The latest SPPS application data

Size: px
Start display at page:

Download "The latest SPPS application data"

Transcription

1 The latest SPPS application data -innovative solution for peptide chemistry- Biotage Japan Ltd. Fumio Kumakura Ph,D

2 Biotage With more than 5,000 discovery chemistry systems installed in over 600 facilities worldwide, Biotage automated systems and consumables work together to increase productivity and improve success rates Synthesis Work-up Purification Evaporation Microwave-Assisted Organic Synthesis (MAOS) Solid-Phase Extraction (SPE) Automated Flash Purification Rapid Solvent Evaporation & PEPTIDES

3 Outline Microwave heating Application of Peptide Synthesis -Difficult sequence -N-Methylated amino acids -Selenocysteine -Glycosylated amino acids -ChemMatrix System -Peptide Synthesizer -Comparison: Synthesis method Summary

4 Microwave Heating Gives Faster and more precise heating Faster chemical reactions Greater yields and better purities Novel reactions

5 Advantages of Microwave Heating The rate of heating is generally higher than by conventional means No temperature gradient through the sample The energy transfer is direct to the absorbing reactants Allows reactions to occur in a more controlled manner in a decreased time scal

6 Microwave Assisted Peptide Synthesis Using Biotage Instruments Manual SPPS M. Erdélyi, A. Gogoll, Rapid microwave-assisted solid phase peptide synthesis, Synthesis, 2002, 11, * M. Brandt, S. Gammeltoft, K. J. Jensen, Microwave heating for solidphase peptide synthesis: General evaluation and applications to 15- mer phosphopeptides, International Journal of Peptide Research and Therapeutics, 2006, 12(4), Semi-automated SPPS S. L. Pedersen, K. K. Sørensen, K. J. Jensen, Semi-automated microwave-assisted SPPS: Optimization of protocols and synthesis of difficult sequences, Biopolymers (Peptide Science), 2010, 94, Fully automated SPPS L. Malik, A. P. Tofteng, S. L. Pedersen, K. K. Sørensen and K. J. Jensen, Automated X-Y robot for peptide synthesis with microwave heating: Application to difficult peptide sequences and protein domains, Journal of Peptide Science, 2010, 16,

7 What is a difficult sequence So called difficult sequences are problematic if not impossible to synthesize using standard coupling and deprotection protocols Difficulties are mainly related to: Intra- and/or intermolecular aggregation Secondary structure formation Steric hindrance of protecting groups which can generate premature termination of the sequence

8 Pancreatic Peptide YY3-36 (1-40) analogue H-YLERELKKLERELKKLSPEELNRYYASLRHYLNLVTRQRY-NH 2 The peptide hormone PYY3-36 plays a central role in the regulation of food intake and energy homeostasis. Synthesis is difficult due to reported PYY3-36 analogue consisting helix and loop due to C-terminus.

9 PYY3-36 analogue peptide reagent Resin: Fmoc-TG Rink amide resin 0.24 mmol/g loading Amino Acids: 770-μL of 0.5M Fmoc-AA in NMP with HOBt and HOAt (9:1) Coupling: μl of HBTU/NMP (0.43 M) μl of DIPEA/NMP (2.0 M) De-protect: 2000 μl of 40% piperidine in DMF Wash: NMP Søren L. Pedersen and Knud J. Jensen

10 PYY3-36 analogue method Synthesis Scale: 100 mmol Deprotection: 3 min with 40% piperidine in DMF at RT +10 min with 20% piperidine in DMF at RT Wash: 3 x 45 sec with NMP at RT Coupling: 1 x 45 min for RT or 1 x C (microwave) Wash: 3 x 30 sec with NMP at RT 3 x 30 sec with DCM at RT Søren L. Pedersen and Knud J. Jensen

11 Synthesis of PYY3-36 analogue H-YLERELKKLERELKKLSPEELNRYYASLRHYLNLVTRQRY-NH 2 45 min at RT Product Crude Purity 23% 10 min at 75ºC assisted MW Product Crude Purity 35%

12 Why are we interested in N-Methylated amino acids R N-Methylated amino acid Exist in many biologically-active natural products Help obtain information about backbone conformation Offer improved lipophilicity, proteolytic stability and bioavailability Replacement of natural amino acid for N-methyl amino acid in biologically active peptides has resulted in analogue with improved pharmacological properties

13 Coupling onto N-Methylated amino acids Me ZGYGFL-Resin X Me ZGYGFL-Resin The experiment was to synthesize four different N-methylated peptide sequences. Sequences were Me ZGYGGFL, with Z being Ala, Ile, Phe or Val, these to be some of the most difficult N-methylated amino acids to couple onto.

14 Coupling onto N-Methylated amino acids Z Z Coupling condition Coupling condition Coupling onto Me AGYGGFL Coupling onto Me FGYGGFL Coupling condition Coupling condition Coupling onto Me IGYGGFL Coupling onto Me VGYGGFL

15 Synthesis of N-Methylated Peptide Ala- Me Ile-Gly-Tyr-Gly-Gly-Phe-Leu Improved coupling conditions for coupling Fmoc-Ala-OH onto Me IGYGGGFL peptidyl.

16 N-Methylated Trimer Synthesis H- Me Ala- Me Ile- Me Gly-NH 2 Coupling condition for the synthesis of peptide

17 N-Methylated Trimer Synthesis 24 h at RT H- Me Ala- Me Ile- Me Gly-NH mau UV_VIS_1 WVL:215 nm Product Overall synthesis time: ~74 h Crude Purity 39% -200 min x 10 min at 75ºC assisted MW 300 mau Product UV_VIS_1 WVL:215 nm Overall synthesis time: ~3 h Crude Purity 80% -50 min

18 What is a Selenocysteine NH 2 HO 2 C SeH L-Selenocysteine (Sec) The 21st amino acid incorporated in proteins by the genetic codon. The active center of redox selenoenzymes, such as glutathione peroxidase. The application to determination of protein structure.

