Advanced Device Manager (ADM) v 5.0. Administrator Guide

Size: px
Start display at page:

Download "Advanced Device Manager (ADM) v 5.0. Administrator Guide"

Transcription

1 Advanced Device Manager (ADM) v 5.0 Administrator Guide Issue Date: 03. XX, 2015 Rev: 007 Astec Technology CO., LTD 17F7.,No.75,Sec.1,Xintai5thRd.,XizhiDist.,NewTaipeiCity221,Taiwan Tel: Fax:

2 Copyright Notices 2015,AstecTechnologyCo.,Ltd.Allrightsreserved. Thismanualandthesoftwareandfirmwaredescribedinitarecopyrighted.Youmay notreproduce,transmit,transcribe,storeinaretrievalsystem,ortranslateintoany languageorcomputerlanguage,inanyformorbyanymeans,electronic, mechanical,magnetic,optical,chemical,manualorotherwise,anypartofthis publicationwithoutexpresswrittenpermission. Trademarks TheAstecandADMlogosaretrademarksofAstecTechnologyCo.,Ltd.Other productnamesmentionedhereinareforidentificationpurposesonlyandmaybe trademarksand/orregisteredtrademarksoftheirrespectivecompanies. Specificationssubjecttochangewithoutnotice. Page2of89

3 Table of Contents 1Introduction...4 2PreparingforInstallation InstallationADMsystem...9 4GettingStarted...21 Page3of89

4 1 Introduction Advanced Device Manager (ADM) is the next generation management tool to replacethepreviousversionofadvancedmanagementsoftware(ams).itdelivers centrally monitor and control, software distribution, update management, asset management, grouping and remote assistance to your network while providing superiorsecurity,performance,mobilizationandtco. This release has several new features which includes the ability to perform operations on the groups and/or individually selected devices providing a simple, timesavingmethodforconfiguringandupdatingmultipledevices.withnewsearch function,youcandiscovertheclientbyspecifiedipormacaddress.italsoallowsto managemultipleservers&subnetsviaoneconsoleinthelargenetwork. ADM is ideal for small, midsize businesses and large enterprises looking to reducethecostandcomplexityassociatedwithindividualdesktopinstallations.with thissoftware,smbsandenterprisescanprovidefast,secureandcentrallymanaged access to any application for authorized users in their organization. ADM comes bundled with all thin clients. It provides comprehensive management control for smallerinstallationsaswellasscalesuptohundredsofthousandsofclients. 11 System Architecture The Advanced Device Manager (ADM) consists of ADM server, console and client s agent. The following illustration shows how the ADM server, console and client sagentinteractiveandcommunicatebetweeneachother. Page4of89

5 12 About This Guide This guide provides the stepbystep to instruction you that how to install and configuretheadmenvironment.italsoincludestherequirementsyoumustaddress beforeyoubegintheinstallationprocedures. ThisguideisintendedforexperiencednetworkadministratorsandInformation technologymemberswhohaveinstalledandconfiguredadmonwindowsserver. 13 Finding the Information You Need in this Guide You can use either the Search window or Find toolbar to locate a word, seriesofwords,orpartialwordinanactivepdfdocument.fordetailedinformation onusingthesefeatures,refertothehelpinyourpdfreader. Page5of89

6 2 Preparing for Installation 21 Before Installation Obtain and configure all hardware and software, as necessary (see "HardwareRequirements"and"SoftwareRequirements"inpage7). CAUTION: It is required that you do not install ADM on any server which is currently dedicated to other tasks (such as a Domain Controller, Backup Controller, Mail Server, Production Web Server, DHCP Server, MSMQ Server, Application Server, and so on). It is highly recommended that ADM be installed on a server that is dedicated to ADM services. InstallasupportedoperatingsystemonthemachinetowhichADMwillbe installed. BesurethatallsystemsareuptodatewithcurrentMicrosoftservicepacks, patchesandupdates(see"softwarerequirements"). Ensure that no other applications requiring IIS and FTP are running on the machinetowhichadmisinstalled. Ensurethatallrequiredcommunicationsportsareavailableandopenfor propercommunicationbetweenservers,routers,andswitches(see "CommunicationPortRequirements"). Ensure you have access to your operating system CDROM and your MicrosoftWindowsSystemfilesforuseduringyourinstallation. NOTE:During ADM installation ADM checks the system to determine if all required software is present. If required software is not present, ADM indicates which software is missing. Some required thirdparty software is included with the ADM software, while other software is available from your operating system CDROM or from the network location for Microsoft Windows system files (usually the i386 folder). UninstalltheAMSconsoleandserver(ifany)toensureyourdevicesare discoveredbynewadm. Page6of89

7 22 Hardware Requirements Dependingonyouroperatingsystem,besurethemachine(s)towhichyouwill install ADM meets or exceeds the minimum system requirements for 32bit operatingsystemsorfor64bitoperatingsystems(asthesearegeneralguidelines, be sure to refer to your operating system documentation for details on hardware requirements). 2.4GHz32bitor64bitprocessor 4GBofsystemmemory 40GBharddrivewithatleast15GBofavailablespace IMPORTANT: The actual free space required depends on the number and size of the packages you register, as well as number of devices you will be managing (the image size of the firmware). The minimum free space shown assumes the image size of the firmware and packages require that amount of space. 23 Software Requirements ADMsupportstheEnglishversionsofsoftwareenclosed WindowsServer2003(32bit) WindowsServer2008R2(32bit) WindowsServer2008R2(64bit) WindowsServer2012R2(32bit) WindowsServer2012R2(64bit) Windows7(32bit) Windows7(64bit) Windows8.1(32bit) Windows8.1(64bit) Bydefault,ADMinstallsMicrosoft.NETFramework TheADMserverwilluseWebandFTPservices,pleaseensurethat DisableInternetInformationServices(IIS)ifitisactivated. DisableFTPserviceifitisactivated. Youmustperformthecustomsettinginaccordingtoyourserverplatform. Page7of89

8 24 Communication Port Requirements To perform ADM full range of management functions, it requires open certain ports on your servers, routers, switches and virus protection software. Below lists theportsadmusesanddescribestherespectivecommunicationprotocolsandtheir function (ensure that these ports are open for proper communication between servers). Role Protocol/Service Port Function Console TCP 8635 FTP 21 Server HTTP 8080 TCP 8635 UDP FTP 21 Client HTTP 8080 UDP FTP 21 Communicatewith theserver Sendfilestothe server Communicatewith theclient Communicatewith theconsole Broadcasttothe client Receivefilesfrom theclient Communicatewith theserver Broadcasttothe server Sendfilestothe server 25 Supported Client Firmware Depends on the thin client operating system, the device(s) which you will connecttotheadmmeetsthesystemrequirementsasbelow: WEC7 v orabove/ WES2009v1.15.1orabove/ WES7v2.47orabove/ WES8 V3.0.0orabove/ Linux2.0v2.4.1orabove/ ThinWiz v1.0.0v1.5.4orabove. Page8of89

9 3. Installation ADM system ThissectionwalksyouthroughtheprocessbeforeinstalltheADMsoftwarethat toallowtheadministratoreasytosetuptheadmsystemintheirenvironment. Caution: Be sure that you have completed all preinstallation requirements as described in "Preparing for Installation" before you begin installing ADM system. ADMsysteminstallsthefollowingADMrolesonasingleserver: ADM Server Controltheclientactionlikethepowercontrol,remoteaccess, groupautoconfiguration. ADM Console Advanceduserinterfaceforconfiguringandmonitoringthe system. 31 ADM Installation Procedure DoubleclicktheADM5.0.xxx.msifiletobegintheADMinstallation.ClickNextto continuetheadmsystemsetup. Page9of89

10 Followtheinstructiontocontinuetheinstallation. Selectthewayyouwanttoinstall,andthenclickNext. Page10of89

11 ClickInstalltobegintheinstallation. InstallingADMsystem,pleasewaitafewseconds. Page11of89

12 ClickFinishtocompleteADMinstallation. 32 Uninstall ADM When using a Microsoft Windows remove program feature (such as Add and RemoveProgramsorProgramsandFeatures)toremoveADM,itiseasiertoremove the ADM by doubleclick the ADM System icon and launch the uninstallation procedure. Page12of89

13 33 ADM System Settings ThissectiondescribeshowtochangeADMsettings.ADMsettingsconsistofADM consolesettings,admserversettingsandaddadmservermanagement.itprovides informationonusingthesettingswithinyouradmenvironment,andadministrator caneasilyperformcompany ssecuritypolicythroughthesesettings. 331 Adding Other ADM Server ADM Console provides connecting multiserver (ADM server), you are able to managermoredevicesthoughmultiserver.pleaseclickadd Server iconas below figure (Toolbar icon) and open an Add an ADM Server dialog box. Enter another serveripaddressordomainname,port,usernameandpassword(thedetailsrefer AddinganADMServer onsection41).ifaddaservertoadmconsoleissuccessful, youwillseenewadmserverintreepane. Figure: Add Server Icon Figure: Add an ADM Server Dialog Box Page13of89

14 Figure: New ADM Server in ADM Servers of Tree Pane 332 ADM Console Settings YoucanchangeAMDConsolesettingstomeetyouroperationhabit.Pleaseclick theconsole Settings iconasbelowfigure(toolbaricon)andopenaconsole Settings dialogbox. Figure: Console Settings Icon OntheOptiontab,youcanselecttheoptionsasbelow LoadingserverlistatADMConsoleisstartup. Connectingserverautomaticallyafterloadingserverlist. SavingserverlistwhenyoucloseADMConsole. ADMConsoleisreconnectedwhenyoulostconnection. WindowsismaximizedorminimizedwhenyouopenADMConsol. Page14of89

15 Figure: Option Tab of Console Settings Dialog Box OnAdvancetab,youcanselectbelowoption TousefullscreenoradjustscreensizewhenusingRDPWindow. Savetheerrorlogwhenstartingdebugmode. Figure: Advance Tab of Console Settings Dialog Box Page15of89

