Why NoSQL databases are needed for the Internet of Things
|
|
- Brandon Noah Summers
- 8 years ago
- Views:
Transcription
1 MachinaResearch//ResearchNote MachinaResearch,2014 MachinaResearch ResearchNote WhyNoSQLdatabasesareneededfor theinternetofthings 1 EmilBerthelsen,PrincipalAnalyst April2014 Theissue Ourview BigDataintheInternetofThingsissnowballing.Theamountofdataisever-increasing and becoming more and more varied. The impact on traditional relational database managementsystems(rdbms)willbesignificant.databasesneedtoadoptandmeet these new IoT requirements with greater data processing agility, multiple analytical tools including real-time analytics, and aligned and consistent views of the data. This Research Note examines what database capabilities will be required to address data managedintheinternetofthings,andhownosqlsystemslikemongodb,cassandra andhbasearemeetingthischallenge. Thetraditionalrelationaldatabasemanagementsystemswillcontinuetohavearole in the Internet of Things when processing structured, highly uniform data sets, generated from a vast number of enterprise IT systems and where this data is managed in a relatively isolated manner. When it comes to managing more heterogeneous data generated by millions and millions of sensors, devices and gateways, each with their own data structures and potentially becoming connected and integrated over the course of many years, databases will require new levels of flexibility, agility and scalability. In this environment, NoSQL databases are proving theirvalue. ThesignificanceoftheInternetofThingsisnotthatmoreandmoredevices,peopleandsystemsare connected with one another. It is that the data generated from these things is shared, processed, analysedandacteduponthrough newandinnovativeapplications,applying completelynew analysis methods and within significantly altered timeframes. The Internet of Things will drive Big Data, providingmoreinformation,frommanydifferentsources,inreal-time,andallowustogaincompletely newperspectivesontheenvironmentsaroundus. The difference between machine-to-machine (M2M) and the Internet of Things (IoT) is driven by significant changes in thehandling of data. In M2M, machine-generated data generally reflectswell- defineddatasets,communicatedwithinestablishedprotocolsandformats,anddeliverswell-defined alertsandnotificationswhenvaluesexceedtheirparameters.applicationsinm2mmakeefficientuse ofthisdataastheseapplicationshavebeendevelopedhand-in-handwithwhatthecharacteristicsof
2 MachinaResearch//ResearchNote MachinaResearch, thedata.ineffect,applicationanddataareintrinsicallydesignedasonetomeetthespecificpurposes oftheapplicationinfairlyrobustyetstaticmodel. IntheInternetofThings,theworldofdataandapplicationsrequiressignificantlymoreflexibility,agility andscalability.theserequirementsaredrivenbyalimitednumberofunderlyingneeds.thisresearch Noteexplorestheserequirementsandunderlyingneedsinmoredetail,including:! Diversity of devices and data Data generated from an exponentially growing number of diversesensors,devices,applications,andthingswillbeaccompaniedbyagrowingdiversityin thestructureandscaleofthatdata andmoreandmoresourcesofadditionaldata ranging fromdatasourcedfromcorporatesystemstocrowdsourceddatawillneedtobecombinedwith thisdata.! Flexibleandagilesystems AstheInternetofThingsbecomesamoreopensystemwherenew sensors,devices,applicationsandthingsareaddedandconnected,and evolve what weterm Subnets of Things, 1 thesupportingapplicationsanddatabasesthatmanagethedatagenerated from these things will need to remain flexible and agile, allowing businesses to meet their requirementswithouthavingtoreinventtheapplicationeverytime.! Sophisticatedanalytics Where simple alerts and notifications were the backbone of M2M systems,analyticsbecomesthecornerstoneoftheinternetofthings,requiringenhancedand multipleanalyticalapproachestoaddresstherequirementsoftheapplications. It should come as no surprise that developments in the Internet of Things and databases have run parallelwithdiscussionsaroundbigdata,atopicexploredinotherpublicationsbymachinaresearch. 2 TherelationshipbetweenIoTandBigData,andthechangesfromM2MtoIoTarecapturedinFigure1. Figure1:M2M,IoTandBigDataconnected[Source:MachinaResearch,2014] 1 MachinaResearchcreatedthe term Subnets of Things in contextofour BigDatainM2M:Tippingpointsand Subnets of Things White Paper released in February 2013, in referring to an island of interconnected devices, driven either by a single point of control, single point of data aggregation, or potentially a common cause or technologystandard 2 MachinaResearchhaspublishedaseriesofResearchNotes,aStrategyReportandaWhitePaperonthetopicof Big Data as this remains a significant opportunity area in M2M and IoT for operators, system integrators, and solutionandplatformproviders.
