COPYRIGHT MEDINEWS (DIABETES) LIMITED
|
|
|
- Hugo Hancock
- 9 years ago
- Views:
Transcription
1 Levy&Ahmad P /2/04 14:58 Page 1 Pharmacology of insulin BUSHRA AHMAD Abstract Diabetes is associated with microvascular and macrovascular complications leading to significant morbidity and mortality. Glycaemic control is important to prevent and delay the progression of these complications. An ideal insulin regimen in patients with diabetes would mirror the 24-hour insulin profile of a non-diabetic person and thereby prevent hyperglycaemia without inducing hypoglycaemia. This has, until recently, proved difficult to reproduce by regular subcutaneous insulin injections due to the inherent pharmacokinetic properties of the available insulins. Normoglycaemia was rarely achieved without hypoglycaemia compromising the quality of patients lives. The advent of the new long- and short-acting insulin analogues are expected to both improve glycaemic control leading to a reduction in diabetes-related complications and reduce the incidence of hypoglycaemia thereby offering patients a better lifestyle. Br J Diabetes Vasc Dis 2004;4:10 14 Key words: insulin, pharmacology, analogues, lispro, aspart, glargine, detemir. Introduction Insulin, from the pancreatic beta-cells, plays a crucial role in glucose homeostasis. It acts on the liver to inhibit glycogenolysis and gluconeogenesis, and in the periphery to stimulate glucose utilisation by muscle and fat. An ideal insulin treatment regimen for people with diabetes would reinstate the normal daily insulin profile (figure 1) and prevent hyperglycaemia without inducing hypoglycaemia. However, in contrast to the physiological delivery of insulin into the hepatic portal circulation, subcutaneously injected insulin provides relatively less insulin to the liver than the periphery. Hence, the normal balance of hepatic and peripheral effects of insulin cannot be exactly restored by conventional injections. Correspondence to: Dr Bushra Ahmad Department of Diabetes, Oxford Centre for Diabetes, Endocrinology and Metabolism, Churchill Hospital, Oxford, OX3 7LJ, UK. Tel: +44 (0) ; Fax: +44 (0) [email protected] Bushra Ahmad Thus, a selection of different insulin structures, formulations and delivery regimens have been designed to address this issue. Structure The insulin molecule consists of two polypeptide chains, the A chain (21 amino acids) and the B chain (30 amino acids) (figure 2). It exists as monomers in dilute solutions such as the circulation but as hexamers (six monomers which self-associate in conjunction with two zinc ions) in crystals and in the beta-cell secretory granule. Human insulin differs from porcine insulin at position B30 (threonine in man versus alanine in pig), and from bovine insulin Figure 1. The normal daily profile of plasma insulin Plasma insulin mu/l Breakfast Lunch Dinner Snack Adapted with permission from Day et al. Br J Cardiol 2003;10: THE BRITISH JOURNAL OF DIABETES AND VASCULAR DISEASE
2 Levy&Ahmad P /2/04 14:58 Page 2 Figure 2. Amino acid sequences of native human insulin, the long-acting analogues glargine and detemir, and the rapid-acting monomeric analogues lispro and aspart. Sequences shown as single letter amino acid code However, there is no measurable difference in biological potency of human and animal insulins. 3 Human insulin is absorbed slightly faster from a subcutaneous injection site 1 than porcine insulin, which may be explained by greater hydrophilicity of the human insulin molecule. 2 Human insulin FVNQHLCGSHLVEALYLVCGERGFFYTPKT Glargine GIVEQCCTSICSLYQLENYCG FVNQHLCGSHLVEALYLVCGERGFFYTPKTR R Detemir FVNQHLCGSHLVEALYLVCGERGFFYTPK Lispro FVNQHLCGSHLVEALYLVCGERGFFYTK PT Aspart Tetradecanoyl FVNQHLCGSHLVEALYLVCGERGFFYTDKT Reproduced with permission from Day et al. Br J Cardiol 2003;10: at positions A8 and A10 (respectively threonine and isoleucine in man versus alanine and valine in the ox). Animal and human insulin are therefore nearly homologous and the differences are not crucial to the receptor binding or action of insulin. The carboxyl end of the B chain of the insulin molecule is involved in self-association of two insulin molecules into dimers. Therefore, the self-association properties of human and porcine insulin may be different. 1 B30 threonine adds an extra hydroxyl group to the human insulin molecule, increasing its hydrophilic properties and decreasing the lipophilic properties when compared to pork insulin. Therefore, human insulin is more soluble in aqueous solutions than porcine insulins. 1 The spherical structure of the insulin monomer is important for its interaction with the insulin receptor: porcine insulin has a slightly different threedimensional structure to human insulin. 2 Short-acting insulins Standard Insulin in neutral concentrated solutions in vials is mostly zinccontaining hexamers. For absorption to occur after subcutaneous injection, insulin needs to be in a monomeric form. As dissociation of the insulin hexamers to monomers is slow, so is the rate of absorption from the subcutaneous site. 4 For example, it can take approximately 1 2 hours for absorption of subcutaneous regular short-acting insulin. 5 This results in a slow rise to peak insulin concentrations and hence suboptimal plasma insulin levels in the early phase of glucose absorption after a meal, leading to postprandial hyperglycaemia. The insulin levels also fall slowly after the peak, extending the period of elevated insulin concentrations with the risk of later hypoglycaemia. 