16 333 ADM Server Settings Ifthedefaultsystemvaluedosnotmeetsecuritypolicy,ADMconsoleprovides thesettingsforadmserver,youcanadjustthesesettingstoperformthecompany s securitypolicy.pleaseselectanadmserverfromtreepaneandclickserver Settings iconasbelowfigure(toolbaricon)toopentheserver Settingsdialogbox. Figure: Server Settings Icon OnGeneral tab,youcansetuptheserverconnectionsettings,includingserver usetcp/udpport,ftpusetcpport,ftpdefaultpasswordandotheroptions.about thesystemthatcansetupthenumberofthreadsandstorethedatabroadcasting interval. Figure: General Tab of Server Settings Dialog Box Page16of89

17 OntheConsole tab,youcansetupthetcplistenportoftheadmserver,adm consolewillbeconnecttoadmserverthroughthistcpport.alsolimitadmconsole IPaddressorbindADMserverIPaddress.Besides,youcanallowtheADMconsoleto findtheadmserverthroughusingbroadcast. Figure: Console Tab of Server Settings Dialog Box On the Client Control tab, you can set up the device connection settings, including the TCP/UDP port of the client, maximize times to retry (including connect/actionfailretry)andtimeoutofcommandsend/receive.forsystem,canset upbroadcastintervalandstorethedatabroadcastinginterval. Figure: Client Control Tab of Server Settings Dialog Box Page17of89

18 OnNetwork tab,youcanmaintainmanagedsubnetoripaddresstomanagethe devicethatipaddressisspecificrange. Figure: Network Tab of Server Settings Dialog Box OnCommunicationtab,youcansetuptimeout(includingconnectionstimeout, no transfer timeout and login timeout) and buffer size (including internal transfer buffersizeandsocketbuffersize).whenenter0secondsintimeoutsettings,itisnot timeout. Page18of89

19 Figure: Communication Tab of Server Settings Dialog Box OnSpeed Limittab,youcanadjustdownloadspeedlimitanduploadspeedlimit forftpfile. Figure: Speed Limit Tab of Server Settings Dialog Box On Security tab, you can change the password that account is Admin when needtologinadmserver(forexample,addaserverfromadmconsole).minimum lengthis6characters,thepasswordisremovedifleaveempty. Page19of89

20 Figure: Security Tab of Server Settings Dialog Box OnMisc.tab,youcanchangewakeuponLANsettings,includingWOLuseport, WOLpacket,retrytimesandinterval. Figure: MISC Tab of Server Settings Dialog Box Page20of89

21 4 Getting Started This chapter provides a brief overview of the functional areas within the ADM Console. It also provides important information and instructions on the system to helpyouquicklygetstartedasathinclientadministrator. 41 Add an ADM Server Before use ADM Console, system will demand you to add an ADM server. BecausethedevicewasmanagedthroughADMserver,soyoualsoneedtomanage ADMserver. PleaseenterbelowserverinformationtoaddanADMserver. Server: ADM ServerIPaddressorservername (defaultipis ) Port: Console useporttomanageserver (defaultportis8635) Username:Loginserverusername(defaultusernameisAdmin) Password:Loginserverpassword(defaultpasswordisAdmin#1) *Tip:IfADMServerandADMConsolebeinstalledinthesamecomputer,youcan enter server name localhost or IP address This IP addressis a special purposeaddressreservedforuseoneachcomputer.ifadmserverbeinstalledin anothercomputer,youmustenteranothercomputer sipaddressinnetwork. Figure: Add a ADM Server Dialog Box Page21of89

22 42 Getting to Know the ADM Console ThissectioncontainsanoverviewoftheareasandtoolsthatcomprisetheADM Console(detailsoneachitemintheconsoleareprovidedintheirrespectivechapters ofthisguide). ADMConsoleallowsyoutoquicklyviewinformationaboutthedevice,helpsyou to easily perform all of the devicemanagement, and simply maintains ADM environment. Figure: ADM Console Interface Inthisconsole,therearefouroperatingareasasbelow: Toolbar Icon: Configure your ADM Console preferences and environment designssothatitmeetsyourmanagementneeds. Tree pane: ListeachADMserverandfunctionsofADMConsoletomanagethe device. Console page: Showthatyouarerunningfunctions,andeachfunctionwould createdifferentconsolepage.youcanswitchtheseconsolepagesandoperate thesefunctionsquicklyatanytime. Message list: Showeachtaskrunninginformation,systemeventinformation andcommunicationinformation. Page22of89

23 Figure: ADM Console Page Interface 43 Completing ADM Authentication AlthoughyouhavestartedtouseADMConsoleandseealistallofthedevice, but you can t manage them. You must obtain the authorization of the device successfully,thefunctionsbeabletorunproperly. PleasedoubleclickUndefinedfromtreepaneandyouwillseealistofthedevice ongroupconsolepage.pleaseselectingadevice,usingrightclickcontextmenuand chooseadm AuthenticationtoopenanADMAuthenticationdialogbox.Youmust enter the password Admin#1 (default password) to complete ADM Authentication. Figure: UnComplete ADM Authentication Icon *Tip:Devicemustnotbeauthenticated,sothatyouareabletocompletetheADM authentication. Page23of89

24 Figure: Using RightClick Context Menu for completing ADM Authorization Figure: ADM Authentication Dialog Box Figure: Complete ADM Authentication Status Page24of89

25 44 Using RightClick Context Menu ADM provide friendly interface, and assist you can easily manage your device. WhenyouhavecompletedADMAuthentication,thenyouareabletouserightclick contextmenuoneachdevicefromgroupconsolepage. Figure: RightClick Context Menu for the Device Page25of89

26 Rightclickcontextmenuconsistofdevicemanager,firmwaremanager,template manager and list management. For list management, you are able to usefully managethelistallofdevicethroughrightclickcontextmenu.themainfunctions areasfollowing(asforotherfunctions,pleasereferrelatedchapter): Move to Group:Assignthedevicetodifferentgroup. Remove From List:Removethedevicefromlist. Select All:Selectallofdevice. Unselect All:Cancelallofdevicebeenselected. Refresh:Refreshinformationofthelistandresearchthedevice. OnADM Serversoftreepane,youareabletouserightclickcontextmenuto addanadmserver. Figure: RightClick Context Menu for ADM Servers of Tree Pane Page26of89

27 On server name of tree pane, you are able to use rightclick context menu to manageanadmserver.thefunctionsareasfollowing: Disconnect:Disconnectthisserver. Add Group:AddaGroupinthisADMserver. Remove Server:RemovethisserverfromADMConsole. Properties:SetupADMserverproperties. Figure: RightClick Context Menu for Server Name of Tree Pane OnGroupsoftreepane,youareabletouserightclickcontextmenutoadda newgroup.thenewgroupwillbeaddedtogroups. Figure: RightClick Context Menu for Groups of Tree Pane OnTemplate,Firmware,ComponentandSchedule Taskoftreepane,youare abletouserightclickcontextmenutomanageconsolepage.thefunctionsareas following: View Detail:Openrelatedconsolepage. Refresh:Refreshthedataofrelatedconsolepage. Figure: RightClick Context Menu for Template, Firmware, Component and Schedule Task of Tree Pane 45 Knowing Your ADM Version TodisplaytheADMcopyrightinformation,versionandbuildnumber,pleaseclick Informationiconasbelowfigure(Toolbaricon). Figure: Information Icon Page27of89

28 Figure: ADM Copyright and Version Information 46 Managing Group Thissectionprovidesa briefwaythattoassistthinclientadministratorsimply managethedevice.whentherearemanydeviceneedtobemanaged,wesuggested that administrator set classification of the device and assign device that the propertiesaresametothesamegroup,sothatyouareabletoeasilymanageyour device. Page28of89

29 461 Create a New Group YouchooseGroupsfromtreepane,andselectAdd Groupfromrightclickmenu, itwillopennew Groupdialogbox.Pleaseenterthegroupnameandselectaquick deploytemplatefiletofinish,admconsolecreateanewgroup,andthenthenew groupbeaddedtogroups. Figure: Add a New Group from Tree Pane Figure: New Group Dialog Box Figure: Complete to Add a New Group Page29of89

30 462 Edit Group Name and Change Deploy Template File YouchooseagroupthatyouwanttomodifynamefromGroupsoftreepane,and select Properties from rightclick menu, it will open Group Properties dialog box. Pleasemodifythegroupnameorselectanotherquickdeploytemplatefiletofinish. Figure: New Group Dialog Box 463 How to Assign Devices to Group Page30of89

31 In Undefined group console page, it will automatically display all of undefined device. Please using rightclick context menu with Move To Group for undefined device,youmustselectanoptionfrommove to Groupdialogbox,andthenassign devicetofinish. *Tip:Ifyouchoicequickdeploytemplatefile,thedevicewillautomaticallystartto updatedataofpropertiesandconnectionstemplatethenrebootafterassign devicestogroup. Figure: Use Move To Group from RightClient Context Menu Figure: Move To Group Dialog Box Figure: Assign Device to New Group Page31of89

32 Page32of89

33 47 Managing Device Thischapterdescribeshowtoperformroutinedevicemanagementtasksusing theadmconsole.itprovidesinformationonmanagingthedeviceswithinyouradm environment. 471 View Device Details and Status AdministratorcanquicklyviewinformationofeachdevicefromGroupconsole page,itisclearataglancetohelpyoutomanagethemusefully.theinformationis includingdevicemodel,terminalname,macaddress,ipaddress,ramsize,flashsize, operatingsystemplatform,firmwareversionanddevicestatus. Figure: View Details of Each Device Administratorcanviewcurrentstatusofeachdevicethroughbelowicons,and youareabletoclickonsomeoftheiconstorunthefunctions.themeaningsareas follow: : Deviceisoffline. :Deviceisunauthorized. :Deviceisonline. :Deviceisrebooting. Page33of89

34 :Clickittoshutdownthedevice. :ClickittowakethedeviceonLAN. :Device sewfisdisabled. :Device sewfisenabled. :Clickittoloaddevice scontrolpanelsettings. :Showthedeviceinformation. 472 Use Remote Control to Manage Device If you need to troubleshoot device problems, ADM Console provide remote control(suchaswakeonlan,reboot,poweroff,sendmessage,ewfcontroland ResetDefault)toassistadministratormangethedevices. InGroupsoftreepane,doubleclickagroupname.Selectthesingledeviceyou want to control, choose a function from rightclick context menu, and then this functionwillberunimmediately. *Caution: EWFControlisonlysupportedonWES7andWES2009clients. ResetDefaultisonlysupportedonWEC7andAstecLinux2.0clients. Figure: RightClick Context Menu for Remote Control Figure: RightClick Context Menu for EWF Page34of89