3 MachinaResearch//ResearchNote MachinaResearch, What is important to take notice of is that improvements in technologies as illustrated by M2M/IoT ApplicationPlatforms 3 andnosqldatabasesareenablingthesedevelopmentstotakeplace. 1 WhatisNoSQL? SQL stands for Structured Query Language, designed for managing data in relational database management systems (RDBMS). NoSQL, referred to as Not Only SQL,wasdesignedformanagingdata whichdidnotnecessarilyhavethestructureofrdbms.someoftheleadingplayersinrdbmsarewell- establishednamessuchasoracle,ibm,microsoftandsap. Instead of data being structured in fixed relational columns, data could be stored in objects of, for example,graphformat(neo4jandvirtuoso),keyvalueformat(riakanddynamodb)orwidecolumn formats (Accumulo, Cassandra and HBase). One additional and widely adopted format of NoSQL databaseisthedocument-basedsolutionaspresentedbymongodbandcouchdb. ToillustratethefundamentaldifferencebetweenRDBMSandadocument-basedNoSQLsolution,the formerstoresdatainhighlystructuredrelationaldatabaseswheredataschemesare fixed, andcurated datahastoconformtospecificcharacteristics(fieldlength,characters,etc.)defined.nosqldatabases, inanutshell,allowfordatatobestoredinwhatessentiallymaybedefinedasform-freeformats,i.e. withoutarigidityorstructureofrdbms,andallowingforalltypesofstructured,semi-structuredand completely unstructured data to be stored in an object. The significant benefit of this approach becomesclearwhenconsideringthevastamountsofdatageneratedby things which may exhibit an equally extensive range of structures and qualities and from which diverse data needs to be pulled togetherandanalysedinordertocreatetheiot.thisdiversitymayrangefromsmallerdifferencesin data structures (for example different field lengths or which data fields are captured) to more substantial differences such as data without any immediate structure as exhibited by images, audio files,randomcontentintextmessages,facebooklikes,andsoon.nosqlprovidessignificantflexibility withregardstodatamanagement. 2 Extendingdatamodelschemaandanalytical processing Another challenge presented by the Internet of Things involves the extensibility in the software. As businessesrecognizeandrealizenewopportunitiesfromtheexpandingestateofsensorsanddevices implemented and the data generated, additional requirements from applications and supporting 3 For more detailed information about M2M/IoT Application Platforms, see Machina Research s White Paper on TheEmergenceofM2M/IoTApplicationPlatforms published in September 2013
4 MachinaResearch//ResearchNote MachinaResearch, systems emerge. As seen with the development in M2M/IoT Application Platforms, 4 managing and developingapplicationsandaddressingscalabilityaresignificantandnewcapabilitiesforplatformsin the age of the Internet of Things. These developments will drive innovations in databases, data analytics,andthestructureofdatastorage. Responding to the Internet of Things with relational database management systems (RDBMS) is an optionbutpresentsalimitingfactorwhichintimewillbecomeasignificantobstacletorealizationofthe full opportunities available from all types of data. Databases in the Internet of Things require the flexibilityofthenosqlapproach,allowingasexploredearlier,differenttypesofdatatobestoredbut moreimportantly,theagilityandflexibilitytoadapttheunderlyingdatamodelstonewandchanging businessrequirementsandapplications. Applications and data models follow the requirements of businesses, and another key development areaneededwillbeindataanalytics.nolongerlimitedtohistoricaldataanalysis,dataanalyticsmoves to as close to real-time analytics as possible, introducing and requiring tools such as data streaming analysis, and with the growing numbers of multiple data sources, Complex Event Processing. In the Internet of Things, data analysis will require multiple analytical approaches, and in some cases, significantvalueisachievedfromreal-timedataanalytics(forexample,inmissioncriticalorlife-saving scenarios where information may guide rescue services within dangerous environments) or from historicalanalysisforpredictivemaintenanceservices. TheInternetofThingsgeneratessignificantlymoredatatobestored,andwhilecloudbasedservices havecertainlyprovidedanefficientandhighlyscalablesolution,developingtoolstomanagedistributed databases (rather than located on a single server) emerge asonemore capability required from the platforms.inthiscorner,hadoopwithitshdfsarchitectureallowsforhundredsandeventhousandsof nodestobecomepartofthedatacluster,anewanddistributedwayofmanagingdata. Finally,thelocationofdatastorageandstorageoptimizationwillbecomeimportantfactors.Thespeed and frequency with which data will need to be accessed by different applications may change, from instancetoinstance,theoptimalconfigurationofdatastorage.essentially,theidealdatabasestructure requiredtosupport(forexample)offlinehistoricalanalysesisdifferenttothatrequiredtosupportreal time analyses. However, specific datasets may be required to support either off line or real time applications(or,morerealistically,aneverevolvingmixofrealtimeandnon-realtimeapplicationsthat changesovertimeasnewiotapplicationsaredeveloped).theimplicationsthatanevolvingmixofreal timeandofflineapplicationsaccessingrelateddatasetsmayhaveonoptimaldatabasestructureisjust oneillustrationofawiderdynamic:everchangingapplicationrequirementsintheinternetofthingswill resultinaneedtodynamicallymanagetheoptimalstructureofassociateddatabasesonanongoing basis. 4 For more detailed information about M2M/IoT Application Platforms, see Machina Research s White Paper on TheEmergenceofM2M/IoTApplicationPlatforms published in September 2013