5 The influence of short-acting insulins on post-prandial hyperglycaemia is improved by subcutaneous administration 30 minutes to one hour before eating 6 but the delayed risk of hypoglycaemia remains. Therefore, the extent of the insulin crystallisation and the ease of dissociation play an important role in determining the rate of absorption after subcutaneous injection. Rapid-acting analogues Insulin hexamer formation is an obstacle to mimicking physiological insulin profiles after subcutaneous injection. This led to the hypothesis that a reduced tendency of insulin to self-associate would enable faster absorption and shorter duration of action. Using this rationale monomeric insulin analogues were created by alteration of selected amino acid residues in regions vital for self-association. 7 After subcutaneous injecting they are absorbed 2 3 times faster than the regular non-dissociating hexameric insulins 7,8 giving a prompt rise in circulating insulin and the opportunity to inject just before a meal. The rates of disappearance are also 2 3 times faster with no lag phase, 8 so monomeric insulins result in a more physiological prandial plasma insulin profile. The two currently available rapid-acting insulin analogues are insulin lispro (LysB28, ProB29) and insulin aspart (AspB28) (figure 2). Insulin lispro (LysB28, ProB29-human insulin) Insulin lispro, the first insulin analogue to be used clinically, has the B28 (proline) and B29 (lysine) residues inverted, resulting in reduced self-association. 7,9 This inverted sequence was found and thought to be responsible for the lower degree of self-association of insulin-like growth factor (IGF-1) and insulin lispro was engineered to incorporate this pharmacological advantage. 10 Both human insulin and insulin lispro exist in their respective formulations as hexamers that are stabilised with zinc and phenolic preservatives to assure two years of shelf life at 4 C. However, insulin lispro differs in that its hexamer complex rapidly dissociates VOLUME 4 ISSUE 1. JANUARY/FEBRUARY
3 Levy&Ahmad P /2/04 14:58 Page 3 into monomeric subunits, as the phenolic ligands diffuse away in the interstitial space resulting in a plasma absorption profile indistinguishable from that of pure monomeric insulin. 4,11 Immunogenicity, receptor binding and metabolic effects of insulin lispro are similar to human insulin Lispro does however have a slightly elevated IGF-1 receptor affinity. 14 Toxicology studies, which included reproductive and developmental periods in animals, showed no long-term toxicity 4 and pooled data from clinical studies showed no increase in adverse events or progression of diabetic complications. 15 The rapid absorption, onset and short duration of action of lispro results in a more precise insulin profile at mealtimes with a peak approximately one hour after subcutaneous injection and rapid elimination. After intravenous injection 'regular' human insulin and insulin lispro have identical pharmacokinetics and pharmacodynamics. 11,16 Glycaemic control on insulin lispro is comparable 17 or improved 18,19 compared to 'regular' short-acting insulin. Improved glycaemic control appears to be best achieved with multiple injection regimens where the basal dose is optimised, 20,21 although this can be associated with increased hypoglycaemia. 22 Insulin lispro can be mixed with neutral protamine Hagedorn (NPH) without any pharmacokinetic changes. 23 Several studies have also shown improved post-prandial glucose levels in type 1 17,24,25 and type 2 diabetes 26 including adolescents. 27 This improvement was at the expense of increased fasting and preprandial glucose levels in one study, 25 although fasting glycaemic control was not significantly different in a meta-analysis. 17 Insulin lispro reduced hypoglycaemia in several studies compared to regular human insulin, especially at night-time. 21,24,28 Severe hypoglycaemia was also reduced, 29 possibly due to purportedly enhanced hepatic sensitivity to glucagon with insulin lispro. 30 However, the counterregulatory hormone responses after insulin lispro compared to human insulin and porcine insulin were similar during a stepwise euglycaemic/hypoglycaemic clamp. 31 Further studies showed the counterregulatory hormone responses on insulin lispro were improved 21 or relatively conserved and equivalent to physiological responses to hypoglycaemia in patients on regular insulin. 32,33 Although the optimal time for injecting insulin lispro is immediately before the meal, it can be injected up to 15 minutes after a meal. 34 Treatment satisfaction and flexibility scores on insulin lispro were improved compared to regular human insulin. 35 Insulin lispro appears to be as safe as regular human insulin in pregnant women with type 1, type 2 and gestational diabetes. 36 It does not cross the placenta after a single standard dose 37 and does not cause adverse outcomes in pregnancy. 36 Concerns about progression of retinopathy have not been demonstrated, 38 but further prospective trials are required to confirm these findings. Insulin aspart (Novorapid) Insulin aspart is formed by replacing the proline at B28 with a negatively charged aspartic acid residue. This switch results in reduced self-association of the insulin molecule. Insulin aspart initially exists as hexamers, which after subcutaneous injection Table 1. Approximate pharmacokinetic parameters of traditional insulin preparations after subcutaneous injection of an average patient dose Human Onset of Peak of Duration of insulin type action action action Regular minutes 2 4 hours 6 8 hours NPH 1 3 hours 5 7 hours hours Lente 1 3 hours 4 8 hours hours Ultralente 2 4 hours 8 14 hours hours Regular human insulin is shown for comparison. Adapted from Hirsch I. Med Clin N Am 1998;82: rapidly dissociate into dimers and monomers. 