35 473 Remote Shadowing Devices Itisveryuseful,administratorcanviewandcontroladeviceremotely(shadowing a device) to help a user with a particular application and to troubleshoot device problems. In Group console page, please select the single device you want to view and choose VNC Viewer from rightclick context menu. Enter session password Admin#1 (defaultpassword)thenseeavnc View Window. Figure: VNC Authentication Dialog Box Figure: VNC View Window Page35of89

36 474 Send a Message to Client Ifadministratorneedtonoticeuserstroubleshootingdeviceproblems,youcan sendamessagetoclient,userswillfollowyounoticeafterreceivingyourmessage. In Group console page, please select the single device you want to view and choosesend Messagefromrightclickcontextmenu.Enteramessagethatyouwant tonotify,clientwillshowamessageboxthatyousendthemessage. Figure: Send Message Dialog Box Figure: Client Message Box Page36of89

37 475 Filter Your Device from List Whenadministratormanagesallseveralofthedevices,weprovideadevicefilter toassistadministratorquicklyfindmanageddevice. InUndefinedconsolepage,pleaseselectafilteritemandtypesearchstringfirst, thenclicksearchicon,admconsolewillfilterthedevicesfromlistbyusername, product name, devicename, device MAC address, device IP address, platform and firmwareversion.youcanclickclearicontocancelsearchstring,admconsolewill listallofthedevices. Figure: Filter the Devices Figure: Filter Button :Searchdevicedata. :Clearsearchstring. 476 Sort Your Device from List Whenadministratormanagesallseveralofthedevices,wealsoprovideadevice sortingtoassistadministratorquicklyfindmanageddevice. Page37of89

38 InUndefinedconsolepage,pleaseselectaSortitem,ADMConsolewillsortthe devices from list by product name, computer name, IP, memory size, flash size, platformandversion.youcanclicksorticon(ascendingordescending)toswitchsort type. Figure: Sort the Devices Figure: Sort Button : Ascenddevicedata. :Descenddevicedata. 477 Change Device Properties Devicepropertiesconsistofgeneral,network,regionalandadvancedproperties. ADM Console allows administrator can change these properties by using Control PanelSettings.Youcaneasilymaintainthepropertiesofeachdevice,andthedevice willapplythesettingsimmediately. In Group console page, please select the single device you want and choose Control Panel Settingsfromrightclickcontextmenu.ThenyouwillopenaControl Panel Settingswindow,itisauserinterfaceformaintainingproperties. Page38of89

39 In side bar, there are four items. Each item also contains several of tabs. Dependingondifferentthinclientoperatingsystem,thepropertiesthatyouwantto changearenotthesame.pleaserefertableasfollowing,itlistallofoperatingsystem supportdeviceproperties. Table: List all of Operating System Support Device Properties (1) Items Tabs Details WES 2009/ WES 7 WEC 7 Astec Linux 2.0 Resolution X X General Network International Advance Display Device Keyboard Mouse Sound Colors X X ScreenSaver X X TerminalName/Group X X X TerminalDescription X Characterrepeat X X InitialState X X MouseOrientation X X PointerSpeed X X Volume X X OtherOption X Network IPAddress X X X DNS Regional Security DNSServer X X X WinsServer X X X TimeZone X X KeyboardLayout X X TerminalProperties X X AdministratorPassword X UserInterface ShellMode X X VNC AllowandPassword X X X DeviceSupport Remote Manage USBHIDDevice X X USBMassStorage Device X X X USBPrinter X X Connect X X X RemoteMangeServer X X X Citrix VDIConnect X Domain ActiveDirectorySSO X Page39of89

40 Table: List all of Operating System Support Device Properties (2) Items Tabs Details WES 8 ThinWiz(1.0.0/1.5.0) General Network International Advance Display Device Keyboard Mouse Sound Resolution X Colors X ScreenSaver X TerminalName/Group X X TerminalDescription Characterrepeat X InitialState X MouseOrientation X PointerSpeed X Volume X OtherOption Network IPAddress X X DNS Regional Security DNSServer X X WinsServer X X TimeZone X KeyboardLayout X TerminalProperties X Administrator Password UserInterface ShellMode VNC AllowandPassword X X Device Support Remote Manage USBHIDDevice X USBMassStorage Device USBPrinter X Connect X X RemoteMangeServer X X Citrix VDIConnect X Domain ActiveDirectorySSO On Display tab of General, you can change display resolution, colors and wait minutesofscreensaver. Figure: Control Panel Settings Window Display Tab of General X X X Page40of89

41 On Device tab of General, you can reset terminal name by MAC and change terminalname,terminalgroupandterminaldescription. Figure: Control Panel Settings Window Device Tab of General On Keyboard tab of General, you can change keyboard character repeat (includingrepeatdelayandrepeatrate)andkeyboardinitialstate. Page41of89

42 Figure: Control Panel Settings Window Keyboard Tab of General OnMousetabofGeneral,youcanchangemouseorientation(forexample,right handedorlefthanded)andpointspeed. Figure: Control Panel Settings Window Mouse Tab of General OnMousetabofGeneral,youcanchangevolume(includingSpeakerandMIC) and point speed, enable sounds for events and application, and enable clicks and tapsforkeyclicks. Page42of89

43 Figure: Control Panel Settings Window Sound Tab of General OnNetworktabofNetwork,youcansetupIPaddressmanually. Figure: Control Panel Settings Window Network Tab of Network On DNS tab of Network, you can set up DNS server (primary or secondary) or Winsserver(primaryorsecondary)manually. Page43of89

44 Figure: Control Panel Settings Window DNS Tab of Network OnRegionaltabofInternational,youcanchangetimezoneanddefaultkeyboard layout. Figure: Control Panel Settings Window Regional Tab of International OnSecuritytabofAdvance,youcanturnterminalpropertiesonoroff,orreset administrator/ewfpassword. Figure: Control Panel Settings Window Security Tab of Advance Page44of89

45 On User Interface tab of Advance, you can change shell mode (including WBT anddesktopmode). Figure: Control Panel Settings Window User Interface Tab of Advance OnUserVNCtabofAdvance,youcanchangepasswordforremoteshadowing control,andallowthatuseremoteshadowingcontrol. Page45of89

46 Figure: Control Panel Settings Window VNC Tab of Advance On Device Support tab of Advance, you can select supported USB device, includinghiddevice,massstoragedeviceandprinter. Figure: Control Panel Settings Window Device Support Tab of Advance Windowsseriesasbelow: Linuxplatform: Page46of89

47 OnRemote ManagetabofAdvance,youcansetuppollingserverforthedevice broadcastingtoadmserver,orresetpasswordforremotemanageauthorize. Figure: Control Panel Settings Window Remote Manage Tab of Advance On Citrix tab of Advance, you can select whether connect the device automaticallyforcitrixvirtualdesktopisrunningwhenadeviceisconnected. Figure: Control Panel Settings Window Citrix Tab of Advance Page47of89

48 OnDomaintabofAdvance,ThisfeaturesupportsAstecLinuxonly. Page48of89

49 478 Manage Device Connections ADM Console provides Connection Management to assist administrator managingthedevice svdi.usingconnect Hostwizard,youcanquicklymaintainthe settingsofeachvdi,andthedevicewillapplythesettingsimmediately. InGroupconsolepage,pleaseselectthesingledeviceyouwanttomanageand choose Connection Manager from rightclick context menu. Then you will open a Connect Hostwizard,itisauserinterfaceformaintainingconnections. ADMConsoleprovidesseveraltypesoftheconnections.WhenyouuseAddto createnewconnection,admconsolewillopennew Connectiondialogboxandyou can select one option. Thin client operating system support different type of the connections(seetablesupportlist).youalsouseedittomodifythissettingoruse Deletetoremoveaconnection.Finally,useUpdatetoapplytheconnectionsettings tothedevice. *Caution:ConnectionManagementisonlysupportedonWEC7,AstecLinux2.0and ThinWiz(1.0.0/1.5.0)clients. Figure: Connect Host Wizard Page49of89

50 Figure: Connect Host Wizard(ThinWiz) Figure: New Connection Dialog Box Figure: New Connection Dialog Box (ThinWiz) Page50of89

51 Table: List all of OS Support Connection Type Connection Type WEC 7 Astec Linux 2.0 ThinWiz 1.0.0/1.5.0 CitrixICAClient X X CitrixReceiver X MicrosoftRemoteDesktopClient X X X MicrosoftRemoteApps X VMwareView X X WebBrowser X X X11Client X VNCViewer X Telnet X SPICEClient X ThinWiz Citrix Receiver: IfyouchooseCitrix Receiver,pleaseenterseverIPaddress/domainname/User Name/Password/Doaminindialogbox. TheGeneraltabdisplayaboutloginsettings,youareabletoenterusername, passwordanddomain,andselectwhetherautologinsystemafterconnectingserver. Figure: Connection Settings Dialog Box for Citrix Receiver Page51of89

52 TheLocal ResourcestabdisplayaboutAudio/USBsettings,youareabletoselect whetheruseaudio/usbdeviceredirectionafterloginsystem. Figure: Connection Settings Dialog Box for Citrix Receiver Local Resources Tab Page52of89

53 ThinWiz Microsoft Remote Desktop Client(RDP) IfyouchooseMicrosoft Remote Desktop Client(RDP),pleaseenterconnection nameandseveripaddress/domainnameindialogbox. TheGeneraltabdisplayaboutloginsettings,youareabletoenterusername, passwordanddomain,andselectwhetherautologinsystemafterconnectingserver. Figure: Connection Settings Dialog Box for RDP Login Tab P.s:ClickAdvancethenopenothertab. TheDisplaytabdisplayaboutscreensettings,youareabletoselectwhetheruse fullscreensystemafterloginsystem. Figure: Connection Settings Dialog Box for RDP Display Tab Page53of89