5 MachinaResearch//ResearchNote MachinaResearch, Dataintegrationbecomesthechallenge 5 Howtohandledatainterrogationisnotanewchallenge,butitisasignificantlygreateronegiventhe volumeofdatainvolved,itsdiversity,multiplestoragelocationsanddifferentanalyticalprocesses.the unifiedviewofdatabecomesthechallengethatdataanalyticsplatformswillneedtoaddress. This challenge involves, at a fundamental level, the development and application of semantics technologies,recognising,forexample,commonvocabulariesorlinkeddata.atmoreadvancedlevels, dataintegrationinvolvesmappingandovercomingtheheterogeneityofthedata,andpresentingthis withaunifiedview. Theadditionalchallengecomesfromunifyingthedataattwolevels,thefirstofwhichisclearlyinterms of the actual data produced by sensors and devices such as temperature readings, on/off status, vibration,etc. Atasecondlevel,andperhapssignificantwhenlookingtogroupsensorsanddevicesaccordingtoany numberofcriteriathatmaybechosen,thetaskthenbecomesoneofaugmentingdataasitarrivesin supporting platforms or the databases, and ensuring that these data identifiers (or metadata) are correctlyaggregatedandprocessedalongsideassociateddata,enhancingthecapabilityofplatformsin verifyingandcontextualisingdata. 4 Conclusionsandrecommendations Platformsmanagingdataandapplicationsrequiresignificantlymoreflexibility,agilityandscalabilityto meet the requirementsof businesses in the Internet of Things. These requirementswill be dynamic, constantly changing as the opportunities from implemented sensors and devices, and their data are identified. Businesses will look to gain and maintain competitive advantage from innovative applications,requiringquickerapplicationdevelopmentandagiledatamodels. In this environment of the Internet of Things and Big Data, Machina Research makes the following recommendations:! EnterprisesshouldcarefullyconsiderdifferenttypesofdatabasesasillustratedinFigure2to addressthedatageneratedfromtheexponentiallygrowingnumberofdiversesensors,devices, andthingsaswellasthegrowingdiversityinstructureandscaleofthatdata.insomeinstances, SQLandhybriddatabaseswillmeettherequirementsofbusinesses,andinothers,asaddressed inthisresearchnote,anosqldatabasewillbethewayforward.
6 MachinaResearch//ResearchNote MachinaResearch, Figure2:NewCapabilitiesintheInternetofThings[Source:MachinaResearch,2014]! Providersofdatabaseswillneedtoensurethattheirsolutionsareflexibleandagile,meeting thedynamicrequirementsofbusinesswithouthavingtoreinventtheapplicationordatamodel everytime,andhavingrobustintegrationswithm2m/iotapplicationplatforms! Adiverseapproachto dataanalyticswillpaydividends.forprovidersofdataanalytics, the abilitytosupportmultipleanalyticalapproachestoaddressthevariedrequirementsofbusiness applicationsanddatawillbecomeanincreasinglyimportantfeatureinthefuture.
7
REAL-TIME BIG DATA ANALYTICS
www.leanxcale.com info@leanxcale.com REAL-TIME BIG DATA ANALYTICS Blending Transactional and Analytical Processing Delivers Real-Time Big Data Analytics 2 ULTRA-SCALABLE FULL ACID FULL SQL DATABASE LeanXcale
More informationHow To Handle Big Data With A Data Scientist
III Big Data Technologies Today, new technologies make it possible to realize value from Big Data. Big data technologies can replace highly customized, expensive legacy systems with a standard solution
More informationHow To Make Data Streaming A Real Time Intelligence
REAL-TIME OPERATIONAL INTELLIGENCE Competitive advantage from unstructured, high-velocity log and machine Big Data 2 SQLstream: Our s-streaming products unlock the value of high-velocity unstructured log
More informationMachina Research. Where is the value in IoT? IoT data and analytics may have an answer. Emil Berthelsen, Principal Analyst April 28, 2016
Machina Research Where is the value in IoT? IoT data and analytics may have an answer Emil Berthelsen, Principal Analyst April 28, 2016 About Machina Research Machina Research is the world s leading provider
More informationArchitecting for the Internet of Things & Big Data
Architecting for the Internet of Things & Big Data Robert Stackowiak, Oracle North America, VP Information Architecture & Big Data September 29, 2014 Safe Harbor Statement The following is intended to
More informationBIG DATA Alignment of Supply & Demand Nuria de Lama Representative of Atos Research &
BIG DATA Alignment of Supply & Demand Nuria de Lama Representative of Atos Research & Innovation 04-08-2011 to the EC 8 th February, Luxembourg Your Atos business Research technologists. and Innovation
More informationNo-SQL Databases for High Volume Data
Target Conference 2014 No-SQL Databases for High Volume Data Edward Wijnen 3 November 2014 The New Connected World Needs a Revolutionary New DBMS Today The Internet of Things 1990 s Mobile 1970 s Mainfram
More informationEmerging Requirements and DBMS Technologies:
Emerging Requirements and DBMS Technologies: When Is Relational the Right Choice? Carl Olofson Research Vice President, IDC April 1, 2014 Agenda 2 Why Relational in the First Place? Evolution of Databases
More informationTransforming the Telecoms Business using Big Data and Analytics
Transforming the Telecoms Business using Big Data and Analytics Event: ICT Forum for HR Professionals Venue: Meikles Hotel, Harare, Zimbabwe Date: 19 th 21 st August 2015 AFRALTI 1 Objectives Describe
More informationMachina Research Viewpoint. The critical role of connectivity platforms in M2M and IoT application enablement
Machina Research Viewpoint The critical role of connectivity platforms in M2M and IoT application enablement June 2014 Connected devices (billion) 2 Introduction The growth of connected devices in M2M
More informationextensible record stores document stores key-value stores Rick Cattel s clustering from Scalable SQL and NoSQL Data Stores SIGMOD Record, 2010
System/ Scale to Primary Secondary Joins/ Integrity Language/ Data Year Paper 1000s Index Indexes Transactions Analytics Constraints Views Algebra model my label 1971 RDBMS O tables sql-like 2003 memcached
More informationonetransport 2016 InterDigital, Inc. All Rights Reserved.