19 Synthesis of Selenopeptide H-Gly-Gln-Ala-Sec-Ala-Trp-Gly-NH 2 Coupling condition for the synthesis of selenopeptide **Sec protected selenium with p-methoxyphenylmethyl group

20 Synthesis of Selenopeptide H-Gly-Gln-Ala-Sec-Ala-Trp-Gly-NH 2 40 min at RT UV 220 nm Product Overall synthesis time: ~10 h Crude Purity 22% 5 min at 75ºC assisted MW UV 220 nm Product Overall synthesis time: ~5 h Crude Purity 48%

21 Glycosylated amino acids H-TRPAPGST*APPAHGVT*SAPD-NH 2 The 20-mer MUC1 tandem repeat sequence is a large extracellular glycoprotein which exist ubiquitously on the surface of mammalian cell membranes. Glycosylated amino acids use mono-saccharide derivatives of Fmoc-Thr(Ac 4 -β-glc)-oh and Fmoc-Thr(Ac 3 -α-galnac)- OH.

22 Synthesis of Glycopeptide H-TRPAPGST*APPAHGVT*SAPD-NH 2 T* = Thr(Ac 4 -β-glc) or Thr(Ac 3 -α-galnac) Glucose Peptide Galactosamine Peptide

23 Synthesis of GlycoPeptide H-TRPAPGST*APPAHGVT*SAPD-NH 2 20 min at 75 assisted MW Crude Purity 53% 20 min at RT Crude Purity 33% 2 h at RT Crude Purity 38% 20 min at 75 assisted MW +depro 2 min at 60 Crude Purity 15% HPLC chromatograms for the synthesis of the 20 mer peptide 1 using different reaction conditions

24 Synthesis of GlycoPeptide H-TRPAPGST*APPAHGVT*SAPD-NH 2 Entry 5 20 min at 75 assisted MW Crude Purity 64% Entry 6 20 min at 75 assisted MW +depro 2 min at 60 Crude Purity 30% HPLC chromatograms for the synthesis of the 20 mer peptide 2

25 ChemMatrix Resins If your peptide is: long, complex, or hydrophobic: ChemMatrix resin Biotage is now distributing ChemMatrix resins Biotage have selected 5 of the most popular linker chemistries for SPPS (Rink, Wang, HMPB, Trityl, PAL) ChemMatrix is a patented 100% PEG resin from Matrix Innovation that offers substantial advantages over traditional PS & PEG based resins for SPPS Peptides produced with ChemMatrix - higher purity and yields

26 Benefits of ChemMatrix Resin Exceptional stability more stability for the chemistry needed in peptide synthesis No Leaching does not add impurity to the end-users work flow Excellent solvent compatibility organic or aqueous, water or otherwise Many choices of linker and also pre-loaded options available we have access to a wide choice Proven superior performance comparison of synthesis of Selenoglutathione using Rinak amide- ChemMatrix and PS resin shows significant advantages Microwave compatible in peptide synthesizers or manual synthesis

27 Case Study: Selenoglutathione g-glu-sec-gly Se Coupling condition for the synthesis of selenopeptide

28 Case Study: Selenoglutathione MBHA Rink amide resin at RT g-glu-sec-gly UV 220 nm Product Overall synthesis time: ~5 h Crude Purity 34% ChemMatrix Rink amide resin at RT UV 220 nm Product Overall synthesis time: ~5 h Crude Purity 77%

29 Synthesis of C-terminus of MuLV CTL epitope H-WFTTLISTIM-NH 2 Different resins using COMU as coupling reagent

30 Synthesis of Dendrimer Peptide Different reaction conditions for the synthesis of dendrimer like structure

31 ChemMatrix Resins Fmoc-S-RAM-TG 45 min, RT Product Product Fmoc-S-RAM-TG 2 x 120 min, RT Product Fmoc-S-RAM-TG 5 min, 75 ChemMatrix 5 min, 75 Product Fmoc-S-RAM-TG 2 x 10 min, 75 Product

32 Peptide Synthesizer from Biotage Syro I (Auto) Syro II (Auto) Syrowave (Auto) Initiator Peptide Workstation (Manual) Initiator + SP wave (Semi-auto)

33 Syro I:Full-Automatic Single robotic arm 2 x digital syringe pump 1 Vortex mixers: parallel Choice of either: 24 or 48 channel reactor Vacuum Pump Amino Acid Rack: 32 x 50 ml Falcon Tubes Reagent Bottle Rack: 2 x 500 ml, 3 x 200 ml Waste Bottle: 1 x 10 liter Synthesis on µmol scale Includes Dell Desktop PC Flat Panel Monitor, Printer Syro XP Software

34 Initiator+ Peptide Workstation: Manual Microwave assisted peptide Manual synthesis Disposable 2-5 and ml glass reactor vials with HDPE frits Synthesis on µmol scale

35 Initiator + SP wave: Semi-Automatic Microwave assisted peptide and organic synthesis Semi-automated Disposable 2, 5 and 10 ml PPreactor vials with PTFE frits Synthesis on µmol scale Inert gas capability Easy-to use Initiator 4.0 software Use pre-defined templates or define your own Vortex mixing Single robot arm, digital syringe pump

36 Syrowave: Full-Automatic Microwave cavity Single robotic arm 1 x digital syringe pump 2 Vortex mixers: Microwave & parallel Choice of either: 24 or 48 channel reactor Vacuum Pump Amino Acid Rack: 32 x 50 ml Falcon Tubes Reagent Bottle Rack: 2 x 500 ml, 3 x 200 ml Waste Bottle: 1 x 10 liter Synthesis on µmol scale Includes Dell Desktop PC Flat Panel Monitor, Printer Syro XP Software

37 Comparison: Synthesis method 1. ACP65-74: H-VQAAIDYING-NH 2 2. LysM: H-LPERVKVVFPL-NH 2 3. JR: H-WFTTLISTIM-NH 2 Synthesis of a difficult peptide sequences using different levels of automation for microwave assisted SPPS: manual, semiautomated and fully automated systems. Three different peptides synthesized as test sequences. All the peptides were synthesized on the PEG-based ChemMatrix resin.