54 TheLocal ResourcestabdisplayaboutSound/Audio/USBsettings,youareableto selectwhetherusesound/audio/usbdeviceredirectionafterloginsystem. Figure: Connection Settings Dialog Box for RDP Local Resources Tab TheProgramstabcansettheprogramwhichlaunchafterconnectionactivate. Figure: Connection Settings Dialog Box for RDP Programs Tab The Performance tab can set the performance which launch after connection activate. Page54of89

55 Figure: Connection Settings Dialog Box for RDP Performance Tab ThinWiz VMware View IfyouchooseVMware View,pleaseenterseverIPaddress/username/password anddomainindialogbox. YoucanuseAdvancetoopenadvancedsettings,theLogintabdisplayaboutlogin settings,youareabletoenterusername,passwordanddomain,andselectwhether autologinsystemafterconnectingserver. Figure: Connection Settings Dialog Box for VMware View General Page55of89

56 TheLocal ResourcestabdisplayaboutSound/Audio/USBsettings,youareableto selectwhetherusesound/audio/usbdeviceredirectionafterloginsystem. Figure: Connection Settings Dialog Box for VMware View Local Resources Tab The Performance tab can set the performance which launch after connection activate. Figure: Connection Settings Dialog Box for VMware View Preferences Tab IfyouchooseCitrix ICA Client,pleaseenterconnectionnameandXenAppsever URLindialogbox.Tocontinuewithselectaconnectingtype,ifchooseserver,enter Page56of89

57 servernameelseentercommandlineandworkingdirectory.onlogin Settingframe, you are able to enter user name, domain name and select weather logon Citrix serverthroughsmartcard. Figure: Connection Settings Dialog Box for Citrix ICA Client Page57of89

58 IfyouchooseMicrosoft Remote Desktop Client(RDP),pleaseenterconnection nameandseveripaddress/domainnameindialogbox. TheGeneraltabdisplayaboutloginsettings,youareabletoenterusername, passwordanddomain,andselectwhetherautologinsystemafterconnectingserver. Figure: Connection Settings Dialog Box for RDP Login Tab TheDisplaytabdisplayaboutscreensettings,youareabletoselectwhetheruse fullscreensystemafterloginsystem. Figure: Connection Settings Dialog Box for RDP Display Tab Page58of89

59 TheLocal ResourcestabdisplayaboutSound/Audio/USBsettings,youareableto selectwhetherusesound/audio/usbdeviceredirectionafterloginsystem. Figure: Connection Settings Dialog Box for RDP Local Resources Tab TheProgramstabcansettheprogramwhichlaunchafterconnectionactivate. Figure: Connection Settings Dialog Box for RDP Programs Tab Page59of89

60 IfyouchooseMicrosoft Remote Apps(RemoteApps),pleaseenterconnection nameandseveripaddress/domainnameindialogbox. The Logon Setting tab display about login settings, you are able to enter user name,passwordanddomain. Figure: Connection Settings Dialog Box for Remote Apps Logon Setting Tab TheApplicationtabdisplayaboutapplicationsettings,youmustenteralias( + executable file name of application) and commandline arguments (if the applicationrequiresarguments). Figure: Connection Settings Dialog Box for Remote Apps Application Tab Page60of89

61 If you choose VMware View, please enter connection name and sever IP address/domainnameindialogbox. YoucanuseAdvancetoopenadvancedsettings,theLogintabdisplayaboutlogin settings,youareabletoenterusername,passwordanddomain,andselectwhether autologinsystemafterconnectingserver. Figure: Connection Settings Dialog Box for VMware View Login Tab TheDisplaytabdisplayaboutscreensettings,youareabletoselectwhetheruse fullscreensystemafterloginsystem. Figure: Connection Settings Dialog Box for VMware View Display Tab Page61of89

62 TheUSBtabdisplayaboutUSBsettings,youareabletoselectwhetheruseUSB deviceredirectionafterloginsystem. Figure: Connection Settings Dialog Box for VMware View USB Tab IfyouchooseWeb Browser,pleaseenterconnectionnameandstartpageURLin dialogbox. Figure: Connection Settings Dialog Box for Web Browser Page62of89

63 If you choose X11 Client, please enter connection name and VNC server IP address,selectaxdmmodeindialogbox. Figure: Connection Settings Dialog Box for X 11 Clients If you choose VNC Viewer, please enter connection name and VNC server IP address/domainnameindialogbox. Figure: Connection Settings Dialog Box for VNC Viewer Page63of89

64 If you choose Telnet, please enter connection name, server IP address/domain nameandusernameindialogbox. Figure: Connection Settings Dialog Box for Telnet If you choose SPICE Client, please enter connection name, SPICE server IP address/domainnameandserverport(defaultis5900)indialogbox. Figure: Connection Settings Dialog Box for SPICE Client Page64of89

65 48 Managing Firmware Thischapterdescribeshowtocloneandupdatefirmwareimageforthedevice. FirmwareManagerisapowerfulfunctionforbackupfirmwareimageofthedevice,it provide simple operating steps and assist administrator to complete the task of saving and restoring firmware image. It is sometimes also clone a firmware to another device to resolve system problem, or upgrade your system from a new firmwareimage. 481 Create a Firmware File from Thin Client ADMConsoleprovidesawayofcloningfirmwarefromeachdevice,andallows you upload firmware to ADM server from rightclick context menu with Firmware Clone. Then you will see a Firmware Clone dialog box, please modify the file name. Pleasewaitforafewminutes,thedevicewillrebootandstarttocreatefirmware imagefile.creatingimagefiletimeisdifferentaccordingtothedifferentthinclient operatingsystem. Figure: Clone Firmware from Thin Client Page65of89

66 Figure: Firmware Clone Dialog Box 482 Import a Firmware File from Local computer Ifyoualreadyhaveafirmwareimagefile(.afw),alsodirectlyimportfiletoADM serverfromlocalcomputer. Please doubleclick Firmware from tree pane and use rightclick context menu withfile Importonconsolepage.ThenyouwillseeanImport an Image Filedialog box, please choose a file (.afw). When you have finished that import a firmware imagefile,whilethelistoffirmwareconsolepagewilldisplayit. Figure: Import Firmware from Local Computer Page66of89

67 Figure: Import an Image File Dialog Box Figure: Import Firmware Image File to Finish 483 Update Firmware of Thin Client YouarereadytothefirmwareimagefileinADMserver,andstarttoupdateor restorethedevice. Page67of89

68 Please choose a device from Group console page and use rightclick context menuwithfirmware Update.ThenyouwillseeaFirmware Image Filedialogbox, pleasechooseafile(.afw).pleasewaitforafewminutes,thedevicewillrebootand starttorestoreprocedure.restoretimeisdifferentaccordingtothedifferentthin clientoperatingsystem. * Tip: Ifyouwanttorestoreanotherdevicethroughnonownedimagefile,youmust selectoption Reset SID inordertoavoidthedevicessid(terminalname)is conflict. Figure: Restore Firmware to Thin Client Figure: Firmware Image File Dialog Box Page68of89

69 484 Maintain Firmware File ADMConsoleprovidesbasicoperatingfunctionofthefileinordertomaintain firmware image file easily in ADM server. Please doubleclick Firmware from tree pane,youareabletomaintainthesefirmwareimagefilethroughrightclickcontext menu. Figure: Firmware s RightClick Context Menu Thefunctionsareasfollowing: File Export:Downloadthefiletolocalcomputer. File Duplicate:Copyaduplicatefile. File Rename:Renametheselectedfile. File Delete:Deletetheselectedfile. Refresh:Refreshthelistoffirmwareimagefile. Page69of89

70 49 Managing Template Thischapterdescribeshowtoassistadministratortoeasilyperformcompany s policyandmanagethedevicethoughusingtemplatemanager. The Template Manager allows you build a template file from the device and deployittootherdevice.admconsolealsoprovideawaythatadministratoreasily maintain template file, and assist administrator to build template file of different policy. 491 Create a Template File from Thin Client Firstyoumustobtainatemplatefileassamplefilefromthedevice.ADMConsole allowsyouuploadtemplatefiletoadmserverfromrightclickcontextmenuwith Get Template from Client. ThenyouwillseeaTemplate Filedialogbox,pleaseenterfilename.Pleasewait forafewminutes,admwillstarttocapturedevicedataandcreatetemplatefile. Figure: Get Template File from Thin Client Page70of89

71 Figure: Template File Dialog Box 492 Import a Template File from Local Computer Ifyoualreadyhaveatemplatefile(.aft),alsodirectlyimportfiletoADMserver fromlocalcomputer. Please doubleclick Template from tree pane and use rightclick context menu withfile Import onconsolepage.thenyouwillseeanupload a Template Filedialog box,pleasechooseafile(.aft). Whenyouhavefinishedthatimportatemplatefile, whilethelistoftemplateconsolepagewilldisplayit. Figure: Import Template File from Local Computer Page71of89

72 Figure: Upload an Template File Dialog Box Figure: Import Template File to Finish Page72of89

73 493 How to Apply Template for Thin Client YouarereadytothetemplatefileinADMserver,andstarttoupdatethedevice. PleasechooseadevicefromGroup Nameoftreepaneanduserightclickcontext menuwithapply Template.ThenyouwillseeaFirmware Image Filedialogboxand chooseafile(.aft).pleasewaitforafewminutes,thedevicewillstarttoupdatedata ofpropertiesandconnectionsthenreboot. * Tip: Wesuggestthatdifferentthinclientoperatingsystemuseowntemplatefilein ordertoavoidthesettingsisexceptional. * Tip: Thedevicemustbeonlinebeforeitupdatesdata. Figure: Apply to Update Thin Client Page73of89

74 Figure: Template File Dialog Box In addition to the above way, you may also apply template from Template console page. Please choose a file from Template console page and use rightclick contextmenuwithapply Template onthetemplatefile.thenyouwillseeaclient Listdialogbox,pleaseaddtheclientsthatwantbeupdated.Pleasewaitforafew minutes, the device will start to update data of properties and connections then reboot. Figure: Apply to Update Thin Client from Template Console Page Page74of89