onetransport 1 onetransport: Who We are Today Platform Provider Transport Expert Analytics Sensors / Analytics Data providers / Use case owners 11 partners 2- year project 3.5m Total funding 2 How this
More informationFind the Information That Matters. Visualize Your Data, Your Way. Scalable, Flexible, Global Enterprise Ready
Real-Time IoT Platform Solutions for Wireless Sensor Networks Find the Information That Matters ViZix is a scalable, secure, high-capacity platform for Internet of Things (IoT) business solutions that
More informationINTRODUCTION TO CASSANDRA
INTRODUCTION TO CASSANDRA This ebook provides a high level overview of Cassandra and describes some of its key strengths and applications. WHAT IS CASSANDRA? Apache Cassandra is a high performance, open
More informationBlueprints and feasibility studies for Enterprise IoT (Part Two of Three)
Blueprints and feasibility studies for Enterprise IoT (Part Two of Three) 1 Executive Summary The Internet of Things provides a host of opportunities for enterprises to design, develop and launch smart
More informationGAIN BETTER INSIGHT FROM BIG DATA USING JBOSS DATA VIRTUALIZATION
GAIN BETTER INSIGHT FROM BIG DATA USING JBOSS DATA VIRTUALIZATION Syed Rasheed Solution Manager Red Hat Corp. Kenny Peeples Technical Manager Red Hat Corp. Kimberly Palko Product Manager Red Hat Corp.
More informationBIG DATA TECHNOLOGY. Hadoop Ecosystem
BIG DATA TECHNOLOGY Hadoop Ecosystem Agenda Background What is Big Data Solution Objective Introduction to Hadoop Hadoop Ecosystem Hybrid EDW Model Predictive Analysis using Hadoop Conclusion What is Big
More informationEvolving from SCADA to IoT
Evolving from SCADA to IoT Evolving from SCADA to IoT Let s define Semantics IoT Objectives, chapters 1 and 2 Separating the hype from the reality Why IoT isn t easy An IoT roadmap & framework IoT vs.
More informationData Services Advisory
Data Services Advisory Modern Datastores An Introduction Created by: Strategy and Transformation Services Modified Date: 8/27/2014 Classification: DRAFT SAFE HARBOR STATEMENT This presentation contains
More information<Insert Picture Here> Extending Hyperion BI with the Oracle BI Server
Extending Hyperion BI with the Oracle BI Server Mark Ostroff Sr. BI Solutions Consultant Agenda Hyperion BI versus Hyperion BI with OBI Server Benefits of using Hyperion BI with the
More informationMaster big data to optimize the oil and gas lifecycle
Viewpoint paper Master big data to optimize the oil and gas lifecycle Information management and analytics (IM&A) helps move decisions from reactive to predictive Table of contents 4 Getting a handle on
More informationCybersecurity Analytics for a Smarter Planet
IBM Institute for Advanced Security December 2010 White Paper Cybersecurity Analytics for a Smarter Planet Enabling complex analytics with ultra-low latencies on cybersecurity data in motion 2 Cybersecurity
More informationIoT and Big Data- The Current and Future Technologies: A Review
Available Online at www.ijcsmc.com International Journal of Computer Science and Mobile Computing A Monthly Journal of Computer Science and Information Technology IJCSMC, Vol. 5, Issue. 1, January 2016,
More informationKeywords Big Data, NoSQL, Relational Databases, Decision Making using Big Data, Hadoop
Volume 4, Issue 1, January 2014 ISSN: 2277 128X International Journal of Advanced Research in Computer Science and Software Engineering Research Paper Available online at: www.ijarcsse.com Transitioning
More informationWhy NoSQL? Your database options in the new non- relational world. 2015 IBM Cloudant 1
Why NoSQL? Your database options in the new non- relational world 2015 IBM Cloudant 1 Table of Contents New types of apps are generating new types of data... 3 A brief history on NoSQL... 3 NoSQL s roots
More informationHow Transactional Analytics is Changing the Future of Business A look at the options, use cases, and anti-patterns
How Transactional Analytics is Changing the Future of Business A look at the options, use cases, and anti-patterns Table of Contents Abstract... 3 Introduction... 3 Definition... 3 The Expanding Digitization
More informationComplex, true real-time analytics on massive, changing datasets.
Complex, true real-time analytics on massive, changing datasets. A NoSQL, all in-memory enabling platform technology from: Better Questions Come Before Better Answers FinchDB is a NoSQL, all in-memory
More informationBig Data: Overview and Roadmap. 2015 eglobaltech. All rights reserved.
Big Data: Overview and Roadmap 2015 eglobaltech. All rights reserved. What is Big Data? Large volumes of complex and variable data that require advanced techniques and technologies to enable capture, storage,
More informationM2M Communications and Internet of Things for Smart Cities. Soumya Kanti Datta Mobile Communications Dept. Email: Soumya-Kanti.Datta@eurecom.
