prepared by a human
Molecular Databases and Tools
NWeHealth, The University of Manchester Molecular Databases and Tools Afternoon Session: NCBI/EBI resources, pairwise alignment, BLAST, multiple sequence alignment and primer finding. Dr. Georgina Moulton
Configuring iplanet 6.0 Web Server For SSL and non-ssl Redirect
Introduction Configuring iplanet 6.0 Web Server For SSL and non-ssl Redirect This document describes the process for configuring an iplanet web server for the following situation: Require that clients
Working with forms in PHP
2002-6-29 Synopsis In this tutorial, you will learn how to use forms with PHP. Page 1 Forms and PHP One of the most popular ways to make a web site interactive is the use of forms. With forms you can have
Web Programming with PHP 5. The right tool for the right job.
Web Programming with PHP 5 The right tool for the right job. PHP as an Acronym PHP PHP: Hypertext Preprocessor This is called a Recursive Acronym GNU? GNU s Not Unix! CYGNUS? CYGNUS is Your GNU Support