75 Figure: Client List Dialog Box 494 Maintain Template File Atemplatefileconsistsofdevicepropertiesandconnectionmanagement.ADM Consoleallowsyoumaintainthesedatatobuildtemplatesamplefile.Pleaseselecta templatefileanduserightclickcontextmenu.ifchoosemodify Template,youwill seea Control Panel Settingswindow.Youareabletochangethesedeviceproperties, such as display, keyboard, mouse, sound, networking, regional and advanced properties.thedetailsofuserinterfacerefer ChangeDeviceProperties. * Tip: TheterminalnameandIPaddressarenotallowedtochangeastoavoidthe deviceterminalnameandipconflicts. Figure: RightClick Context Menu for maintaining Template File Page75of89

76 Figure: Template Name Had Been Disabled IfchooseConnection Manager,youwillseeaConnect Hostwizard.Youareableto maintaintheseconnectionsettings,suchascitrixica,rdp,remoteapps,vmware View,WebBrowser,X11Client,VNCViewer,TelnetandSPICEClient.Theoperating detailsrefer ManagingDeviceConnections. Figure: Connect Host Wizard Page76of89

77 ADMConsoleprovidesbasicoperatingfunctionofthefileinordertomaintain templatefileeasilyinadmserver.pleasedoubleclicktemplatefromtreepane,you areabletomaintainthesetemplatefilethroughrightclickcontextmenu. Figure: Template s RightClick Context Menu Thefunctionsareasfollowing: File Export:Downloadthefiletolocalcomputer. File Duplicate:Copyaduplicatefile. File Rename:Renametheselectedfile. File Delete:Deletetheselectedfile. Refresh:Refreshthelistoftemplatefile. Page77of89

78 410 Managing Update This chapter describes how to update file of the device. Update Manager is a convenient function for Windows operating system, it can directly install program (forexample,patchfile)onthedeviceandassistadministratortoresolveproblem. * Caution: UpdatefeatureisonlysupportedonWES7andWES2009clients Import a Component File from Local Computer Please you prepare a file (.msi or.exe) and directly import file to ADM server fromlocalcomputer. PleasedoubleclickComponentfromtreepaneanduserightclickcontextmenu withfile Importonconsolepage.ThenyouwillseeanUpload a Component File dialogbox,pleasechooseafile(.msior.exe). Whenyouhavefinishedthatuploada componentfile,whilethelistofcomponentconsolepagewilldisplayit. Figure: Import Component from Local Computer Page78of89

79 Figure: Upload an Component File Dialog Box Figure: Import Component File to Finish 4102 How to Update Component for Thin Client IfyouarereadytothecomponentfileinADMserver,andthenstarttoupdate thedevice. Page79of89

80 Please choose a file from Component console page and use rightclick context menuwithupdate Component onthecomponentfile.thenyouwillseeaclient List dialog box, please add the clients that want be updated. Please wait for a few minutes,thedevicewillstartinstallationprocedure. Figure: Thin Client Update Component Figure: Client List Dialog Box Page80of89

81 4103 Maintain Component File ADMConsoleprovidesbasicoperatingfunctionofthefileinordertomaintain componentfileeasilyinadmserver.pleasedoubleclickcomponentfromtreepane, youareabletomaintainthesecomponentfilethroughrightclickcontextmenu. Figure: Component s RightClick Context Menu Thefunctionsareasfollowing: File Export:Downloadthefiletolocalcomputer. File Duplicate:Copyaduplicatefile. File Rename:Renametheselectedfile. File Delete:Deletetheselectedfile. Refresh:Refreshthelistofcomponentfile. Page81of89

82 411 Managing Schedule Task Thischapterdescribeshowtoassistadministratortoeasilyperformcompany s policyandmaintainthedevicethoughusingschedulemanager. TheScheduleManagerallowsyouscheduleanytimetomaintainthedevice.You maybe need to implement regular rule, it provides simple configuration steps and assistadministratortobuildtaskofdifferentpolicy Create a Schedule Task Please doubleclick Schedule Task from tree pane and use rightclick context menuwithnew a Schedule TaskonSchedule Taskconsolepage.Thenyouwillseea Scheduledialogbox,pleasesetupaboutinformation. ADMConsoleprovidesfouractions,suchasWakeonLAN,Reboot,Shutdownand Update (restore device from firmware). When you choose Update, must select a firmwareimagefileinthesametime. * Tip: InClients list,itwilldisplayallofdevicehavebeenauthenticated. Figure: Create a New Schedule Task Page82of89

83 Figure: Schedule Dialog Box Figure: File Dialog Box Page83of89

84 4112 Modify Your Schedule Task Please doubleclick Schedule Task from tree pane and use rightclick context menuwithedit a Schedule Task onatask.thenyouwillseeascheduledialogbox, andpleasemodifyaboutinformation. Figure: Edit a Schedule Task Page84of89

85 4113 How to Manage Schedule Task ADMConsoleprovidesbasicoperatingfunctionofthetaskinordertomanage thetaskeasily.pleasedoubleclickschedule Taskfromtreepane,youcandirectly viewtaskstatusandrunactionsofthetaskthroughrightclickcontextmenu. Figure: View Schedule Task Status Figure: Schedule Task s RightClick Context Menu Thefunctionsareasfollowing: Pending: Holddownthetask. Resume: Restartthetask. Delete:Deletethetask. Execute: Executethetaskimmediately. Refresh: Refreshthetasklist. Page85of89

86 412 Viewing System Log ThischapterdescribeswhichADMprovidevarioustypesofthedeviceactionlogs andhowtoassistadministratortoeasilytracelogs. ADM will automatically records your operation behavior, and provide a simply queryfunctiontoassistadministratortoaccesstheseinformation How to View Details of Log ADMConsoleprovidesaqueryfunctiontoviewalldetailsoflog.Pleasedouble clicklogfromtreepane,youcanchooseoneofthetabsyouwanttoviewlog.you mustentersearchcondition(matterwhatkindoflog,logdateisrequired),andthen clickapplytodisplaylogrecords. *Tip:Eachpagedisplaysalistofonly50recordsoflog.YoucanclickDatabuttonto viewnextorprevious50records. Figure: Data Button :Displaynext50records. :Displayprevious50records. Table: List all of Log Type Log Type Description Search Condition Logon RecorduserloginorlogoutADM. LogDate(Required) Device Group Template Firmware Component Schedule Recordtheactionsofmanagingdeviceand executionresultsofadevice. Recordtheactionsofmanaginggroupand executionresultsofadevice. Recordtheactionsofmanagingtemplateand executionresultsofadevice. Recordtheactionsofmanagingfirmwareand executionresultsofadevice. Recordtheactionsofmanagingupdateand executionresultsofadevice. Recordtheactionsofmanagingscheduletask andexecutionresultsofadeviceortask. LogDate(Required) DeviceMAC DeviceName LogDate(Required) GroupName LogDate(Required) TemplateName LogDate(Required) FirmwareName LogDate(Required) ComponentName LogDate(Required) Page86of89

87 Figure: View All Details of Log Figure: View Next or Previous 50 Records of Log WhenAMDmanagesmorethanonedeviceatsametime,youcanalsodouble clickonerecordtoviewmoredetailsofthedeviceifyousawtheword Doubleclick seedetail inmemofield. Page87of89

88 Figure: DoubleClick a Record to View More Details of the Device Figure: Details of the Device 4122 How to Export Details of Log ADM supports export the logs to a.txt or.csv file. First you must inquire the recordsoflogyouwant,andclickexporttouseexporttoafiledialogbox,please enterfilenameandselectfiletype,andthenclicksavetofinishexportingthelogs. *Tip:TextfileformatistabdelimitedandCSVfileformatiscommaseparated. Page88of89

89 Figure: Export the Logs to a File Figure: Export to a File Dialog Box Page89of89

2X ApplicationServer & LoadBalancer Manual

2X ApplicationServer & LoadBalancer Manual 2X ApplicationServer & LoadBalancer Manual 2X ApplicationServer & LoadBalancer Contents 1 URL: www.2x.com E-mail: [email protected] Information in this document is subject to change without notice. Companies,

More information

Contents. 1-10ZiG Manager. 2 - Thin Client Management. 1.1 - Configuring and Managing the Server. 1.1.1 - Server Settings. 1.1.2 - Network Settings

Contents. 1-10ZiG Manager. 2 - Thin Client Management. 1.1 - Configuring and Managing the Server. 1.1.1 - Server Settings. 1.1.2 - Network Settings Contents 1-10ZiG Manager 1.1 - Configuring and Managing the Server 1.1.1 - Server Settings 1.1.2 - Network Settings 1.1.3 - Ports Used 1.1.4 - Discovery Settings 1.1.5 - Advanced Settings 1.1.6 - Starting

More information

2X ApplicationServer & LoadBalancer Manual

2X ApplicationServer & LoadBalancer Manual 2X ApplicationServer & LoadBalancer Manual 2X ApplicationServer & LoadBalancer Contents 1 URL: www.2x.com E-mail: [email protected] Information in this document is subject to change without notice. Companies,

More information

ACP ThinManager Tech Notes Troubleshooting Guide

ACP ThinManager Tech Notes Troubleshooting Guide ACP ThinManager Tech Notes Troubleshooting Guide Use the F1 button on any page of a ThinManager wizard to launch Help for that page. Visit www.thinmanager.com/technotes/ to download the manual, manual

More information

SC-T35/SC-T45/SC-T46/SC-T47 ViewSonic Device Manager User Guide

SC-T35/SC-T45/SC-T46/SC-T47 ViewSonic Device Manager User Guide SC-T35/SC-T45/SC-T46/SC-T47 ViewSonic Device Manager User Guide Copyright and Trademark Statements 2014 ViewSonic Computer Corp. All rights reserved. This document contains proprietary information that

More information

Legal Notes. Regarding Trademarks. 2012 KYOCERA Document Solutions Inc.