M2M Communications and Internet of Things for Smart Cities Soumya Kanti Datta Mobile Communications Dept. Email: Soumya-Kanti.Datta@eurecom.fr WHAT IS EURECOM A graduate school & research centre in communication
More informationOffload Enterprise Data Warehouse (EDW) to Big Data Lake. Ample White Paper
Offload Enterprise Data Warehouse (EDW) to Big Data Lake Oracle Exadata, Teradata, Netezza and SQL Server Ample White Paper EDW (Enterprise Data Warehouse) Offloads The EDW (Enterprise Data Warehouse)
More informationGetting Real Real Time Data Integration Patterns and Architectures
Getting Real Real Time Data Integration Patterns and Architectures Nelson Petracek Senior Director, Enterprise Technology Architecture Informatica Digital Government Institute s Enterprise Architecture
More informationCloud Big Data Architectures
Cloud Big Data Architectures Lynn Langit QCon Sao Paulo, Brazil 2016 About this Workshop Real-world Cloud Scenarios w/aws, Azure and GCP 1. Big Data Solution Types 2. Data Pipelines 3. ETL and Visualization
More informationData Modeling for Big Data
Data Modeling for Big Data by Jinbao Zhu, Principal Software Engineer, and Allen Wang, Manager, Software Engineering, CA Technologies In the Internet era, the volume of data we deal with has grown to terabytes
More informationNOSQL, BIG DATA AND GRAPHS. Technology Choices for Today s Mission- Critical Applications
NOSQL, BIG DATA AND GRAPHS Technology Choices for Today s Mission- Critical Applications 2 NOSQL, BIG DATA AND GRAPHS NOSQL, BIG DATA AND GRAPHS TECHNOLOGY CHOICES FOR TODAY S MISSION- CRITICAL APPLICATIONS
More informationEssential Elements of an IoT Core Platform
Essential Elements of an IoT Core Platform Judith Hurwitz President and CEO Daniel Kirsch Principal Analyst and Vice President Sponsored by Hitachi Introduction The maturation of the enterprise cloud,
More informationsecure intelligence collection and assessment system Your business technologists. Powering progress
secure intelligence collection and assessment system Your business technologists. Powering progress The decisive advantage for intelligence services The rising mass of data items from multiple sources
More informationFORRESTER CONSULTING INTERNET OF THINGS SURVEY - KEY FINDINGS. Building Value from Visibility: 2012 Enterprise Internet of Things Adoption Outlook
FORRESTER CONSULTING INTERNET OF THINGS SURVEY - KEY FINDINGS Building Value from Visibility: 2012 Enterprise Internet of Things Adoption Outlook SURVEY RESPONDENTS WERE PROVIDED WITH FOLLOWING DEFINITION
More informationSAP and Hortonworks Reference Architecture
SAP and Hortonworks Reference Architecture Hortonworks. We Do Hadoop. June Page 1 2014 Hortonworks Inc. 2011 2014. All Rights Reserved A Modern Data Architecture With SAP DATA SYSTEMS APPLICATIO NS Statistical
More informationHadoop Ecosystem Overview. CMSC 491 Hadoop-Based Distributed Computing Spring 2015 Adam Shook
Hadoop Ecosystem Overview CMSC 491 Hadoop-Based Distributed Computing Spring 2015 Adam Shook Agenda Introduce Hadoop projects to prepare you for your group work Intimate detail will be provided in future
More informationInfrastructures for big data
Infrastructures for big data Rasmus Pagh 1 Today s lecture Three technologies for handling big data: MapReduce (Hadoop) BigTable (and descendants) Data stream algorithms Alternatives to (some uses of)
More informationSoftware Engineering for Big Data. CS846 Paulo Alencar David R. Cheriton School of Computer Science University of Waterloo
Software Engineering for Big Data CS846 Paulo Alencar David R. Cheriton School of Computer Science University of Waterloo Big Data Big data technologies describe a new generation of technologies that aim
More informationBig Data - Infrastructure Considerations
April 2014, HAPPIEST MINDS TECHNOLOGIES Big Data - Infrastructure Considerations Author Anand Veeramani / Deepak Shivamurthy SHARING. MINDFUL. INTEGRITY. LEARNING. EXCELLENCE. SOCIAL RESPONSIBILITY. Copyright
More informationJOURNAL OF OBJECT TECHNOLOGY
JOURNAL OF OBJECT TECHNOLOGY Online at www.jot.fm. Published by ETH Zurich, Chair of Software Engineering JOT, 2008 Vol. 7, No. 8, November-December 2008 What s Your Information Agenda? Mahesh H. Dodani,
More informationBig Data and Healthcare Payers WHITE PAPER
Knowledgent White Paper Series Big Data and Healthcare Payers WHITE PAPER Summary With the implementation of the Affordable Care Act, the transition to a more member-centric relationship model, and other
More informationLuncheon Webinar Series May 13, 2013
Luncheon Webinar Series May 13, 2013 InfoSphere DataStage is Big Data Integration Sponsored By: Presented by : Tony Curcio, InfoSphere Product Management 0 InfoSphere DataStage is Big Data Integration
More informationIntegrating a Big Data Platform into Government:
Integrating a Big Data Platform into Government: Drive Better Decisions for Policy and Program Outcomes John Haddad, Senior Director Product Marketing, Informatica Digital Government Institute s Government
More informationTime-Series Databases and Machine Learning
Time-Series Databases and Machine Learning Jimmy Bates November 2017 1 Top-Ranked Hadoop 1 3 5 7 Read Write File System World Record Performance High Availability Enterprise-grade Security Distribution