38 Compare to the system ACP 65-74: H-VQAAIDYING-NH 2 1 Syro Wave (Full-Auto) Product 2 min at 75 assisted MW Crude Purity 97% 2 Initiator+, SP Wave (Semi-Auto) Product 2 min at 75 assisted MW Crude Purity 93% 3 Initiator Peptide Workstation (Manual) Product 2 min at 75 assisted MW Crude Purity 94%

39 Compare the peptide synthesizer 1. ACP 65-74: H-VQAAIDYING-NH 2 2. LysM: H-LPERVKVVFPL-NH 2 3. JR: H-WFTTLISTIM-NH 2

40 Summmary Reduction in synthesis time and an increase in purity using Microwave Irradiation in SPPS -PYY 3-36 of Difficult Sequence -N-Methylated Peptide -Selenopeptide -Glycopeptide Improve the purity using ChemMatrix -MuLV CTL epitope peptide in Difficult Sequence -Selenoglutathione -Dendoric structure peptide Compare to the instruments for microwave assisted SPPS. -The Initiator Peptide Workstation gave the fastest cycle times however, is the most labor intensive. -The Syro Wave system gave excellent purity peptides with the least amount of user input. -The semi-automated Initiator+ SP Wave system required the perfect setup in terms of speed of synthesis, quality of peptides produced and level of user intervention.

41 Conclusion Microwave is powerful technique for accelerating the synthesis of peptides and peptidomimetics. Reduction in synthesis time and an increase in purity. Improve coupling rates and prevent side reactions in SPPS. ChemMatrix is efficient resin for Microwave in SPPS. Three instruments of automation solutions for microwave assisted SPPS provided peptides with high level of purities but differ in cycle times and level of user intervention required.

Novel Method for Solid Phase Peptide Synthesis Using Microwave Energy

Novel Method for Solid Phase Peptide Synthesis Using Microwave Energy Novel Method for Solid Phase Peptide Synthesis Using Microwave Energy Jonathan M. Collins, Michael J. Collins, Rebecca C. Steorts CEM Corporation, Matthews, NC 28106-0200, U.S.A. Presented at American

More information

Small μmol Scale Synthesis of a Labeled Antimicrobial Peptide using Biotage

Small μmol Scale Synthesis of a Labeled Antimicrobial Peptide using Biotage Application ote A098 Small μmol Scale Synthesis of a Labeled Antimicrobial Peptide Page 1 Small μmol Scale Synthesis of a Labeled Antimicrobial Peptide using Biotage Initiator+ Alstra Introduction Labeled

More information

CEM, First in Microwave Peptide Synthesis

CEM, First in Microwave Peptide Synthesis CEM, First in Microwave Peptide Synthesis In 2002, a CEM biochemist named Jonathan Collins presented his concept of a microwave-assisted peptide synthesis system to several colleagues. Collins concept

More information

1) Technical informations. - a) How does it work? - b) Purification - c) Quality Control. 2) Standard synthesis

1) Technical informations. - a) How does it work? - b) Purification - c) Quality Control. 2) Standard synthesis 1) Technical informations - a) How does it work? - b) Purification - c) Quality Control 2) Standard synthesis - a) Standard peptides - b) Modified peptides - c) Shipment and Delivery Time - d) How to order?

More information

Experimental procedures. Solid phase peptide synthesis (SPPS)

Experimental procedures. Solid phase peptide synthesis (SPPS) Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry This journal is The Royal Society of Chemistry 214 Experimental procedures Solid phase peptide synthesis (SPPS) Solid phase

More information

Focus XC. Ultimate Fully Automated Peptide Synthesizer with Sonication and Heating Options

Focus XC. Ultimate Fully Automated Peptide Synthesizer with Sonication and Heating Options Focus XC Ultimate Fully Automated Peptide Synthesizer with Sonication and Heating Options FOCUS XC AUTOMATED PEPTIDE SYNTHESIZER aapptec s Focus XC is a compact, easy to use fully automated peptide synthesizer

More information

l 4-minute cycle time l 90% solvent reduction Remarkably fast Automated Microwave Peptide Synthesizer

l 4-minute cycle time l 90% solvent reduction Remarkably fast Automated Microwave Peptide Synthesizer Automated Microwave Peptide Synthesizer CEM is transforming the way chemists perform peptide synthesis once again with the introduction of the Liberty Blue Microwave Peptide Synthesizer. More than just

More information

Automated Fast-Bead Synthesis of Small Peptides

Automated Fast-Bead Synthesis of Small Peptides Automated Fast-Bead Synthesis of Small Peptides Application Note 228 Joan Stevens, Ph.D., Norbert Wodke, Tim Hegeman and Kirby Reed (Gilson, Inc.) Introduction In proteomic research, the synthesis of peptides

More information

Rapid Microwave-Assisted Solid Phase Peptide Synthesis

Rapid Microwave-Assisted Solid Phase Peptide Synthesis 592 SPECIAL TOPIC Rapid Microwave-Assisted Solid Phase Peptide Synthesis Rapid Máté Microwave-Assisted Solid Phase Peptide SynthesisErdélyi, a,b Adolf Gogoll* a a Department of Organic Chemistry, Uppsala

More information

Microwave Assisted Peptide Synthesis. Sanjukta Ghosh Green Chemistry 671 December 8, 2011

Microwave Assisted Peptide Synthesis. Sanjukta Ghosh Green Chemistry 671 December 8, 2011 Microwave Assisted Peptide Synthesis Sanjukta Ghosh Green Chemistry 671 December 8, 2011 Overview I. What are peptides and why are they important II. III. IV. Conventional method of peptide synthesis :

More information

Dr. Rita P.-Y. Chen Institute of Biological Chemistry Academia Sinica

Dr. Rita P.-Y. Chen Institute of Biological Chemistry Academia Sinica PEPTIDE SYNTHESIS Dr. Rita P.-Y. Chen Institute of Biological Chemistry Academia Sinica 1 Solution phase chemistry -Time consuming: isolation and purification at each step -Low yield: can t drive reaction

More information

Peptide Synthesis Zheng Miao* and Zhen Cheng

Peptide Synthesis Zheng Miao* and Zhen Cheng Peptide Synthesis Zheng Miao* and Zhen Cheng 1 Department of Radiology, Molecular Imaging Program at Stanford, Stanford University School of Medicine, Stanford, USA *For correspondence: [email protected]