Legal Notes. Regarding Trademarks. 2012 KYOCERA Document Solutions Inc. Legal Notes Unauthorized reproduction of all or part of this guide is prohibited. The information in this guide is subject to change without notice. We cannot be held liable for any problems arising from

More information

Configure thin client settings locally

Configure thin client settings locally This chapter contains information to help you set up your thin client hardware, look and feel, and system settings using the Control Center. Tip While it is not recommended to use dialog boxes for configuring

More information

User Manual. Onsight Management Suite Version 5.1. Another Innovation by Librestream

User Manual. Onsight Management Suite Version 5.1. Another Innovation by Librestream User Manual Onsight Management Suite Version 5.1 Another Innovation by Librestream Doc #: 400075-06 May 2012 Information in this document is subject to change without notice. Reproduction in any manner

More information

2X ApplicationServer & LoadBalancer & VirtualDesktopServer Manual

2X ApplicationServer & LoadBalancer & VirtualDesktopServer Manual 2X ApplicationServer & LoadBalancer & VirtualDesktopServer Manual 2X VirtualDesktopServer Contents 1 2X VirtualDesktopServer Contents 2 URL: www.2x.com E-mail: [email protected] Information in this document

More information

2XApplication Server XG v10.1

2XApplication Server XG v10.1 2XApplication Server XG v10.1 Introduction 1 URL: www.2x.com E-mail: [email protected] Information in this document is subject to change without notice. Companies, names, and data used in examples herein are

More information

2X ApplicationServer & LoadBalancer Manual

2X ApplicationServer & LoadBalancer Manual 2X ApplicationServer & LoadBalancer Manual 2X ApplicationServer & LoadBalancer Contents 1 URL: www.2x.com E-mail: [email protected] Information in this document is subject to change without notice. Companies,

More information

Sharp Remote Device Manager (SRDM) Server Software Setup Guide

Sharp Remote Device Manager (SRDM) Server Software Setup Guide Sharp Remote Device Manager (SRDM) Server Software Setup Guide This Guide explains how to install the software which is required in order to use Sharp Remote Device Manager (SRDM). SRDM is a web-based

More information

Administrators Guide. Wyse Device Manager Release 4.9.1. Issue: 042012 PN: 883885-01 Rev. N

Administrators Guide. Wyse Device Manager Release 4.9.1. Issue: 042012 PN: 883885-01 Rev. N Administrators Guide Wyse Device Manager Release 4.9.1 Issue: 042012 PN: 883885-01 Rev. N Copyright Notices 2012, Wyse Technology Inc. All rights reserved. This manual and the software and firmware described

More information

2XApplication Server XG v10.6

2XApplication Server XG v10.6 2XApplication Server XG v10.6 Introduction 1 URL: www.2x.com E-mail: [email protected] Information in this document is subject to change without notice. Companies, names, and data used in examples herein are

More information

SonicWALL SSL VPN 3.5: Virtual Assist

SonicWALL SSL VPN 3.5: Virtual Assist SonicWALL SSL VPN 3.5: Virtual Assist Document Scope This document describes how to use the SonicWALL Virtual Assist add-on for SonicWALL SSL VPN security appliances. This document contains the following

More information

Remote Application Server Version 14. Last updated: 06-02-15

Remote Application Server Version 14. Last updated: 06-02-15 Remote Application Server Version 14 Last updated: 06-02-15 Information in this document is subject to change without notice. Companies, names, and data used in examples herein are fictitious unless otherwise

More information

Version 3.8. Installation Guide

Version 3.8. Installation Guide Version 3.8 Installation Guide Copyright 2007 Jetro Platforms, Ltd. All rights reserved. This document is being furnished by Jetro Platforms for information purposes only to licensed users of the Jetro

More information

Quick start to evaluating HP Windows Embedded Standard 2009 Thin Clients. HP t5630w, HP t5730w, HP t5740, HP gt7720

Quick start to evaluating HP Windows Embedded Standard 2009 Thin Clients. HP t5630w, HP t5730w, HP t5740, HP gt7720 Get your thin client running Right out of the box Quick start to evaluating HP Windows Embedded Standard 2009 Thin Clients HP t5630w, HP t5730w, HP t5740, HP gt7720 Get your new thin client system up and

More information

Aspera Connect User Guide

Aspera Connect User Guide Aspera Connect User Guide Windows XP/2003/Vista/2008/7 Browser: Firefox 2+, IE 6+ Version 2.3.1 Chapter 1 Chapter 2 Introduction Setting Up 2.1 Installation 2.2 Configure the Network Environment 2.3 Connect

More information

Remote Application Server Version 14. Last updated: 25-02-15

Remote Application Server Version 14. Last updated: 25-02-15 Remote Application Server Version 14 Last updated: 25-02-15 Information in this document is subject to change without notice. Companies, names, and data used in examples herein are fictitious unless otherwise

More information

Network Setup Guide. Introduction. Setting up for use over LAN

Network Setup Guide. Introduction. Setting up for use over LAN Network Setup Guide This manual contains the setup information required to use the machine over wired LAN. If you use the machine with USB connection, refer to your setup sheet. Introduction To use the

More information

Moxa Device Manager 2.0 User s Guide

Moxa Device Manager 2.0 User s Guide First Edition, March 2009 www.moxa.com/product 2009 Moxa Inc. All rights reserved. Reproduction without permission is prohibited. Moxa Device Manager 2.0 User Guide The software described in this manual

More information

Installation Guide. Wyse Device Manager Release 4.8.5. Issue: 042511 PN: 883886-01 Rev. L

Installation Guide. Wyse Device Manager Release 4.8.5. Issue: 042511 PN: 883886-01 Rev. L Installation Guide Wyse Device Manager Release 4.8.5 Issue: 042511 PN: 883886-01 Rev. L Copyright Notices 2011, Wyse Technology Inc. All rights reserved. This manual and the software and firmware described

More information

Citrix Access Gateway Plug-in for Windows User Guide

Citrix Access Gateway Plug-in for Windows User Guide Citrix Access Gateway Plug-in for Windows User Guide Access Gateway 9.2, Enterprise Edition Copyright and Trademark Notice Use of the product documented in this guide is subject to your prior acceptance

More information

Quick Start to Evaluating. HP t5630w, HP t5730w, HP gt7720

Quick Start to Evaluating. HP t5630w, HP t5730w, HP gt7720 Get your thin client Get your running thin client running Right out Right out of of the box the box Quick Start to Evaluating HP Windows Embedded Standard Thin Clients HP t5630w, HP t5730w, HP gt7720 Get

More information

Avalanche Remote Control User Guide. Version 4.1.3

Avalanche Remote Control User Guide. Version 4.1.3 Avalanche Remote Control User Guide Version 4.1.3 ii Copyright 2012 by Wavelink Corporation. All rights reserved. Wavelink Corporation 10808 South River Front Parkway, Suite 200 South Jordan, Utah 84095

More information

Deploying BitDefender Client Security and BitDefender Windows Server Solutions

Deploying BitDefender Client Security and BitDefender Windows Server Solutions Deploying BitDefender Client Security and BitDefender Windows Server Solutions Quick Install Guide Copyright 2010 BitDefender; 1. Installation Overview Thank you for selecting BitDefender Business Solutions

More information

VMware/Hyper-V Backup Plug-in User Guide

VMware/Hyper-V Backup Plug-in User Guide VMware/Hyper-V Backup Plug-in User Guide COPYRIGHT No part of this publication may be reproduced, stored in a retrieval system, or transmitted in any form or by any means, electronic, mechanical, photocopying,

More information

29 ThinManager Troubleshooting Guide

29 ThinManager Troubleshooting Guide 29 ThinManager Troubleshooting Guide This is a list of common configuration errors and a guide for fixing them. Note: When any problem arises, check Downloads at www.thinmanager.com for the latest firmware

More information

Installing and Configuring vcloud Connector

Installing and Configuring vcloud Connector Installing and Configuring vcloud Connector vcloud Connector 2.7.0 This document supports the version of each product listed and supports all subsequent versions until the document is replaced by a new

More information

Remote Monitoring and Control of the R&S FSL with a Web Browser

Remote Monitoring and Control of the R&S FSL with a Web Browser Rohde & Schwarz Products: R&S FSL3, R&S FSL6, R&S FSL18 Remote Monitoring and Control of the R&S FSL with a Web Browser Application Note This application notes describes remote operation or monitoring

More information

4cast Client Specification and Installation

4cast Client Specification and Installation 4cast Client Specification and Installation Version 2015.00 10 November 2014 Innovative Solutions for Education Management www.drakelane.co.uk System requirements The client requires Administrative rights

More information

Windows Embedded Standard 7 (WES7) Administration Guide

Windows Embedded Standard 7 (WES7) Administration Guide Windows Embedded Standard 7 (WES7) Administration Guide Notes, Cautions, and Warnings NOTE: A NOTE indicates important information that helps you make better use of your computer. CAUTION: A CAUTION indicates

More information

TDP43ME NetPS. Network Printer Server. Control Center. for Ethernet Module

TDP43ME NetPS. Network Printer Server. Control Center. for Ethernet Module Panduit Corp. 2010 TDP43ME NetPS PA26306A01 Rev. 01 11-2010 Network Printer Server Control Center for Ethernet Module NOTE: In the interest of higher quality and value, Panduit products are continually

More information

HP MediaSmart Server Software Upgrade from v.2 to v.3

HP MediaSmart Server Software Upgrade from v.2 to v.3 HP MediaSmart Server Software Upgrade from v.2 to v.3 Table of Contents Table of Contents Upgrade Your Server Software to HP MediaSmart Server v.3 2 Before You Begin 3 What's New 3 Features That Will

More information

Remote Monitoring and Control of the R&S FSV with a Web Browser

Remote Monitoring and Control of the R&S FSV with a Web Browser Rohde & Schwarz Products: R&S FSV3, R&S FSV7, R&S FSV13, R&S FSV30 Remote Monitoring and Control of the R&S FSV with a Web Browser Application Note This application note describes remote operation or monitoring

More information

Kaseya Server Instal ation User Guide June 6, 2008

Kaseya Server Instal ation User Guide June 6, 2008 Kaseya Server Installation User Guide June 6, 2008 About Kaseya Kaseya is a global provider of IT automation software for IT Solution Providers and Public and Private Sector IT organizations. Kaseya's

More information

Thin Client Manager. Table of Contents. 1-10ZiG Manager. 2 - Thin Client Management. 3 - Remote client configurations. 1 of 16

Thin Client Manager. Table of Contents. 1-10ZiG Manager. 2 - Thin Client Management. 3 - Remote client configurations. 1 of 16 1 of 16 Thin Client Manager Table of Contents 1-10ZiG Manager 1.1 - Configuring and Managing the Server 1.1.1 - Server Settings 1.1.2 - Starting and Stopping the Server 1.2 - Configuring and Starting the

More information

Global VPN Client Getting Started Guide

Global VPN Client Getting Started Guide Global VPN Client Getting Started Guide 1 Notes, Cautions, and Warnings NOTE: A NOTE indicates important information that helps you make better use of your system. CAUTION: A CAUTION indicates potential

More information

Getting started. Symantec AntiVirus Corporate Edition. About Symantec AntiVirus. How to get started

Getting started. Symantec AntiVirus Corporate Edition. About Symantec AntiVirus. How to get started Getting started Corporate Edition Copyright 2005 Corporation. All rights reserved. Printed in the U.S.A. 03/05 PN: 10362873 and the logo are U.S. registered trademarks of Corporation. is a trademark of

More information

Quadro Configuration Console User's Guide. Table of Contents. Table of Contents

Quadro Configuration Console User's Guide. Table of Contents. Table of Contents Epygi Technologies Table of Contents Table of Contents About This User s Guide... 3 Introducing the Quadro Configuration Console... 4 Technical Specification... 6 Requirements... 6 System Requirements...