More informationDatenverwaltung im Wandel - Building an Enterprise Data Hub with
Datenverwaltung im Wandel - Building an Enterprise Data Hub with Cloudera Bernard Doering Regional Director, Central EMEA, Cloudera Cloudera Your Hadoop Experts Founded 2008, by former employees of Employees
More informationManaging Cloud Server with Big Data for Small, Medium Enterprises: Issues and Challenges
Managing Cloud Server with Big Data for Small, Medium Enterprises: Issues and Challenges Prerita Gupta Research Scholar, DAV College, Chandigarh Dr. Harmunish Taneja Department of Computer Science and
More informationA new agenda item for enterprise executives: Enterprise IoT (Part One of Three)
A new agenda item for enterprise executives: Enterprise IoT (Part One of Three) 1 Executive Summary The Internet of Things provides a host of opportunities for enterprises to introduce and integrate innovative
More informationBig Data Storage Challenges for the Industrial Internet of Things
Big Data Storage Challenges for the Industrial Internet of Things Shyam V Nath Diwakar Kasibhotla SDC September, 2014 Agenda Introduction to IoT and Industrial Internet Industrial & Sensor Data Big Data
More informationAnalytics March 2015 White paper. Why NoSQL? Your database options in the new non-relational world
Analytics March 2015 White paper Why NoSQL? Your database options in the new non-relational world 2 Why NoSQL? Contents 2 New types of apps are generating new types of data 2 A brief history of NoSQL 3
More informationAffordable, Scalable, Reliable OLTP in a Cloud and Big Data World: IBM DB2 purescale
WHITE PAPER Affordable, Scalable, Reliable OLTP in a Cloud and Big Data World: IBM DB2 purescale Sponsored by: IBM Carl W. Olofson December 2014 IN THIS WHITE PAPER This white paper discusses the concept
More informationExplore the Art of the Possible Discover how your company can create new business value through a co-innovation partnership with SAP
Explore the Art of the Possible Discover how your company can create new business value through a co-innovation partnership with SAP Innovate to Differentiate How SAP technology innovations can help your
More informationHorizontal IoT Application Development using Semantic Web Technologies
Horizontal IoT Application Development using Semantic Web Technologies Soumya Kanti Datta Research Engineer Communication Systems Department Email: Soumya-Kanti.Datta@eurecom.fr Roadmap Introduction Challenges
More informationBig Data and Data Science: Behind the Buzz Words
Big Data and Data Science: Behind the Buzz Words Peggy Brinkmann, FCAS, MAAA Actuary Milliman, Inc. April 1, 2014 Contents Big data: from hype to value Deconstructing data science Managing big data Analyzing
More informationReal-Time Handling of Network Monitoring Data Using a Data-Intensive Framework
Real-Time Handling of Network Monitoring Data Using a Data-Intensive Framework Aryan TaheriMonfared Tomasz Wiktor Wlodarczyk Chunming Rong Department of Electrical Engineering and Computer Science University
More informationBig Data, Cloud Computing, Spatial Databases Steven Hagan Vice President Server Technologies
Big Data, Cloud Computing, Spatial Databases Steven Hagan Vice President Server Technologies Big Data: Global Digital Data Growth Growing leaps and bounds by 40+% Year over Year! 2009 =.8 Zetabytes =.08
More informationBig Data Solutions. Portal Development with MongoDB and Liferay. Solutions
Big Data Solutions Portal Development with MongoDB and Liferay Solutions Introduction Companies have made huge investments in Business Intelligence and analytics to better understand their clients and
More informationThe emergence of big data technology and analytics
ABSTRACT The emergence of big data technology and analytics Bernice Purcell Holy Family University The Internet has made new sources of vast amount of data available to business executives. Big data is
More informationINTERNATIONAL JOURNAL OF PURE AND APPLIED RESEARCH IN ENGINEERING AND TECHNOLOGY
INTERNATIONAL JOURNAL OF PURE AND APPLIED RESEARCH IN ENGINEERING AND TECHNOLOGY A PATH FOR HORIZING YOUR INNOVATIVE WORK OVERVIEW ON BIG DATA SYSTEMATIC TOOLS MR. SACHIN D. CHAVHAN 1, PROF. S. A. BHURA
More informationAssociate Professor, Department of CSE, Shri Vishnu Engineering College for Women, Andhra Pradesh, India 2
Volume 6, Issue 3, March 2016 ISSN: 2277 128X International Journal of Advanced Research in Computer Science and Software Engineering Research Paper Available online at: www.ijarcsse.com Special Issue
More informationUnderstanding traffic flow
White Paper A Real-time Data Hub For Smarter City Applications Intelligent Transportation Innovation for Real-time Traffic Flow Analytics with Dynamic Congestion Management 2 Understanding traffic flow
More informationIndustry 4.0 and Big Data
Industry 4.0 and Big Data Marek Obitko, mobitko@ra.rockwell.com Senior Research Engineer 03/25/2015 PUBLIC PUBLIC - 5058-CO900H 2 Background Joint work with Czech Institute of Informatics, Robotics and
More informationHadoop and Data Warehouse Friends, Enemies or Profiteers? What about Real Time?