More information

A novel method for the synthesis of peptides

A novel method for the synthesis of peptides A novel method for the synthesis of peptides in solution DioRaSSP (Diosynth Rapid Solution Synthesis of Peptides) offers substantial benefits for the large-scale synthesis of peptides meeting all the specifications

More information

Overview'of'Solid-Phase'Peptide'Synthesis'(SPPS)'and'Secondary'Structure'Determination'by'FTIR'

Overview'of'Solid-Phase'Peptide'Synthesis'(SPPS)'and'Secondary'Structure'Determination'by'FTIR' verviewofsolid-phasepeptidesynthesis(spps)andsecondarystructuredeterminationbyftir Introduction Proteinsareubiquitousinlivingorganismsandcells,andcanserveavarietyoffunctions.Proteinscanactas enzymes,hormones,antibiotics,receptors,orserveasstructuralsupportsintissuessuchasmuscle,hair,and

More information

How To Make A Drug From A Peptide

How To Make A Drug From A Peptide MODERN PERSPECTIVES ON PEPTIDE SYNTHESIS INTRODUCTION WHITEPAPER www.almacgroup.com The complexity of synthetic peptide products, whether as reagents used in research or as therapeutic APIs, is increasing.

More information

Amino Acid Analyzer L-8900

Amino Acid Analyzer L-8900 Amino Acid Analyzer L-8900 VWR - Hitachi Your Partner in Amino Acid Analysis Hitachi has manufactured more than 1800 Amino Acid Analysers for over 40 years. The new Amino Acid Analyser Model L-8900 is

More information

Outline. Market & Technology Trends. LifeTein Technology Portfolio. LifeTein Services

Outline. Market & Technology Trends. LifeTein Technology Portfolio. LifeTein Services 1 Outline Market & Technology Trends LifeTein Technology Portfolio LifeTein Services 2 Synthetic Therapeutic Peptides More than 60 synthetic therapeutic peptides under 50 amino acids in size have reached

More information

ORGANIC SAMPLE PREPARATION

ORGANIC SAMPLE PREPARATION ORGANIC SAMPLE PREPARATION W W W.LA BT E C H S R L.CO M WSPE MANUAL VACUUM MANIFOLD SPE Process control of the flow rate is critical to guarantee reproducible extractions. Differently then any other systems,

More information

FAST AND EFFICIENT PURIFICATION OF SYNTHETIC PEPTIDES BY SOLID-PHASE EXTRACTION

FAST AND EFFICIENT PURIFICATION OF SYNTHETIC PEPTIDES BY SOLID-PHASE EXTRACTION ACTA CHROMATOGRAPHICA, NO. 14, 2004 FAST AND EFFICIENT PURIFICATION OF SYNTHETIC PEPTIDES BY SOLID-PHASE EXTRACTION W. Kamysz 1,*, M. Okrój 2, E. Łempicka 3, T. Ossowski 3, and J. Łukasiak 1 1 Faculty

More information

High-Throughput 3-D Chromatography Through Ion Exchange SPE

High-Throughput 3-D Chromatography Through Ion Exchange SPE High-Throughput 3-D Chromatography Through Ion Exchange SPE Application Note 205 Luke Roenneburg and Alan Hamstra (Gilson, Inc.) Introduction 2-dimensional (2-D) separation is the separation of a sample

More information

DEVELOPMENT OF MICROWAVE-ASSISTED SYNTHESIS METHODS FOR PREPARATION OF PEPTIDES. Ph.D. thesis BERNADETT BACSA

DEVELOPMENT OF MICROWAVE-ASSISTED SYNTHESIS METHODS FOR PREPARATION OF PEPTIDES. Ph.D. thesis BERNADETT BACSA DEVELOPMENT OF MICROWAVE-ASSISTED SYNTHESIS METHODS FOR PREPARATION OF PEPTIDES Ph.D. thesis BERNADETT BACSA Supervisors: Dr. Gábor Dibó associate professor ELTE Department of Organic Chemistry Dr. Gábor

More information

Solid Phase Peptide Synthesis Methodology with Integrin α5 and Ligand Ac-RGDNP-NH2

Solid Phase Peptide Synthesis Methodology with Integrin α5 and Ligand Ac-RGDNP-NH2 Solid Phase Peptide Synthesis Methodology with Integrin α5 and Ligand Ac-RGDNP-NH2 Amy Ho The University of Texas at Dallas 2006 Abstract Peptides are short chains of amino acids that biologically function

More information

Rapid solid-phase peptide synthesis using thermal and controlled microwave irradiation

Rapid solid-phase peptide synthesis using thermal and controlled microwave irradiation Journal of Peptide Science Published online in Wiley InterScience (www.interscience.wiley.com)..771 Rapid solid-phase peptide synthesis using thermal and controlled microwave irradiation BERNADETT BACSA,

More information

LifeTein in Industrial Production of Therapeutic Peptides. Phil Moore, PhD Director of Business Development LifeTein LLC, NJ, USA

LifeTein in Industrial Production of Therapeutic Peptides. Phil Moore, PhD Director of Business Development LifeTein LLC, NJ, USA LifeTein in Industrial Production of Therapeutic Peptides Phil Moore, PhD Director of Business Development LifeTein LLC, NJ, USA 1 Outline Market and Technology Trend LifeTein s Technology portfolio LifeTein

More information

Standard practices for Fmoc-based solid-phase. peptide synthesis in the Nowick laboratory. (Version 1.6.1)

Standard practices for Fmoc-based solid-phase. peptide synthesis in the Nowick laboratory. (Version 1.6.1) Standard practices for Fmoc-based solid-phase peptide synthesis in the Nowick laboratory (Version 1.6.1) Adam G. Kreutzer and Patrick J. Salveson E-mail: Contents Contributions to this guide 3 General

More information

PS3 Peptide Synthesizer QUICK START GUIDE

PS3 Peptide Synthesizer QUICK START GUIDE PS3 TM Peptide Synthesizer QUICK START GUIDE TM PS3 Peptide Synthesizer QUICK START GUIDE 2006 Protein Technologies, Inc. 4675 S. Coach Dr. Tucson, AZ 85714 USA All Rights Reserved. DOC #9030005 Rev 01