4 Aspart resembles human insulin in receptor binding, potency 39 and metabolic and mitogenic effects. 14 No safety issues were raised by a range of experiments in which insulin aspart and human insulin exhibited similar pharmacological profiles. 40 It was associated with an increase in cross-reactive insulin antibodies, which subsequently fell towards baseline values, without any apparent effects on efficacy or safety. 41 After subcutaneous administration insulin aspart is absorbed faster, than 'regular' human insulin, with higher peak insulin concentrations and a reduced duration of action. 42,43 Aspart improves post-prandial glucose control 44 and in some studies it improves glycaemic control 44,45 compared to regular insulin in patients with type 1 diabetes. It has been associated with reduced night-time and severe hypoglycaemia in some 45 but not all studies. 44 The counterregulatory and symptomatic responses to acute hypoglycaemia between patients on insulin aspart and regular human insulin are similar. 46 Aspart can be administered immediately prior to a meal or postprandially 47 and treatment satisfaction and quality of life scores were significantly improved compared to 'regular' human insulin. 45 No adverse effects were seen with insulin aspart 44 but it is of note that no safety data in pregnancy are available. It is likely that insulin aspart, like insulin lispro, will require multiple injection regimens where the basal dose is optimised. Insulin aspart can be mixed with NPH without alteration of its pharmacokinetics. 48 Long-acting insulins The first successful insulin preparation with a prolonged action was protamine insulin followed by the Lente crystalline zincinsulin series. Classically long-acting insulins have been formulated as crystalline or amorphous suspensions obtained by addition of small amounts of zinc that at high insulin concentrations and neutral ph increase the self-association into dimers and hexamers. 8 The resulting insulin is absorbed slowly from the injected depot. The current long-acting insulins are Ultralente (Ultratard), the longest acting human insulin-zinc crystalline suspension, NPH (or isophane) insulin, an intermediate acting insulin protamine suspension and Lente (70/30 mixture of ultralente with semilente), an intermediate acting insulin (table 1) THE BRITISH JOURNAL OF DIABETES AND VASCULAR DISEASE
4 Levy&Ahmad P /2/04 14:58 Page 4 Key messages Physical and chemical properties of insulin have been used to alter subcutaneous absorption Recombinant DNA technology has led to the production of novel insulin analogues The new short-acting insulin analogues allow more flexibility with rapid absorption, onset and short duration of action The new long-acting insulin analogues allow a more physiological basal insulin profile Crystalline insulin suspensions have a number of disadvantages. Ultratard, although it has a long duration of action, has a high intersubject and intrasubject variation of absorption. This is partly due to suboptimal mixing of the insulin suspension. NPH and Lente are usually too short-acting for a once a day dosing. 4,49 NPH peaks in action 5 7 hours after injection and so the night-time dose can cause nocturnal hypoglycaemia in the early hours when insulin sensitivity is often increased. Reducing the evening dose, however, results in raised morning blood glucoses due to a relative reduction in insulin sensitivity between hours (known as the dawn phenomenon). 50 Long-acting analogues To achieve physiological insulin profiles ideal basal insulins should have a 24-hour peakless activity profile allowing oncedaily dosage, with little variability in blood glucose excursions. 49 Two approaches are being used to develop new long-acting insulin analogues. The first approach changes the isoelectric point (the ph at which insulin is least soluble and precipitates) resulting in an insulin molecule that is soluble at acidic ph (and hence eliminates the variability problems with suspensions) but precipitates in subcutaneous tissues where the ph is near neutral. Insulin glargine (A21 Gly, B31 Arg, B32 Arg) was developed using this method (figure 2). It is a long-acting human insulin analogue that has a near peakless action for at least 24 hours with reduced incidence of hypoglycaemia. 51 The addition of two positively charged arginine molecules to the C-terminus of the B- chain results in a more neutral ph. To confer stability asparagine at position 21 in the A chain was replaced by glycine. 4,49 Insulin glargine is well tolerated with improved treatment satisfaction scores in both type 1 and type 2 diabetes. It elicits less hypoglycaemia, especially nocturnal hypoglycaemia, than NPH insulins with similar levels of improved glycaemic control. 52,53 Initial safety concerns arose after a study in human osteosarcoma cells showed a 6 8-fold IGF-1 receptor binding affinity and mitogenic potency compared to regular human insulin. 14 However, further studies in human skeletal muscle cells found insulin glargine was equivalent to regular human insulin for metabolic responses, and mitogenic effects were not demonstrated. 54 The second approach involves the addition of a fatty acyl chain, which allows the insulin to bind to non-esterified binding sites on albumin. As the modified insulin dissociates slowly from albumin and favours the hexameric state the resultant absorption and duration of action are longer. This is the rationale behind the current development of insulin detemir. 