Hadoop and Data Warehouse Friends, Enemies or Profiteers? What about Real Time? Kai Wähner kwaehner@tibco.com @KaiWaehner www.kai-waehner.de Disclaimer! These opinions are my own and do not necessarily
More informationInformix The Intelligent Database for IoT
Informix The Intelligent Database for IoT Kiran Challapalli Informix Competitive Technology & Enablement challapalli@in.ibm.com +91-80431-91802 Agenda What is Internet of Things (IoT) Why it matters IoT
More informationBig Data: A Storage Systems Perspective Muthukumar Murugan Ph.D. HP Storage Division
Big Data: A Storage Systems Perspective Muthukumar Murugan Ph.D. HP Storage Division In this talk Big data storage: Current trends Issues with current storage options Evolution of storage to support big
More information5 Keys to Unlocking the Big Data Analytics Puzzle. Anurag Tandon Director, Product Marketing March 26, 2014
5 Keys to Unlocking the Big Data Analytics Puzzle Anurag Tandon Director, Product Marketing March 26, 2014 1 A Little About Us A global footprint. A proven innovator. A leader in enterprise analytics for
More informationOracle s Big Data solutions. Roger Wullschleger. <Insert Picture Here>
s Big Data solutions Roger Wullschleger DBTA Workshop on Big Data, Cloud Data Management and NoSQL 10. October 2012, Stade de Suisse, Berne 1 The following is intended to outline
More informationData Refinery with Big Data Aspects
International Journal of Information and Computation Technology. ISSN 0974-2239 Volume 3, Number 7 (2013), pp. 655-662 International Research Publications House http://www. irphouse.com /ijict.htm Data
More informationStaying agile with Big Data
An Ovum white paper for Red Hat Publication Date: 09 Sep 2014 Tony Baer Summary Catalyst Like any major technology project, organizations implementing Big Data projects face challenges with aligning business
More informationGanzheitliches Datenmanagement
Ganzheitliches Datenmanagement für Hadoop Michael Kohs, Senior Sales Consultant @mikchaos The Problem with Big Data Projects in 2016 Relational, Mainframe Documents and Emails Data Modeler Data Scientist
More informationBig Data Analytics. Rasoul Karimi
Big Data Analytics Rasoul Karimi Information Systems and Machine Learning Lab (ISMLL) Institute of Computer Science University of Hildesheim, Germany Big Data Analytics Big Data Analytics 1 / 1 Introduction
More informationBig Data Analytics in Health Care
Big Data Analytics in Health Care S. G. Nandhini 1, V. Lavanya 2, K.Vasantha Kokilam 3 1 13mss032, 2 13mss025, III. M.Sc (software systems), SRI KRISHNA ARTS AND SCIENCE COLLEGE, 3 Assistant Professor,
More informationWhite Paper April 2006
White Paper April 2006 Table of Contents 1. Executive Summary...4 1.1 Scorecards...4 1.2 Alerts...4 1.3 Data Collection Agents...4 1.4 Self Tuning Caching System...4 2. Business Intelligence Model...5
More informationBIGDATA GREENPLUM DBA INTRODUCTION COURSE OBJECTIVES COURSE SUMMARY HIGHLIGHTS OF GREENPLUM DBA AT IQ TECH
BIGDATA GREENPLUM DBA Meta-data: Outrun your competition with advanced knowledge in the area of BigData with IQ Technology s online training course on Greenplum DBA. A state-of-the-art course that is delivered
More informationHADOOP SOLUTION USING EMC ISILON AND CLOUDERA ENTERPRISE Efficient, Flexible In-Place Hadoop Analytics
HADOOP SOLUTION USING EMC ISILON AND CLOUDERA ENTERPRISE Efficient, Flexible In-Place Hadoop Analytics ESSENTIALS EMC ISILON Use the industry's first and only scale-out NAS solution with native Hadoop
More informationCloud Scale Distributed Data Storage. Jürmo Mehine
Cloud Scale Distributed Data Storage Jürmo Mehine 2014 Outline Background Relational model Database scaling Keys, values and aggregates The NoSQL landscape Non-relational data models Key-value Document-oriented
More informationAccenture and Oracle: Leading the IoT Revolution
Accenture and Oracle: Leading the IoT Revolution ACCENTURE AND ORACLE The Internet of Things (IoT) is rapidly moving from concept to reality, as companies see the value of connecting a range of sensors,
More informationSAP HANA Data Center Intelligence - Overview Presentation
SAP HANA Data Center Intelligence - Overview Presentation August, 2014 Customer Disclaimer This presentation outlines our general product direction and should not be relied on in making a purchase decision.