More information

A Novel Bioconjugation Technology

A Novel Bioconjugation Technology A Novel Bioconjugation Technology for Assay Development and More! Presentation overview Who we are Solutions we provide for our customers Solulink s technology Linking system The Solulink advantage Applications

More information

The Peptides Vol. 2: Analysis, Synthesis, Biology: Special Methods in Peptide Synthesis

The Peptides Vol. 2: Analysis, Synthesis, Biology: Special Methods in Peptide Synthesis The Peptides Vol. 2: Analysis, Synthesis, Biology: Special Methods in Peptide Synthesis Download: The Peptides Vol. 2: Analysis, Synthesis, Biology: Special Methods in Peptide Synthesis PDF ebook The Peptides

More information

Peptide Library Synthesis

Peptide Library Synthesis Peptide Library Synthesis Jamie M. R. Moore Guy Laboratory UCSF I. verview.. page 2 II. Reagents and Apparatus. page 4 III. Flow Chart. page 6 IV. Protocol. page 7 IV. Tables A. List of Fmoc Amino. page

More information

Oasis HLB Cartridges and 96-Well Plates

Oasis HLB Cartridges and 96-Well Plates CONTENTS I. INTRODUCTION II. SAMPLE PRE-TREATMENT a. Biological Samples b. Solid Samples: Soil, Whole Foods, Tissue c. Aqueous Samples: Water, Beverages d. Non-Aqueous Liquid III. SOLID PHASE EXTRACTION

More information

Specific Challenges in Large-Scale Manufacturing of Peptide as API s Presentation at TIDES Conference, Las Vegas, April 25 29, 2004

Specific Challenges in Large-Scale Manufacturing of Peptide as API s Presentation at TIDES Conference, Las Vegas, April 25 29, 2004 Specific Challenges in Large-Scale Manufacturing of Peptide as API s Presentation at TIDES Conference, Las Vegas, April 25 29, 2004 Oleg Werbitzky Slide 2 Agenda Market environment Current manufacturing

More information

2010 European Amino Acid Derivatives Product Line Strategy Award

2010 European Amino Acid Derivatives Product Line Strategy Award 2010 European Amino Acid Derivatives Product Line Strategy Award 2010 Frost & Sullivan 1 We Accelerate Growth Frost & Sullivan s Global Research Platform Frost & Sullivan is entering its 50 th year in

More information

Challenges in Industrial Production of Peptides. Dr. Daniel Bourgin Director of Sales & BD LCM-TIDES, Lonza Ltd. Basel, Switzerland

Challenges in Industrial Production of Peptides. Dr. Daniel Bourgin Director of Sales & BD LCM-TIDES, Lonza Ltd. Basel, Switzerland Challenges in Industrial Production of Peptides Dr. Daniel Bourgin Director of Sales & BD LCM-TIDES, Lonza Ltd. Basel, Switzerland Agenda Market Trend Technology Trend Challenges Lonza s Technology portfolio

More information

Aspects of industrial purification of peptides using large-scale chromatography. Lars Andersson and Jonas Persson

Aspects of industrial purification of peptides using large-scale chromatography. Lars Andersson and Jonas Persson Aspects of industrial purification of peptides using large-scale chromatography Introduction By Lars Andersson and Jonas Persson PolyPeptide Laboratories (Sweden) AB PO Box 30089 SE-200 61 LIMHAMN SWEDEN

More information

Combinatorial Chemistry and solid phase synthesis seminar and laboratory course

Combinatorial Chemistry and solid phase synthesis seminar and laboratory course Combinatorial Chemistry and solid phase synthesis seminar and laboratory course Topic 1: Principles of combinatorial chemistry 1. Introduction: Why Combinatorial Chemistry? Until recently, a common drug

More information

Syllabus. 1. Occurrence and Functions of Peptides in Nature and Every Day Life hormones, neurotransmitters, therapeutics, artificial sweetener,

Syllabus. 1. Occurrence and Functions of Peptides in Nature and Every Day Life hormones, neurotransmitters, therapeutics, artificial sweetener, Syllabus 1. ccurrence and Functions of Peptides in ature and Every Day Life hormones, neurotransmitters, therapeutics, artificial sweetener, 2. Peptide Synthesis a) Aspartam: Properties of amino acids;

More information

USP's Therapeutic Peptides Expert Panel discusses manufacturing processes and impurity control for synthetic peptide APIs.

USP's Therapeutic Peptides Expert Panel discusses manufacturing processes and impurity control for synthetic peptide APIs. Control Strategies for Synthetic Therapeutic Peptide APIs Part III: Manufacturing Process Considerations By Brian Gregg,Aleksander Swietlow,Anita Y. Szajek,Harold Rode,Michael Verlander,Ivo Eggen USP's

More information

Structure-Based Design of Covalent Siah Inhibitors

Structure-Based Design of Covalent Siah Inhibitors Chemistry & Biology, Volume 20 Supplemental Information Structure-Based Design of Covalent Siah Inhibitors John L. Stebbins, Eugenio Santelli, Yongmei Feng, Surya K. De, Angela Purves, Khatereh Motamedchaboki,

More information

How To Use An Acquity Qda Detector

How To Use An Acquity Qda Detector Mass-Directed Isolation of a Synthetic Peptide Using the ACQUITY QDa Detector Jo-Ann M. Jablonski and Andrew J. Aubin Waters Corporation, Milford, MA, USA APPLICATION BENEFITS The ACQUITY QDa Detector

More information

Peptides: Synthesis and Biological Interest

Peptides: Synthesis and Biological Interest Peptides: Synthesis and Biological Interest Therapeutic Agents Therapeutic peptides approved by the FDA (2009-2011) 3 Proteins Biopolymers of α-amino acids. Amino acids are joined by peptide bond. They

More information

1. COUPLING REAGENTS : Structure and acronyms

1. COUPLING REAGENTS : Structure and acronyms Coupling Reagents 1. COUPLING REAGENTS : Structure and acronyms... 2 2. CARBODIIMIDE... 3 1.a. N,N -Dicyclohexylcarbodimide (DCC)... 3 DCC/HOBt coupling experimental procedure:... 4 1.b. N-(3-Dimethylaminopropyl)-N