4,49 Insulin detemir is a soluble long-acting analogue with a fatty acyl chain attached to B29 Lys (figure 2). In healthy subjects detemir has a less pronounced peak compared to NPH insulin. Maximum concentrations were reached after 4 6 hours, 55 and detemir appears to produce a more predictable glycaemic control, a smoother plasma glucose profile with a significant reduction in hypoglycaemia. 56 Further human pharmacodynamic and clinical studies are awaited. Conclusions New long- and short-acting insulin analogues are providing greater opportunity for patients to improve glycaemic control. This should lead to a reduction in diabetes-related complications and reduce the incidence of hypoglycaemia, thereby offering patients a better lifestyle. References 1. Heinemann L, Richter B. Clinical Pharmacology of human insulin. Diabetes Care Dec 1993;16(suppl 3): Chawdhury SA, Dodson EJ, Dodson GG et al. The crystal structures of three non-pancreatic human insulins. Diabetologia 1983;25: Brogden RN, Heel RC. Human insulin. A review of its biological activity, pharmacokinetics and therapeutic use. Drugs 1987;34(3): Bolli GB, Di Marchi RD, Park GD, Pramming S, Koivisto VA. Insulin analogues and their potential in the management of diabetes mellitus. Diabetologia 1999;42: Binder C, Lauritzen T, Faber O, Pramming S. Insulin pharmokinetics. Diabetes Care 1984;7: Dimitriadis GD, Gerich JE. Importance of timing of preprandial subcutaneous insulin administration in the management of diabetes mellitus. Diabetes Care 1983;6: Brange J, Ribel U, Hansen JF et al. Monomeric insulins obtained by protein engineering and their medical implications. Nature 1988;333: Brange J, Owens DR, Kang S, Volund A. Monomeric insulins and their experimental and clinical implications. Diabetes Care 1990;13: Brems DN, Alter LA, Beckage MJ et al. Altering the association properties of insulin by amino acid replacement. Protein Eng 1992;5: Di Marchi RD, Chance RE, Long HB, Shields JE, Slieker LJ. Preparation of an insulin with improved pharmokinetics relative to human insulin through consideration of structural homology with insulin-like growth factor 1. Horm Res 1994;41(suppl 2):S93-S Radziuk JM, Davis JC, Pye WS et al. Bioavailability and bioeffectiveness of subcutaneous human insulin and two of it s analogues- LysB28, ProB29- human insulin and AspB10, LysB28, ProB29-human insulin-assessed in a conscious pig model. Diabetes 1997;46: Somwar R, Sweeny G, Ramlal T, Klip A. Stimulation of glucose and amino acid transport and activation of the insulin signalling pathways by insulin lispro in L6 skeletal muscle cells. Clin Ther 1998;20: Slieker LJ, Brooke GS, Di Marchi RD et al. Modifications in the B10 and B26-30 regions of the B chain of human insulin alter affinity for the human IGF-1 receptor more than for the insulin receptor. Diabetologia 1997;40(suppl 2):S54-S61. VOLUME 4 ISSUE 1. JANUARY/FEBRUARY
5 Levy&Ahmad P /2/04 14:58 Page Kurtzhals P, Schaffer L, Sorensen A et al. Correlations of receptor binding and metabolic and mitogenic potencies of insulin analogs designed for clinical use. Diabetes 2000;49(6): Glazer NB, Zalani S, Anderson JH Jr, Baastyr EJ 3rd. Safety of insulin lispro: pooled data from clinical trials. Am J Health Syst Pharm 1999;56(6): Howey DC, Bowsher RR, Brunelle RL, Woodworth JR. [Lys(B28), Pro(B29)]-human insulin. A rapidly absorbed analogue of human insulin. Diabetes 1994;43: Davey P, Grainger D, MacMillan J, Rajan N, Aristides M, Gliksman M. Clinical outcomes with insulin lispro compared with human regular insulin: a meta-analysis. Clin Ther 1997;19(4): Anderson JH Jr, Brunelle RL, Koivisto VA et al. Improved mealtime treatment of diabetes mellitus using an insulin analogue. Clin Ther 1997;19: Chase HP, Lockspeiser T, Peery B, Shepherd M, MacKenzie T, Anderson J, Garg SK. The impact of the diabetes control and complications trial and humalog insulin on glycohemoglobin levels and severe hypoglycemia in type 1 diabetes. Diabetes Care 2001;24(3): Del Sindaco P, Ciofetta M, Lalli C et al. Use of the short-acting insulin analogue lispro in intensive treatment of Type 1 diabetes: importance of appropriate replacement of basal insulin and time interval injection meal. Diabetic Medicine 1998;15: Lalli C, Ciofetta M, Del Sindaco P et al. Long-term intensive treatment of type 1 diabetes with the short-acting insulin analogue lispro in variable combination with NPH insulin at mealtime. Diabetes Care 1999;22: Stades AM, Hoekstra JB, van den Tweel I, Erkelens DW, Holleman F Stability Study Group. Additional lunchtime basal insulin during insulin lispro intensive therapy in a randomized, multicenter, crossover study in adults: real-life design. Diabetes Care 2002;25(4): Joseph SE, Korzon-Burakowska A, Woodworth JR et al. The action profile of lispro is not blunted by mixing in the syringe with NPH insulin. Diabetes Care 1998;21: Anderson JH Jr, Brunelle RL, Koivisto VA et al. Reduction in postprandial hyperglycaemia and frequency of hypoglycaemia in IDDM patients on insulin-analog treatment. Diabetes 1997;46: Gale EA. A randomized, controlled trial comparing insulin lispro with human soluble insulin in patients with Type 1 diabetes on intensified insulin therapy. The UK Trial Group. Diabet Med 2000;17(3): Anderson JH Jr, Brunelle RL, Keohane et al. Mealtime treatment with insulin analog improves postprandial hyperglycaemia and hypoglycaemia in patients with non-insulin dependent diabetes mellitus. Arch Int Med 1997;157: Holcombe JH, Zalani S, Arora VK, Mast CJ. Lispro in Adolesecents Study Group. Comparison of insulin lispro with regular human insulin for the treatment of type 1 diabetes in adolescents. Clin Ther 2002;24(4): Heller SR, Ameil SA, Mansell P. Effect of the fast-acting