More informationThe Power And Use of FireScope Unify ESB
The Power And Use of FireScope Unify ESB Executive Summary An important differentiator for FireScope Unify is its ability to acquire and collect both unstructured and structured data that exists within
More informationIntroduction to Polyglot Persistence. Antonios Giannopoulos Database Administrator at ObjectRocket by Rackspace
Introduction to Polyglot Persistence Antonios Giannopoulos Database Administrator at ObjectRocket by Rackspace FOSSCOMM 2016 Background - 14 years in databases and system engineering - NoSQL DBA @ ObjectRocket
More informationPerformance Management of SQL Server
Performance Management of SQL Server Padma Krishnan Senior Manager When we design applications, we give equal importance to the backend database as we do to the architecture and design of the application
More informationBig Systems, Big Data
Big Systems, Big Data When considering Big Distributed Systems, it can be noted that a major concern is dealing with data, and in particular, Big Data Have general data issues (such as latency, availability,
More informationReal Time Fraud Detection With Sequence Mining on Big Data Platform. Pranab Ghosh Big Data Consultant IEEE CNSV meeting, May 6 2014 Santa Clara, CA
Real Time Fraud Detection With Sequence Mining on Big Data Platform Pranab Ghosh Big Data Consultant IEEE CNSV meeting, May 6 2014 Santa Clara, CA Open Source Big Data Eco System Query (NOSQL) : Cassandra,
More informationI D C T E C H N O L O G Y S P O T L I G H T
I D C T E C H N O L O G Y S P O T L I G H T Capitalizing on the Future with Data Solutions December 2015 Adapted from IDC PeerScape: Practices for Ensuring a Successful Big Data and Analytics Project,
More informationBig Data Anwendungen in Industrie und Forschung
Big Data Anwendungen in Industrie und Forschung Dr. Reinhard Stumptner +43 7236 3343 851 reinhard.stumptner@scch.at www.scch.at Das SCCH ist eine Initiative der Das SCCH befindet sich im SCCH Key Facts
More informationInternet of Things Vom Hype zum Innovationsschub!
Internet of Things Vom Hype zum Innovationsschub! Internal Helmut Grimm, SAP SE März, 2016 Disclaimer This presentation outlines our general product direction and should not be relied on in making a purchase
More informationwww.objectivity.com Choosing The Right Big Data Tools For The Job A Polyglot Approach
www.objectivity.com Choosing The Right Big Data Tools For The Job A Polyglot Approach Nic Caine NoSQL Matters, April 2013 Overview The Problem Current Big Data Analytics Relationship Analytics Leveraging
More informationTHE DEVELOPER GUIDE TO BUILDING STREAMING DATA APPLICATIONS
THE DEVELOPER GUIDE TO BUILDING STREAMING DATA APPLICATIONS WHITE PAPER Successfully writing Fast Data applications to manage data generated from mobile, smart devices and social interactions, and the
More informationHadoop Evolution In Organizations. Mark Vervuurt Cluster Data Science & Analytics
In Organizations Mark Vervuurt Cluster Data Science & Analytics AGENDA 1. Yellow Elephant 2. Data Ingestion & Complex Event Processing 3. SQL on Hadoop 4. NoSQL 5. InMemory 6. Data Science & Machine Learning
More informationENZO UNIFIED SOLVES THE CHALLENGES OF REAL-TIME DATA INTEGRATION
ENZO UNIFIED SOLVES THE CHALLENGES OF REAL-TIME DATA INTEGRATION Enzo Unified Solves Real-Time Data Integration Challenges that Increase Business Agility and Reduce Operational Complexities CHALLENGES
More informationDominik Wagenknecht Accenture
Dominik Wagenknecht Accenture Improving Mainframe Performance with Hadoop October 17, 2014 Organizers General Partner Top Media Partner Media Partner Supporters About me Dominik Wagenknecht Accenture Vienna
More informationCLOUD BASED SEMANTIC EVENT PROCESSING FOR
CLOUD BASED SEMANTIC EVENT PROCESSING FOR MONITORING AND MANAGEMENT OF SUPPLY CHAINS A VLTN White Paper Dr. Bill Karakostas Bill.karakostas@vltn.be Executive Summary Supply chain visibility is essential
More informationMaking Sense of Big Data in Insurance
Making Sense of Big Data in Insurance Amir Halfon, CTO, Financial Services, MarkLogic Corporation BIG DATA?.. SLIDE: 2 The Evolution of Data Management For your application data! Application- and hardware-specific
More informationBuilding Big with Big Data Now companies are in the middle of a renovation that forces them to be analytics-driven to continue being competitive.
Unlocking Big Data Building Big with Big Data Now companies are in the middle of a renovation that forces them to be analytics-driven to continue being competitive. Data analysis provides a complete insight
More informationKeywords Big Data; OODBMS; RDBMS; hadoop; EDM; learning analytics, data abundance.
Volume 4, Issue 11, November 2014 ISSN: 2277 128X International Journal of Advanced Research in Computer Science and Software Engineering Research Paper Available online at: www.ijarcsse.com Analytics
More informationCA Technologies Big Data Infrastructure Management Unified Management and Visibility of Big Data
Research Report CA Technologies Big Data Infrastructure Management Executive Summary CA Technologies recently exhibited new technology innovations, marking its entry into the Big Data marketplace with
More informationTowards Smart and Intelligent SDN Controller
Towards Smart and Intelligent SDN Controller - Through the Generic, Extensible, and Elastic Time Series Data Repository (TSDR) YuLing Chen, Dell Inc. Rajesh Narayanan, Dell Inc. Sharon Aicler, Cisco Systems
More informationTHE CLOUD DATA BRIEF. Big Data Transitions to the Cloud
THE CLOUD DATA BRIEF Big Data Transitions to the Cloud Most businesses strive to capture and analyze their data. But how and where does this happen? Solutions were once limited to databases deployed exclusively
More information