More information

Choose your optimal tools for protein studies

Choose your optimal tools for protein studies Protein Purification Choose your optimal tools for protein studies Bacterial Baculoviral Cell free Mammalian Secreted Intracellular High yield Increased solubility Highest purity Highest yield His-tag

More information

Guidance for Industry

Guidance for Industry Guidance for Industry for the Submission of Chemistry, Manufacturing, and Controls Information for Synthetic Peptide Substances Center for Drug Evaluation and Research (CDER) Center for Biologics Evaluation

More information

Short Peptide Synthesis

Short Peptide Synthesis Short Peptide Synthesis Keith ó Proinsias 8 th February 2010 Introduction Amide bond and basic amide synthesis Solution phase peptide synthesis Protecting groups required for peptide synthesis Coupling

More information

Market Growing for Custom-Made Peptides Expansion

Market Growing for Custom-Made Peptides Expansion Market Growing for Custom-Made Peptides Expansion Attributed to Increase Use in Drug and Vaccine Development Continued growth and a changing landscape characterize the custom peptides marketplace, as suppliers

More information

IFC. A new perspective i l ifi ti. p p g p. Single softw FractPAL software plug-in for Agilent ChemStation. Medicinal Chemistry.

IFC. A new perspective i l ifi ti. p p g p. Single softw FractPAL software plug-in for Agilent ChemStation. Medicinal Chemistry. IFC A new perspective i l ifi ti Medicinal Chemistry p p CombiChem Compound Isolation Autopurification Drug Discovery y y q p p p p g p Single softw FractPAL software plug-in for Agilent ChemStation The

More information

TENDER DOCUMENT PURCHASING EQUIPMENT FOR PEPTIDE SYNTHESIS

TENDER DOCUMENT PURCHASING EQUIPMENT FOR PEPTIDE SYNTHESIS TENDER DOCUMENT PURCHASING EQUIPMENT FOR PEPTIDE SYNTHESIS for Barents BioCentre Section 1 Description of the purchase 1.1. Introduction The Northern Research Institute (NORUT) P.O. Box 6434 Forskningsparken,

More information

Melting points (m.p.) were determined using a Reichert hot-stage melting point

Melting points (m.p.) were determined using a Reichert hot-stage melting point Supporting information 1.0 General experimental 1.1 Instrumentation Melting points (m.p.) were determined using a Reichert hot-stage melting point apparatus and are uncorrected. Infrared spectra (IR) spectra

More information

Integrated Protein Services

Integrated Protein Services Integrated Protein Services Custom protein expression & purification Version DC04-0012 Expression strategy The first step in the recombinant protein generation process is to design an appropriate expression

More information

Human serum albumin (HSA) nanoparticles stabilized with. intermolecular disulfide bonds. Supporting Information

Human serum albumin (HSA) nanoparticles stabilized with. intermolecular disulfide bonds. Supporting Information Human serum albumin (HSA) nanoparticles stabilized with intermolecular disulfide bonds Wentan Wang, Yanbin Huang*, Shufang Zhao, Ting Shao and Yi Cheng* Department of Chemical Engineering, Tsinghua University,

More information

Peptide synthesis, radiolabelling and radiochemical analysis

Peptide synthesis, radiolabelling and radiochemical analysis SUPPLEMENTAL DATA MATERIALS AND METHODS Peptide synthesis, radiolabelling and radiochemical analysis Solid phase synthesis of peptides was carried out on using ABI 433A peptide synthesizer, on a preloaded

More information

EXPERIMENT 5: DIPEPTIDE RESEARCH PROJECT

EXPERIMENT 5: DIPEPTIDE RESEARCH PROJECT EXPERIMENT 5: DIPEPTIDE RESEARCH PROJECT Pre-Lab Questions: None. 64 I. Background Information DIPEPTIDE RESEARCH PROJECT Methods developed by organic chemists for the synthesis of biopolymers have had

More information

PROTEIN SEQUENCING. First Sequence

PROTEIN SEQUENCING. First Sequence PROTEIN SEQUENCING First Sequence The first protein sequencing was achieved by Frederic Sanger in 1953. He determined the amino acid sequence of bovine insulin Sanger was awarded the Nobel Prize in 1958

More information

Chemistry 321, Experiment 8: Quantitation of caffeine from a beverage using gas chromatography

Chemistry 321, Experiment 8: Quantitation of caffeine from a beverage using gas chromatography Chemistry 321, Experiment 8: Quantitation of caffeine from a beverage using gas chromatography INTRODUCTION The analysis of soft drinks for caffeine was able to be performed using UV-Vis. The complex sample

More information

1 General introduction

1 General introduction General introduction Peptides and peptidomimetics _ 1 1 General introduction 1.1 Peptides and peptidomimetics umerous small and large peptides, which are sequence and length-specific polymers composed

More information

Dipeptide Synthesis. polarized light (Figure 2).

Dipeptide Synthesis. polarized light (Figure 2). Dipeptide Synthesis + Scheme 1: Peptide synthesis without carboxyl activation + 2 Throughout your organic chemistry tenure you have been taught the underlying principles necessary to construct simple organic

More information

2. Couple the two protected amino acids.

2. Couple the two protected amino acids. General Considerations The Strategy of Peptide Synthesis Making peptide bonds between amino acids is not difficult. The challenge is connecting amino acids in the correct sequence. andom peptide bond formation

More information

Covalent Conjugation to Cytodiagnostics Carboxylated Gold Nanoparticles Tech Note #105

Covalent Conjugation to Cytodiagnostics Carboxylated Gold Nanoparticles Tech Note #105 Covalent Conjugation to Cytodiagnostics Carboxylated Gold Nanoparticles Tech Note #105 Background Gold nanoparticle conjugates have been widely used in biological research and biosensing applications.