insulin analog lispro on the risk of nocturnal hypoglycemia during intensified insulin therapy. UK Lispro Study Group. Diabetes Care 1999;22(10): Brunelle RL, Llewelyn J, Anderson JH, Gale EAM, Koivisto VA. Metaanalysis of the Effect of Insulin Lispro on Severe Hypoglycaemia in Patients with Type 1 Diabetes. Diabetes Care 1998;21: Launay B, Zinman B, Tildesley HD, Strack T, Chiasson JL. Effect of Continuous Subcutaneous Insulin Infusion With Lispro on Hepatic Responsiveness to Glucagon in Type 1 Diabetes. Diabetes Care 1998;21: Jacobs MA, Salobir B, Popp-Snijders C, Ader H, Heine RJ. Counterregulatory hormone responses and symptoms during hypoglycaemia induced by porcine, human regular insulin and Lys(B28), Pro(B29) human insulin analogue (insulin Lispro) in healthy male volunteers. Diabet Med 1997;14(3): Torlone E, Fanelli C, Rambotti AM et al. Pharmacokinetics, pharmacodynamics and glucose counterregulation following subcutaneous injection of the monomeric insulin analogue [Lys(B28),Pro(B29)] in IDDM. Diabetologia 1994;37: McCrimmon RJ, Frier BM. Symptomatic and physiological responses to hypoglycaemia induced by human soluble insulin and the analogue lispro human insulin. Diabet Med 1997;14: Schernthaner G, Wein W, Sandholzer K et al. Post prandial insulin lispro. A therapeutic option for type 1 diabetic patients. Diabetes Care 1998;21: Kotsanos JG, Vignati L, Huster W et al. Health-related quality-of-life results from multinational clinical trials of insulin lispro. Assessing benefits of a new diabetes therapy. Diabetes Care J 1997;20(6): Bhattacharyya A, Brown S, Hughes S, Vice PA. Insulin Lispro and regular insulin in pregnancy. QJM 2001;94(5): Boskovic R, Feig DS, Derewlany L, Knie B, Portnoi G, Koren G. Transfer of insulin lispro across the human placenta: in vitro perfusion studies. Diabetes Care 2003;26(5): Loukovaara S, Immonen I, Teramo KA, Kaaja R. Progression of retinopathy during pregnancy in type 1 diabetic women treated with insulin lispro. Diabetes Care 2002;26(4): Volund A, Brange J, Drejer K et al. In vitro and in vivo potency of insulin analogues designed for clinical use. Diabet Med 1991;8: Dall V. Preclinical safety pharmacology studies on the rapid-acting insulin analogue insulin aspart. Arzneimittelforschung 1999;49(5): Lindholm A, Jensen LB, Home PD, Raskin P, Boehm BO, Rastam J. Immune responses to insulin aspart and biphasic insulin aspart in people with type 1 and type 2 diabetes. Diabetes Care 2002;25(5): Mudaliar SR, Lindberg FA, Joyce M et al. Insulin aspart (B28 asp-insulin): a fast-acting analog of human insulin: absorption kinetics and action profile compared with regular human insulin in healthy nondiabetic subjects. Diabetes Care 1999;22(9): Kang S, Brange J, Burch A, Volund A, Owens DR. Absorption kinetics and action profiles of subcutaneously administered insulin analogues (AspB9, GluB27; AspB10, AspB28) in healthy subjects. Diabetes Care 1991;14: Raskin P, Guthrie RA, Leiter L, Riis A, Jovanovic L. Use of insulin aspart, a fast-acting insulin analog, as the mealtime insulin in the management of patients with type 1 diabetes. Diabetes Care 2000;23(5): Home PD, Lindholm A, Riis A. Insulin aspart vs human insulin in the management of long-term blood glucose control in Type 1 diabetes mellitus: a randomized controlled trial. Diabet Med 2000;17(11): Frier BM, Ewing FM, Lindholm A, Hylleberg B, Kanc K. Symptomatic and counterregulatory hormonal responses to acute hypoglycaemia induced by insulin aspart and soluble human insulin in Type 1 diabetes. Diabetes Metab Rev 2000;16(4): Brunner GA, Hirschberger S, Sendlhofer G et al. Post-prandial administration of the insulin analogue insulin aspart in patients with Type 1 diabetes. Diabet Med 2000;17(5): Halberg IB, Jacobsen LV, Dahl UL. A study on self-mixing insulin aspart with NPH insulin in the syringe before injection. Diabetes 1999;48(suppl 1):A104 (Abstract). 49. Barnett AH. A review of basal insulins. Diabet Med 2003;20: Perriello G, De Feo P, Torlone E et al. The dawn phenomenon in Type 1 (insulin-dependent) diabetes mellitus: magnitude, frequency, variability, and dependency on glucose counterregulation and insulin sensitivity. Diabetologia 1991;34: Lepore M, Pampanelli S, Fanelli C et al. Pharmacokinetics and pharmacodynamics of subcutaneous injection of long-acting human insulin analog glargine, NPH insulin, and ultralente human insulin and continuous subcutaneous infusion of insulin lispro. Diabetes 2000;49(12): Rosenstock J, Schwartz SL, Clark CM Jr, Park GD, Donley DW, Edward MB. Basal insulin therapy in type 2 diabetes: 28-week comparison of insulin glargine (HOE 901) and NPH insulin. Diabetes Care 2001;24(4): Pieber TR, Eugene-Jolchine I, Derobert E. Efficacy and safety of HOE 901 versus NPH insulin in patients with Type 1 Diabetes. The European Study Group of HOE 901 in type 1 diabetes. Diabetes Care 2000;23(2): Ciaraldi TP, Carter L, Seipke G, Mudaliar S, Henry RR. Effects of the longacting insulin analog insulin glargine on cultured human skeletal muscle cells: comparisons to insulin and IGF-1. J Clin Endocrinol Metab 2001;86(12): Heinemann L, Sinha K, Weyer C, Loftager M, Hirschberger S, Heise T. Time-action profile of the soluble, fatty acid acylated, long acting insulin analogue NN304. Diabet Med 1999;16(4): Vague P, Selam JL, Skeie S et al. Insulin detemir is associated with more predictable glycemic control and reduced risk of hypoglycaemia than NPH insulin in patients with type 1 diabetes on a basal-bolus regimen with premeal insulin aspart. Diabetes Care 2003;26(3): THE BRITISH JOURNAL OF DIABETES AND VASCULAR DISEASE
Basal Insulin Analogues Where are We Now?