More information

Metalogix SharePoint Backup. Advanced Installation Guide. Publication Date: August 24, 2015

Metalogix SharePoint Backup. Advanced Installation Guide. Publication Date: August 24, 2015 Metalogix SharePoint Backup Publication Date: August 24, 2015 All Rights Reserved. This software is protected by copyright law and international treaties. Unauthorized reproduction or distribution of this

More information

Important Notes for WinConnect Server ES Software Installation:

Important Notes for WinConnect Server ES Software Installation: Important Notes for WinConnect Server ES Software Installation: 1. Only Windows 8/8.1 Enterprise, Windows 8/8.1 Professional (32-bit & 64-bit) or Windows Server 2012 (64-bit) or Windows Server 2012 Foundation

More information

FileMaker Server 11. FileMaker Server Help

FileMaker Server 11. FileMaker Server Help FileMaker Server 11 FileMaker Server Help 2010 FileMaker, Inc. All Rights Reserved. FileMaker, Inc. 5201 Patrick Henry Drive Santa Clara, California 95054 FileMaker is a trademark of FileMaker, Inc. registered

More information

Product Description. Licenses Notice. Introduction TC-200

Product Description. Licenses Notice. Introduction TC-200 User Manual TC-200 Introduction TC-200 Product Description The TC-200 provides the fastest Thin Client performance on the market, It runs embedded Linux, swing user interface, Citrix 6.3, Microsoft RDP

More information

Deploying BitDefender Client Security and BitDefender Windows Server Solutions

Deploying BitDefender Client Security and BitDefender Windows Server Solutions Deploying BitDefender Client Security and BitDefender Windows Server Solutions Quick Install Guide Copyright 2011 BitDefender 1. Installation Overview Thank you for selecting BitDefender Business Solutions

More information

523 Non-ThinManager Components

523 Non-ThinManager Components 28 Non-ThinManager Components Microsoft Terminal Servers play an important role in the ThinManager system. It is recommended that you become familiar with the documentation provided by Microsoft about

More information

CONNECT-TO-CHOP USER GUIDE

CONNECT-TO-CHOP USER GUIDE CONNECT-TO-CHOP USER GUIDE VERSION V8 Table of Contents 1 Overview... 3 2 Requirements... 3 2.1 Security... 3 2.2 Computer... 3 2.3 Application... 3 2.3.1 Web Browser... 3 2.3.2 Prerequisites... 3 3 Logon...

More information

HP MediaSmart Server Software Upgrade from v.1 to v.3

HP MediaSmart Server Software Upgrade from v.1 to v.3 HP MediaSmart Server Software Upgrade from v.1 to v.3 Table of Contents Upgrade Your Server Software to HP MediaSmart Server v.3 2 Before You Begin 3 What's New... 3 Features That Will Change... 4 Prepare

More information

WhatsUp Gold v16.3 Installation and Configuration Guide

WhatsUp Gold v16.3 Installation and Configuration Guide WhatsUp Gold v16.3 Installation and Configuration Guide Contents Installing and Configuring WhatsUp Gold using WhatsUp Setup Installation Overview... 1 Overview... 1 Security considerations... 2 Standard

More information

Getting Started with ESXi Embedded

Getting Started with ESXi Embedded ESXi 4.1 Embedded vcenter Server 4.1 This document supports the version of each product listed and supports all subsequent versions until the document is replaced by a new edition. To check for more recent

More information

HP Connection Manager. Administrator's Guide

HP Connection Manager. Administrator's Guide HP Connection Manager Administrator's Guide Copyright 2011 Hewlett-Packard Development Company, L.P. The information contained herein is subject to change without notice. Microsoft, Windows, and Windows

More information

FTP, IIS, and Firewall Reference and Troubleshooting

FTP, IIS, and Firewall Reference and Troubleshooting FTP, IIS, and Firewall Reference and Troubleshooting Although Cisco VXC Manager automatically installs and configures everything you need for use with respect to FTP, IIS, and the Windows Firewall, the

More information

Gigabyte Management Console User s Guide (For ASPEED AST 2400 Chipset)

Gigabyte Management Console User s Guide (For ASPEED AST 2400 Chipset) Gigabyte Management Console User s Guide (For ASPEED AST 2400 Chipset) Version: 1.4 Table of Contents Using Your Gigabyte Management Console... 3 Gigabyte Management Console Key Features and Functions...

More information

MDM Mass Configuration Tool User s Manual

MDM Mass Configuration Tool User s Manual User s Manual First Edition, October 2010 www.moxa.com/product 2010 Moxa Inc. All rights reserved. Reproduction without permission is prohibited. User s Manual The software described in this manual is

More information

Reference and Troubleshooting: FTP, IIS, and Firewall Information

Reference and Troubleshooting: FTP, IIS, and Firewall Information APPENDIXC Reference and Troubleshooting: FTP, IIS, and Firewall Information Although Cisco VXC Manager automatically installs and configures everything you need for use with respect to FTP, IIS, and the

More information

Deploying Remote Desktop Connection Broker with High Availability Step-by-Step Guide

Deploying Remote Desktop Connection Broker with High Availability Step-by-Step Guide Deploying Remote Desktop Connection Broker with High Availability Step-by-Step Guide Microsoft Corporation Published: May 2010 Abstract This guide describes the steps for configuring Remote Desktop Connection

More information

PowerLogic ION Enterprise 5.6

PowerLogic ION Enterprise 5.6 PowerLogic ION Enterprise 5.6 Power Management Software User Guide April 2007 Notices This section describes the symbols used in this guide. Danger This alerts you to things that may cause serious injury

More information

vspace Server Management Console

vspace Server Management Console vspace Server Management Console User Manual TABLE OF CONTENTS 1.0 Getting Started... 3 1.1 Installing vspace... 3 1.2 Registering vspace... 3 1.3 Connecting Your Devices... 3 2.0 NComputing vspace...

More information

Legal Notes. Regarding Trademarks. 2013 KYOCERA Document Solutions Inc.

Legal Notes. Regarding Trademarks. 2013 KYOCERA Document Solutions Inc. Legal Notes Unauthorized reproduction of all or part of this guide is prohibited. The information in this guide is subject to change without notice. We cannot be held liable for any problems arising from

More information

FileMaker Server 10 Help

FileMaker Server 10 Help FileMaker Server 10 Help 2007-2009 FileMaker, Inc. All Rights Reserved. FileMaker, Inc. 5201 Patrick Henry Drive Santa Clara, California 95054 FileMaker, the file folder logo, Bento and the Bento logo

More information

Xcalibur Global Version 1.2 Installation Guide Document Version 3.0

Xcalibur Global Version 1.2 Installation Guide Document Version 3.0 Xcalibur Global Version 1.2 Installation Guide Document Version 3.0 December 2010 COPYRIGHT NOTICE TRADEMARKS 2010 Chip PC Inc., Chip PC (Israel) Ltd., Chip PC (UK) Ltd., Chip PC GmbH All rights reserved.

More information

NETASQ SSO Agent Installation and deployment

NETASQ SSO Agent Installation and deployment NETASQ SSO Agent Installation and deployment Document version: 1.3 Reference: naentno_sso_agent Page 1 / 20 Copyright NETASQ 2013 General information 3 Principle 3 Requirements 3 Active Directory user

More information

Getting Started with Vision 6

Getting Started with Vision 6 Getting Started with Vision 6 Version 6.9 Notice Copyright 1981-2009 Netop Business Solutions A/S. All Rights Reserved. Portions used under license from third parties. Please send any comments to: Netop

More information

nappliance misa Server 2006 Standard Edition Users Guide For use with misa Appliances 2006 nappliance Networks, Inc.

nappliance misa Server 2006 Standard Edition Users Guide For use with misa Appliances 2006 nappliance Networks, Inc. nappliance misa Server 2006 Standard Edition Users Guide For use with misa Appliances The information contained in this document represents the current view of Microsoft Corporation on the issues discussed

More information

Step-by-Step Guide to Setup Instant Messaging (IM) Workspace Datasheet

Step-by-Step Guide to Setup Instant Messaging (IM) Workspace Datasheet Step-by-Step Guide to Setup Instant Messaging (IM) Workspace Datasheet CONTENTS Installation System requirements SQL Server setup Setting up user accounts Authentication mode Account options Import from

More information

visionapp Remote Desktop 2010 (vrd 2010)

visionapp Remote Desktop 2010 (vrd 2010) visionapp Remote Desktop 2010 (vrd 2010) Convenient System Management P roduct Information www.vrd2010.com Inhalt 1 Introduction... 1 2 Overview of Administration Tools... 1 2.1 RDP Administration Tools...