More information

MILESTONE. RotoSYNTH. Rotative Solid-Phase Microwave Reactor

MILESTONE. RotoSYNTH. Rotative Solid-Phase Microwave Reactor MILESTONE H E L P I N G C H E M I S T S RotoSYNTH Rotative Solid-Phase Microwave Reactor RotoSYNTH benefits The benefits of microwave-enhanced synthesis Microwave enhanced chemistry represents a fundamental

More information

Investigation of Solid-Phase Peptide Synthesis by the Near-Infrared Multispectral Imaging Technique: A Detection Method for Combinatorial Chemistry

Investigation of Solid-Phase Peptide Synthesis by the Near-Infrared Multispectral Imaging Technique: A Detection Method for Combinatorial Chemistry Anal. Chem. 1999, 71, 2255-2261 Accelerated Articles Investigation of Solid-Phase Peptide Synthesis by the Near-Infrared Multispectral Imaging Technique: A Detection Method for Combinatorial Chemistry

More information

Empore. 96-Well Solid Phase Extraction Plates. Technical Information. Instructions for Use. Product Characteristics. Product Description

Empore. 96-Well Solid Phase Extraction Plates. Technical Information. Instructions for Use. Product Characteristics. Product Description Technical Information Empore 96-Well Solid Phase Extraction Plates Instructions for Use Product Description Empore 96-Well Solid Phase Extraction Plates are designed for high throughput solid phase extraction

More information

How To Make A Peptide

How To Make A Peptide Peptide synthesis From Wikipedia, the free encyclopedia In organic chemistry, peptide synthesis is the creation of peptides, which are organic compounds in which multiple amino acids bind via peptide bonds

More information

EuroPeptides 2014: Workshop Considerations for Peptide Contract Manufacturing: Case Study on Scale-up Considerations

EuroPeptides 2014: Workshop Considerations for Peptide Contract Manufacturing: Case Study on Scale-up Considerations EuroPeptides 2014: Workshop Considerations for Peptide Contract Manufacturing: Case Study on Scale-up Considerations Bruce H Morimoto, PhD Executive Director, Applied Translational Medicine Disclaimer

More information

Peptide purification strategies

Peptide purification strategies Särö Conference 2009 Peptide purification strategies Ulf Altenhöner Lonza Exclusive Synthesis R&D Outline Introduction Integrated process development Model-based process development Inspiration Conclusions

More information

--not necessarily a protein! (all proteins are polypeptides, but the converse is not true)

--not necessarily a protein! (all proteins are polypeptides, but the converse is not true) 00Note Set 5b 1 PEPTIDE BONDS AND POLYPEPTIDES OLIGOPEPTIDE: --chain containing only a few amino acids (see tetrapaptide, Fig 5.9) POLYPEPTIDE CHAINS: --many amino acids joined together --not necessarily

More information

HPLC Analysis of Acetaminophen Tablets with Waters Alliance and Agilent Supplies

HPLC Analysis of Acetaminophen Tablets with Waters Alliance and Agilent Supplies HPLC Analysis of Acetaminophen Tablets with Waters Alliance and Agilent Supplies Application Note Small Molecule Pharmaceuticals Authors Jignesh Shah, Tiantian Li, and Anil Sharma Agilent Technologies,

More information

Helices From Readily in Biological Structures

Helices From Readily in Biological Structures The α Helix and the β Sheet Are Common Folding Patterns Although the overall conformation each protein is unique, there are only two different folding patterns are present in all proteins, which are α

More information

Determination of Anabolic Steroids in Horse Urine by SPE and LC-MS/MS

Determination of Anabolic Steroids in Horse Urine by SPE and LC-MS/MS Summary: Determination of Anabolic Steroids in Horse Urine by SPE and LC-MS/MS UCT Part Numbers: CUNAX226 - Clean-Up C8+NAX, 2mg/6mL BETA-GLUC- ml Beta-Glucuronidase Enzyme, liquid form SLAQ1ID21-3UM -

More information

An In-Gel Digestion Protocol

An In-Gel Digestion Protocol An In-Gel Digestion Protocol This protocol describes the digestion of a protein present in an SDS-PAGE gel band with trypsin. The band can be taken from either a 1D or 2D electrophoresis gel. Reagents

More information

Simple, economical and flexible apparatus for solid phase peptide synthesis

Simple, economical and flexible apparatus for solid phase peptide synthesis Indian Journal of Chemistry Vol. 46B, July 2007, pp. 1143-1147 Simple, economical and flexible apparatus for solid phase peptide synthesis Kota Satyanarayana*, K V R C Rajesh Kumar & Ch Venkanna Natco

More information

Supporting Information

Supporting Information Supporting Information Copyright Wiley-VCH Verlag GmbH & Co. KGaA, 69451 Weinheim, 2013 More than Meets the Eye: Conformational Switching of a Stacked Dialkoxynaphthalene Naphthalenetetracarboxylic diimide

More information

Analytical Test Report

Analytical Test Report Analytical Test Report Customer: Address (City, State): Purchase Order: Report Number: Project Number: Date Received: Date of Report: Test Location: Boulder, CO. Assay: Part Number: Amino Acids by HPLC

More information

IV. -Amino Acids: carboxyl and amino groups bonded to -Carbon. V. Polypeptides and Proteins

IV. -Amino Acids: carboxyl and amino groups bonded to -Carbon. V. Polypeptides and Proteins IV. -Amino Acids: carboxyl and amino groups bonded to -Carbon A. Acid/Base properties 1. carboxyl group is proton donor! weak acid 2. amino group is proton acceptor! weak base 3. At physiological ph: H

More information

Syncore. Polyvap /Analyst / Reactor

Syncore. Polyvap /Analyst / Reactor Syncore Polyvap /Analyst / Reactor en Syncore An efficient, safe and environmentally sound tool for parallel sample processing Syncore comprises three instruments suitable for all aspects of multiple sample

More information

How To Test For Leachables

How To Test For Leachables Current FDA Perspective on Leachable Impurities in Parenteral and Ophthalmic Drug products AAPS Workshop on Pharmaceutical Stability Scientific and Regulatory Considerations for Global Drug Development

More information

Guide to Reverse Phase SpinColumns Chromatography for Sample Prep

Guide to Reverse Phase SpinColumns Chromatography for Sample Prep Guide to Reverse Phase SpinColumns Chromatography for Sample Prep www.harvardapparatus.com Contents Introduction...2-3 Modes of Separation...4-6 Spin Column Efficiency...7-8 Fast Protein Analysis...9 Specifications...10