232 Medicine Update 41 Basal Insulin Analogues Where are We Now? S CHANDRU, V MOHAN Insulin is a polypeptide secreted by the beta cells of pancreas and consists of 51 amino acids (AA). It has two polypeptide
INSULIN PRODUCTS. Jack DeRuiter
INSULIN PRODUCTS Jack DeRuiter The number and types of insulin preparations available in the United States is constantly changing, thus students should refer to recent drug resources for a current list
The first injection of insulin was given on
EFFECTIVE USE OF INSULIN THERAPY IN TYPE 2 DIABETES * Bernard Zinman, MDCM ABSTRACT Type 2 diabetes is a progressive disease; an individual s ability to secrete insulin in increasing amounts to overcome
Efficacy and Safety of Insulin Aspart in Patients with Type 1 Diabetes Mellitus
Clin Pediatr Endocrinol 2002; 11(2), 87-92 Copyright 2002 by The Japanese Society for Pediatric Endocrinology Original Efficacy and Safety of Insulin Aspart in Patients with Type 1 Diabetes Mellitus Toshikazu
JK SCIENCE. Newer Insulins. Jasleen Kaur, Dinesh K. Badyal
REVIEW ARTICLE Introduction Diabetes is rapidly reaching epidemic proportions, affecting 174 million people worldwide and this number is likely to double by year 2030 (1). Insulins are the mainstay of
Abdulaziz Al-Subaie. Anfal Al-Shalwi
Abdulaziz Al-Subaie Anfal Al-Shalwi Introduction what is diabetes mellitus? A chronic metabolic disorder characterized by high blood glucose level caused by insulin deficiency and sometimes accompanied
Prior Authorization Guideline
Prior Authorization Guideline Guideline: PC - Apidra, Levemir Therapeutic Class: Hormones and Synthetic Substitutes Therapeutic Sub-Class: Antidiabetic Agents Client: CA, CO, NV, OK, OR, WA and AZ Approval
Insulin Lispro - A Review
Introduction Insulin Lispro - A Review Pages with reference to book, From 212 To 214 Zarina Muzaffer ( Pakistan Institute of Medical Sciences, Islamabad. ) Ahmar lqbal ( Eli Lilli Pakistan (Private) Limited,
Insulin: A Powerful Weapon in the Diabetic Arsenal. Diana Cowell, PharmD PGY-1 Pharmacy Resident
Insulin: A Powerful Weapon in the Diabetic Arsenal Diana Cowell, PharmD PGY-1 Pharmacy Resident Objectives Identify the mechanism of action of insulin Describe the onset and duration for the various types
Present and Future of Insulin Therapy: Research Rationale for New Insulins
Present and Future of Insulin Therapy: Research Rationale for New Insulins Current insulin analogues represent an important advance over human insulins, but clinically important limitations of these agents
Insulin therapy in various type 1 diabetes patients workshop
Insulin therapy in various type 1 diabetes patients workshop Bruce H.R. Wolffenbuttel, MD PhD Dept of Endocrinology, UMC Groningen website: www.umcg.net & www.gmed.nl Twitter: @bhrw Case no. 1 Male of
Insulin detemir in the treatment of type 1 and type 2 diabetes
AUTHOR COPY REVIEW Insulin detemir in the treatment of type 1 and type 2 diabetes Jean-Christophe Philips André Scheen Division of Diabetes, Nutrition & Metabolic Disorders, Department of Medicine, CHU
Insulin Therapy. Endocrinologist. H. Delshad M.D. Research Institute For Endocrine Sciences
Insulin Therapy H. Delshad M.D Endocrinologist Research Institute For Endocrine Sciences Primary Objectives of Effective Management A1C % 9 8 Diagnosis SBP mm Hg LDL mg/dl 7 145 130 140 100 Reduction of
IMPROVED METABOLIC CONTROL WITH A FAVORABLE WEIGHT PROFILE IN PATIENTS WITH TYPE 2 DIABETES TREATED WITH INSULIN GLARGINE (LANTUS ) IN CLINICAL
464 IMPROVED METABOLIC CONTROL WITH A FAVORABLE WEIGHT PROFILE IN PATIENTS WITH TYPE 2 DIABETES TREATED WITH INSULIN GLARGINE (LANTUS ) IN CLINICAL PRACTICE STEPHAN A SCHREIBER AND ANIKA RUßMAN ABSTRACT
DRUGS FOR GLUCOSE MANAGEMENT AND DIABETES
Page 1 DRUGS FOR GLUCOSE MANAGEMENT AND DIABETES Drugs to know are: Actrapid HM Humulin R, L, U Penmix SUNALI MEHTA The three principal hormones produced by the pancreas are: Insulin: nutrient metabolism:
CLASS OBJECTIVES. Describe the history of insulin discovery List types of insulin Define indications and dosages Review case studies
Insulins CLASS OBJECTIVES Describe the history of insulin discovery List types of insulin Define indications and dosages Review case studies INVENTION OF INSULIN 1921 The first stills used to make insulin
Scottish Medicines Consortium
Scottish Medicines Consortium insulin glulisine for subcutaneous injection 100 units/ml (Apidra ) No. (298/06) Sanofi Aventis 4 August 2006 The Scottish Medicines Consortium (SMC) has completed its assessment
Insulin Therapy in Type 1 Diabetes
S32 Insulin Therapy in Type 1 Diabetes Canadian Diabetes Association Clinical Practice Guidelines Expert Committee INTRODUCTION Insulin therapy remains the mainstay of treatment for type 1 diabetes mellitus.
10 to 30 minutes ½ to 3 hours 3 to 5 hours. 30 60 minutes 1 to 5 hours 8 hours. 1 to 4 hours
Insulin Action There are several types of insulin. They are classified by how long they act: very fast, fast, slow and very slow acting. Each type of insulin has a certain time period in which it works.