More information

Moxa Device Manager 2.3 User s Manual

Moxa Device Manager 2.3 User s Manual User s Manual Third Edition, March 2011 www.moxa.com/product 2011 Moxa Inc. All rights reserved. User s Manual The software described in this manual is furnished under a license agreement and may be used

More information

LTM Management Console. Administration Guide

LTM Management Console. Administration Guide LTM Management Console Administration Guide Notes, Cautions, and Warnings NOTE: A NOTE indicates important information that helps to make better use of the product. CAUTION: A CAUTION indicates potential

More information

How to use Mints@Home

How to use Mints@Home How to use Mints@Home Citrix Remote Access gives Mints users the ability to access University Of Cambridge and MINTS resources from any computer, anywhere in the world,. The service requires a high-speed

More information

User Guide. CTERA Agent. August 2011 Version 3.0

User Guide. CTERA Agent. August 2011 Version 3.0 User Guide CTERA Agent August 2011 Version 3.0 Copyright 2009-2011 CTERA Networks Ltd. All rights reserved. No part of this document may be reproduced in any form or by any means without written permission

More information

Installing and Configuring vcloud Connector

Installing and Configuring vcloud Connector Installing and Configuring vcloud Connector vcloud Connector 2.0.0 This document supports the version of each product listed and supports all subsequent versions until the document is replaced by a new

More information

WinConnect Server ES User Manual

WinConnect Server ES User Manual THINSOFT PTE LTD 23 Tai Seng Drive, #06-00, Singapore 535224, Fax (65) 6289-7308 www.thinsoftinc.com WinConnect Server ES User Manual Document Version 1.0 1 WinConnect Server ES User Manual Copyright 2007

More information

WhatsUp Gold v16.1 Installation and Configuration Guide

WhatsUp Gold v16.1 Installation and Configuration Guide WhatsUp Gold v16.1 Installation and Configuration Guide Contents Installing and Configuring Ipswitch WhatsUp Gold v16.1 using WhatsUp Setup Installing WhatsUp Gold using WhatsUp Setup... 1 Security guidelines

More information

Citrix EdgeSight for Load Testing User s Guide. Citrix EdgeSight for Load Testing 3.8

Citrix EdgeSight for Load Testing User s Guide. Citrix EdgeSight for Load Testing 3.8 Citrix EdgeSight for Load Testing User s Guide Citrix EdgeSight for Load Testing 3.8 Copyright Use of the product documented in this guide is subject to your prior acceptance of the End User License Agreement.

More information

Virtual Appliance Setup Guide

Virtual Appliance Setup Guide The Virtual Appliance includes the same powerful technology and simple Web based user interface found on the Barracuda Web Application Firewall hardware appliance. It is designed for easy deployment on

More information

Cloudvue Remote Desktop Client GUI User Guide

Cloudvue Remote Desktop Client GUI User Guide Cloudvue Remote Desktop Client GUI User Guide I. To connect to a Windows server - After power up, the login screen will be displayed. A. Auto Search/User Defined Use Auto Search to find available Windows

More information

Thinspace deskcloud. Quick Start Guide

Thinspace deskcloud. Quick Start Guide Thinspace deskcloud Quick Start Guide Version 1.2 Published: SEP-2014 Updated: 16-SEP-2014 2014 Thinspace Technology Ltd. All rights reserved. The information contained in this document represents the

More information

Setting up VMware ESXi for 2X VirtualDesktopServer Manual

Setting up VMware ESXi for 2X VirtualDesktopServer Manual Setting up VMware ESXi for 2X VirtualDesktopServer Manual URL: www.2x.com E-mail: [email protected] Information in this document is subject to change without notice. Companies, names, and data used in examples

More information

Step-by-Step Setup Guide Wireless File Transmitter FTP Mode

Step-by-Step Setup Guide Wireless File Transmitter FTP Mode EOS Step-by-Step Setup Guide Wireless File Transmitter FTP Mode Infrastructure Setup Windows 7 2012 Canon U.S.A., Inc. All Rights Reserved. Reproduction in whole or in part without permission is prohibited.

More information

VRC 7900/8900 Avalanche Enabler User s Manual

VRC 7900/8900 Avalanche Enabler User s Manual VRC 7900/8900 Avalanche Enabler User s Manual WLE-VRC-20030702-02 Revised 7/2/03 ii Copyright 2003 by Wavelink Corporation All rights reserved. Wavelink Corporation 6985 South Union Park Avenue, Suite

More information

VERITAS Backup Exec TM 10.0 for Windows Servers

VERITAS Backup Exec TM 10.0 for Windows Servers VERITAS Backup Exec TM 10.0 for Windows Servers Quick Installation Guide N134418 July 2004 Disclaimer The information contained in this publication is subject to change without notice. VERITAS Software

More information

For Active Directory Installation Guide

For Active Directory Installation Guide For Active Directory Installation Guide Version 2.5.2 April 2010 Copyright 2010 Legal Notices makes no representations or warranties with respect to the contents or use of this documentation, and specifically

More information

CTERA Agent for Mac OS-X

CTERA Agent for Mac OS-X User Guide CTERA Agent for Mac OS-X June 2014 Version 4.1 Copyright 2009-2014 CTERA Networks Ltd. All rights reserved. No part of this document may be reproduced in any form or by any means without written

More information

Citrix EdgeSight for Load Testing User s Guide. Citrx EdgeSight for Load Testing 2.7

Citrix EdgeSight for Load Testing User s Guide. Citrx EdgeSight for Load Testing 2.7 Citrix EdgeSight for Load Testing User s Guide Citrx EdgeSight for Load Testing 2.7 Copyright Use of the product documented in this guide is subject to your prior acceptance of the End User License Agreement.

More information

Quick Start Guide for VMware and Windows 7

Quick Start Guide for VMware and Windows 7 PROPALMS VDI Version 2.1 Quick Start Guide for VMware and Windows 7 Rev. 1.1 Published: JULY-2011 1999-2011 Propalms Ltd. All rights reserved. The information contained in this document represents the

More information

Attix5 Pro Server Edition

Attix5 Pro Server Edition Attix5 Pro Server Edition V7.0.3 User Manual for Linux and Unix operating systems Your guide to protecting data with Attix5 Pro Server Edition. Copyright notice and proprietary information All rights reserved.

More information

Connection and Printer Setup Guide

Connection and Printer Setup Guide Connection and Printer Setup Guide For connection issues, see the following sections of this document: "Connection Requirements" on page 1 "Log on" on page 2 "Troubleshooting Your Connection" on page 4

More information

Symantec PGP Whole Disk Encryption Hands-On Lab V 3.7

Symantec PGP Whole Disk Encryption Hands-On Lab V 3.7 Symantec PGP Whole Disk Encryption Hands-On Lab V 3.7 Description This hands-on lab session covers the hard drive encryption technologies from PGP. Students will administer a typical Whole Disk Encryption

More information

NETWORK PRINT MONITOR User Guide

NETWORK PRINT MONITOR User Guide NETWORK PRINT MONITOR User Guide Legal Notes Unauthorized reproduction of all or part of this guide is prohibited. The information in this guide is subject to change without notice. We cannot be held liable

More information

Scan to E-mail Quick Setup Guide

Scan to E-mail Quick Setup Guide Xerox WorkCentre M118i Scan to E-mail Quick Setup Guide 701P42574 This guide provides a quick reference for setting up the Scan to E-mail feature on the Xerox WorkCentre M118i. It includes procedures for:

More information

Installing the Operating System or Hypervisor

Installing the Operating System or Hypervisor Installing the Operating System or Hypervisor If you purchased E-Series Server Option 1 (E-Series Server without preinstalled operating system or hypervisor), you must install an operating system or hypervisor.

More information

Plesk 11 Manual. Fasthosts Customer Support

Plesk 11 Manual. Fasthosts Customer Support Fasthosts Customer Support Plesk 11 Manual This guide covers everything you need to know in order to get started with the Parallels Plesk 11 control panel. Contents Introduction... 3 Before you begin...

More information

Installation Notes for Outpost Network Security (ONS) version 3.2

Installation Notes for Outpost Network Security (ONS) version 3.2 Outpost Network Security Installation Notes version 3.2 Page 1 Installation Notes for Outpost Network Security (ONS) version 3.2 Contents Installation Notes for Outpost Network Security (ONS) version 3.2...

More information

Technical Brief for Windows Home Server Remote Access

Technical Brief for Windows Home Server Remote Access Technical Brief for Windows Home Server Remote Access Microsoft Corporation Published: October, 2008 Version: 1.1 Abstract This Technical Brief provides an in-depth look at the features and functionality

More information

Installation Guide. Wyse S Class Conversion to ThinOS. Wyse Simple Imager TM Release 2.0.2. Issue: 092611 PN: 883887-04L Rev. C

Installation Guide. Wyse S Class Conversion to ThinOS. Wyse Simple Imager TM Release 2.0.2. Issue: 092611 PN: 883887-04L Rev. C Installation Guide Wyse S Class Conversion to ThinOS Wyse Simple Imager TM Release 2.0.2 Issue: 092611 PN: 883887-04L Rev. C Copyright Notices 2011, Wyse Technology Inc. All rights reserved. This manual

More information

BlackArmor NAS 110 User Guide

BlackArmor NAS 110 User Guide BlackArmor NAS 110 User Guide BlackArmor NAS 110 User Guide 2010 Seagate Technology LLC. All rights reserved. Seagate, Seagate Technology, the Wave logo, and FreeAgent are trademarks or registered trademarks

More information

SHARP Digital Signage Software Pro PN-SS05 OPERATION MANUAL

SHARP Digital Signage Software Pro PN-SS05 OPERATION MANUAL SHARP Digital Signage Software Pro PN-SS05 Version 4.1 OPERATION MANUAL Contents Introduction... 2 Precautions on Use...2 Trademarks...2 How to Read this Manual...3 Definitions...3 Installing/Launching...

More information

Veeam Backup Enterprise Manager. Version 7.0

Veeam Backup Enterprise Manager. Version 7.0 Veeam Backup Enterprise Manager Version 7.0 User Guide August, 2013 2013 Veeam Software. All rights reserved. All trademarks are the property of their respective owners. No part of this publication may

More information

Step-by-Step Guide for Microsoft Advanced Group Policy Management 4.0

Step-by-Step Guide for Microsoft Advanced Group Policy Management 4.0 Step-by-Step Guide for Microsoft Advanced Group Policy Management 4.0 Microsoft Corporation Published: September 2009 Abstract This step-by-step guide describes a sample scenario for installing Microsoft

More information