More information

CONFIRMATION OF ZOLPIDEM BY LIQUID CHROMATOGRAPHY MASS SPECTROMETRY

CONFIRMATION OF ZOLPIDEM BY LIQUID CHROMATOGRAPHY MASS SPECTROMETRY CONFIRMATION OF ZOLPIDEM BY LIQUID CHROMATOGRAPHY MASS SPECTROMETRY 9.1 POLICY This test method may be used to confirm the presence of zolpidem (ZOL), with diazepam-d 5 (DZP-d 5 ) internal standard, in

More information

Spatial Screening of Cyclic Neoglycopeptides: Identification of Multivalent Wheat Germ Agglutinin Ligands**

Spatial Screening of Cyclic Neoglycopeptides: Identification of Multivalent Wheat Germ Agglutinin Ligands** 1 Spatial Screening of Cyclic Neoglycopeptides: Identification of Multivalent Wheat Germ Agglutinin Ligands** Valentin Wittmann* and Sonja Seeberger Experimental Section General. Solid-phase peptide synthesis

More information

THE CHEMICAL SYNTHESIS OF PEPTIDES

THE CHEMICAL SYNTHESIS OF PEPTIDES TE EMIAL SYTESIS F PEPTIDES Peptides are the long molecular chains that make up proteins. Synthetic peptides are used either as drugs (as they are biologically active) or in the diagnosis of disease. Peptides

More information

MILESTONE. SynthWAVE. The Game Changer in Microwave Synthesis

MILESTONE. SynthWAVE. The Game Changer in Microwave Synthesis MILESTONE H E L P I N G C H E M I S T S SynthWAVE The Game Changer in Microwave Synthesis The new Milestone SynthWAVE is designed for safe, reliable and reproducible scale-up of microwave-enhanced chemical

More information

(c) How would your answers to problem (a) change if the molecular weight of the protein was 100,000 Dalton?

(c) How would your answers to problem (a) change if the molecular weight of the protein was 100,000 Dalton? Problem 1. (12 points total, 4 points each) The molecular weight of an unspecified protein, at physiological conditions, is 70,000 Dalton, as determined by sedimentation equilibrium measurements and by

More information

Protein Physics. A. V. Finkelstein & O. B. Ptitsyn LECTURE 1

Protein Physics. A. V. Finkelstein & O. B. Ptitsyn LECTURE 1 Protein Physics A. V. Finkelstein & O. B. Ptitsyn LECTURE 1 PROTEINS Functions in a Cell MOLECULAR MACHINES BUILDING BLOCKS of a CELL ARMS of a CELL ENZYMES - enzymatic catalysis of biochemical reactions

More information

Integrated Protein Services

Integrated Protein Services Integrated Protein Services Custom protein expression & purification Last date of revision June 2015 Version DC04-0013 www.iba-lifesciences.com Expression strategy The first step in the recombinant protein

More information

Innovative vs Traditional

Innovative vs Traditional And in the red corner, introducing the challenger NASDAQ April 4 2011 243.47 $ 1.38 $ 0.58 % 0.07 $ 0.02 $ 39.4 % Technology DVD Digital Streamline Instant Play Internet Access Unlimited Selection No Late

More information

The peptide bond is rigid and planar

The peptide bond is rigid and planar Level Description Bonds Primary Sequence of amino acids in proteins Covalent (peptide bonds) Secondary Structural motifs in proteins: α- helix and β-sheet Hydrogen bonds (between NH and CO groups in backbone)

More information

Protease Peptide Microarrays Ready-to-use microarrays for protease profiling

Protease Peptide Microarrays Ready-to-use microarrays for protease profiling Protocol Protease Peptide Microarrays Ready-to-use microarrays for protease profiling Contact us: InfoLine: +49-30-97893-117 Order per fax: +49-30-97893-299 Or e-mail: [email protected] www: www.jpt.com

More information

Extraction of Epinephrine, Norepinephrine and Dopamine from Human Plasma Using EVOLUTE EXPRESS WCX Prior to LC-MS/MS Analysis

Extraction of Epinephrine, Norepinephrine and Dopamine from Human Plasma Using EVOLUTE EXPRESS WCX Prior to LC-MS/MS Analysis Application Note AN844 Extraction of, and from Human Plasma Using EVOLUTE EXPRESS WCX Page 1 Extraction of, and from Human Plasma Using EVOLUTE EXPRESS WCX Prior to LC-MS/MS Analysis Introduction Catecholamines

More information

Fast conventional Fmoc solid-phase peptide synthesis with HCTU

Fast conventional Fmoc solid-phase peptide synthesis with HCTU Journal of Peptide Science J. Pept. Sci. 2008; 14: 97 101 Published online 24 September 2007 in Wiley InterScience (www.interscience.wiley.com)..921 Fast conventional Fmoc solid-phase peptide synthesis

More information

Table of contents. Bibliografische Informationen http://d-nb.info/1006571213. digitalisiert durch

Table of contents. Bibliografische Informationen http://d-nb.info/1006571213. digitalisiert durch 1. Research scope: The role of structure rigid'tf'ication in nature and chemistry 1 2. Establishing a Dha=Tap backbone scan in order to elucidate structural properties of the N-terminusofNPY 5 2.1 Introduction.

More information

Classic Immunoprecipitation

Classic Immunoprecipitation 292PR 01 G-Biosciences 1-800-628-7730 1-314-991-6034 [email protected] A Geno Technology, Inc. (USA) brand name Classic Immunoprecipitation Utilizes Protein A/G Agarose for Antibody Binding (Cat.

More information

experiment5 Understanding and applying the concept of limiting reagents. Learning how to perform a vacuum filtration.

experiment5 Understanding and applying the concept of limiting reagents. Learning how to perform a vacuum filtration. 81 experiment5 LECTURE AND LAB SKILLS EMPHASIZED Synthesizing an organic substance. Understanding and applying the concept of limiting reagents. Determining percent yield. Learning how to perform a vacuum

More information