Insulin onset, peak and duration of action
Insulin onset, peak and duration of action Insulin was first discovered in the early 190 s. Before then, diabetes could not be treated. Insulin was then taken from cow and pig pancreases, but nearly all
Intensive Insulin Therapy in Diabetes Management
Intensive Insulin Therapy in Diabetes Management Lillian F. Lien, MD Medical Director, Duke Inpatient Diabetes Management Assistant Professor of Medicine Division of Endocrinology, Metabolism, & Nutrition
Initiation and Adjustment of Insulin Regimens for Type 2 Diabetes
PL Detail-Document #300128 This Detail-Document accompanies the related article published in PHARMACIST S LETTER / PRESCRIBER S LETTER January 2014 Initiation and Adjustment of Insulin Regimens for Type
INSULIN THERAPY FOR CHILDREN AND ADOLESCENTS WITH TYPE 1 DIABETES
INSULIN THERAPY FOR CHILDREN AND ADOLESCENTS WITH TYPE 1 DIABETES Young Jun Rhie, M.D. Department of Pediatrics Korea University Ansan Hospital Introduction 1 Children and adolescents with type 1 diabetes
Insulin initiation in type 2 diabetes: Experience and insights
Insulin initiation in type 2 diabetes: Experience and insights Joan Everett A diagnosis of type 2 diabetes can be devastating for the individual and their family. Furthermore, many people with diabetes
Intensifying Insulin Therapy
Intensifying Insulin Therapy Rick Hess, PharmD, CDE, BC-ADM Associate Professor Gatton College of Pharmacy, Department of Pharmacy Practice East Tennessee State University Johnson City, Tennessee Learning
Therapy Insulin Practical guide to Health Care Providers Quick Reference F Diabetes Mellitus in Type 2
Ministry of Health, Malaysia 2010 First published March 2011 Perkhidmatan Diabetes dan Endokrinologi Kementerian Kesihatan Malaysia Practical guide to Insulin Therapy in Type 2 Diabetes Mellitus Quick
Insulin Algorithm for Type 2 Diabetes Mellitus in Children and Adults
Insulin Algorithm for Type 2 Diabetes Mellitus in Children and Adults Stock # 45-11647 Revised 10/28/10 Glycemic Goals 1,2 Individualize goal based on patient risk factors A1c 6%
INJEX Self Study Program Part 1
INJEX Self Study Program Part 1 What is Diabetes? Diabetes is a disease in which the body does not produce or properly use insulin. Diabetes is a disorder of metabolism -- the way our bodies use digested
Insulin Therapy In Type 2 DM. Sources of support. Agenda. Michael Fischer, M.D., M.S. The underuse of insulin Insulin definition and types
Insulin Therapy In Type 2 DM Michael Fischer, M.D., M.S. Sources of support NaRCAD is supported by a grant from the Agency for Healthcare Research and Quality My current research projects are funded by
INSULIN ALGORITHM FOR TYPE 2 DIABETES MELLITUS IN CHILDREN 1 AND ADULTS
Publication # 45-11647 Targets*
INSULIN AND INCRETIN THERAPIES: WHAT COMBINATIONS ARE RIGHT FOR YOUR PATIENT?
INSULIN AND INCRETIN THERAPIES: WHAT COMBINATIONS ARE RIGHT FOR YOUR PATIENT? MARTHA M. BRINSKO, MSN, ANP-BC CHARLOTTE COMMUNITY HEALTH CLINIC CHARLOTTE, NC Diagnosed and undiagnosed diabetes in the United
INSULIN TREATMENT FOR TYPE 2 DIABETES MANAGEMENT
INSULIN TREATMENT FOR TYPE 2 DIABETES MANAGEMENT APIRADEE SRIWIJITKAMOL DIVISION OF ENDOCRINOLOGY AND METABOLISM DEPARTMENT OF MEDICINE FACULTY OF MEDICINE SIRIRAJ HOSPITOL QUESTION 1 1. ท านเคยเป นแพทย
Diabetes mellitus 1 عبد هللا الزعبي. pharmacology. Shatha Khalil Shahwan. 1 P a g e
Diabetes mellitus 1 pharmacology عبد هللا الزعبي 1 P a g e 4 Shatha Khalil Shahwan Diabetes mellitus The goals of the treatment of diabetes 1. Treating symptoms 2. Treating and Preventing acute complications
There seem to be inconsistencies regarding diabetic management in
Society of Ambulatory Anesthesia (SAMBA) Consensus Statement on Perioperative Blood Glucose Management in Diabetic Patients Undergoing Ambulatory Surgery Review of the consensus statement and additional
Evolution of Insulin Development: Focus on Key Parameters
Adv Ther (2012) 29(7):590 619. DOI 10.1007/s12325-012-0034-8 REVIEW Evolution of Insulin Development: Focus on Key Parameters Joseph M. Tibaldi To view enhanced content go to www.advancesintherapy.com
Insulin T Y P E 1 T Y P E 2
T Y P E 1 T Y P E 2 INSULIN There are many different insulins for many different situations and lifestyles. This section should help you and your doctor decide which insulin or insulins are best for you.
Diabetes: When To Treat With Insulin and Treatment Goals
Diabetes: When To Treat With Insulin and Treatment Goals Lanita. S. White, Pharm.D. Director, UAMS 12 th Street Health and Wellness Center Assistant Professor of Pharmacy Practice, UAMS College of Pharmacy
MANAGEMENT OF TYPE - 1 DIABETES MELLITUS
MANAGEMENT OF TYPE - 1 DIABETES MELLITUS INVESTIGATIONS AND TREATMENT MANSI NAIK VII SEMESTER INVESTIGATIONS FASTING BLOOD SUGAR PLASMA GLUCOSE HEMOGLOBIN A 1c SYMPTOMS OF TYPE 1 DIABETES MELLITUS Polyuria
Insulin: Breaking Barriers Enhancing Therapies. Jerry Meece, RPh, FACA, CDE [email protected]
Insulin: Breaking Barriers Enhancing Therapies Jerry Meece, RPh, FACA, CDE [email protected] Questions To Address Who are candidates for insulin? When do we start insulin? How do the different types of
Adocia reports positive results from phase IIa clinical study of ultra-fast acting BioChaperone Lispro
PRESS RELEASE Adocia reports positive results from phase IIa clinical study of ultra-fast acting BioChaperone Lispro BioChaperone Lispro is significantly faster than Humalog in type I diabetic patients;
Most patients with T2DM will eventually require insulin therapy. ADA Glycemic Control Targets. What are some of the obstacles?
ADA Glycemic Control Targets A1C < 7% Preprandial plasma glucose 70-130 mg/dl Postprandial plasma glucose (PPG)
education Insulin delivery devices Paper Current insulin preparations Discovery of insulin and key developments in preparations
Paper 2009 Royal College of Physicians of Edinburgh Insulin delivery devices 1 AJ Graveling, 2 EA McIntyre 1 Specialty Registrar; 2 Consultant, Department of Diabetes & Endocrinology, Monklands Hospital,
Pump Therapy Indications:
Insulin Pumping Getting Started March 7, 2008 Clinical Pearls To understand the rational behind pump therapy To explore patient preferences for and against insulin pump therapy Realistic expectations for
EASD/ADA 2015 Highlights- insulin. Dr Jarl Hellman
EASD/ADA 2015 Highlights- insulin Dr Jarl Hellman Innehåll NPH Epidemiologi Nya insuliner Basinsulinets bäste vän exklusive hund och UKPDS? G.B Bolli Hypoglykemi - NPH Exogenous insulin and risk of all-cause
TYPE 2 DIABETES SEQUENTIAL INSULIN STRATEGIES
TYPE 2 DIABETES SEQUENTIAL INSULIN STRATEGIES Non-insulin regimes Basal insulin only (usually with oral agents) Number of injections 1 Regimen complexity Low Basal insulin +1 meal-time rapidacting insulin
Diabetes Mellitus. Melissa Meredith M.D. Diabetes Mellitus
Melissa Meredith M.D. Diabetes mellitus is a group of metabolic diseases characterized by high blood glucose resulting from defects in insulin secretion, insulin action, or both Diabetes is a chronic,
Insulin detemir versus insulin glargine for type 2 diabetes mellitus (Review)
Insulin detemir versus insulin glargine for type 2 diabetes mellitus (Review) Swinnen SG, Simon ACR, Holleman F, Hoekstra JB, DeVries JH This is a reprint of a Cochrane review, prepared and maintained
Management of Diabetes Mellitus with Insulin Lispro
Clinical Medicine Insights: Therapeutics Review Open Access Full open access to this and thousands of other papers at http://www.la-press.com. Management of Diabetes Mellitus with Insulin Lispro Masami
Glycemic Control Initiative: Insulin Order Set Changes Hypoglycemia Nursing Protocol
Glycemic Control Initiative: Insulin Order Set Changes Hypoglycemia Nursing Protocol Ruth LaCasse Kalish, RPh Department of Pharmacy Objectives Review the current practice at UConn Health with sliding
Insulin Initiation and Intensification
Insulin Initiation and Intensification ANDREW S. RHINEHART, MD, FACP, CDE MEDICAL DIRECTOR AND DIABETOLOGIST JOHNSTON MEMORIAL DIABETES CARE CENTER Objectives Understand the pharmacodynamics and pharmacokinetics
Guideline on non-clinical and clinical development of similar biological medicinal products containing recombinant human insulin and insulin analogues
26 February 2015 EMEA/CHMP/BMWP/32775/2005_Rev. 1 Committee for Medicinal products for Human Use (CHMP) Guideline on non-clinical and clinical development of similar biological medicinal products containing
Cochrane Quality and Productivity topics
Long-acting insulin analogues versus NPH insulin (human isophane insulin) for type 2 diabetes mellitus NICE has developed the Cochrane Quality and Productivity (QP) topics to help the NHS identify practices
The basal plus strategy. Denis Raccah, MD, PhD Professor of Medicine University Hospital Sainte Marguerite Marseille FRANCE
The basal plus strategy Denis Raccah, MD, PhD Professor of Medicine University Hospital Sainte Marguerite Marseille FRANCE ADA/EASD guidelines recommend use of basal insulin as early as the second step
INSULINThere are. T y p e 1 T y p e 2. many different insulins for
T y p e 1 T y p e 2 INSULINThere are many different insulins for Characteristics The three characteristics of insulin are: Onset. The length of time before insulin reaches the bloodstream and begins lowering
Medical Policy An independent licensee of the Blue Cross Blue Shield Association
Afrezza Page 1 of 6 Medical Policy An independent licensee of the Blue Cross Blue Shield Association Title: Afrezza (human insulin) Prime Therapeutics will review Prior Authorization requests Prior Authorization
SHORT CLINICAL GUIDELINE SCOPE
NATIONAL INSTITUTE FOR HEALTH AND CLINICAL EXCELLENCE SHORT CLINICAL GUIDELINE SCOPE 1 Guideline title Type 2 diabetes: newer agents for blood glucose control in type 2 diabetes 1.1 Short title Type 2
PANCREATIC HORMONES, ANTIDIABETIC AGENTS: INSULIN AND ORAL ANTIDIABETICS- handout Iwona Zaporowska-Stachowiak
PANCREATIC HORMONES, ANTIDIABETIC AGENTS: INSULIN AND ORAL ANTIDIABETICS- handout Iwona Zaporowska-Stachowiak The endocrine pancreas (the islets of Langerhans) consists of four types of endocrine cells:
Diabetes Fundamentals
Diabetes Fundamentals Prevalence of Diabetes in the U.S. Undiagnosed 10.7% of all people 20+ 23.1% of all people 60+ (12.2 million) Slide provided by Roche Diagnostics Sources: ADA, WHO statistics Prevalence
Lipodystrophy: Metabolic and Clinical Aspects. Resource Room Slide Series
Lipodystrophy: Metabolic and Clinical Aspects Resource Room Slide Series Current Thinking About the Diagnosis and Treatment of the Insulin-Resistant State: How to Use Insulin Therapy Irl B. Hirsch, MD
NCT00272090. sanofi-aventis HOE901_3507. insulin glargine
These results are supplied for informational purposes only. Prescribing decisions should be made based on the approved package insert in the country of prescription Sponsor/company: Generic drug name:
PERIOPERATIVE INSULIN MANAGEMENT
G E N E R A L A N A E S T H E S I A Tutorial 327 PERIOPERATIVE INSULIN MANAGEMENT Dr. Jeffrey B Dobyns, DO, CMQ Assistant Professor of Anesthesiology and Perioperative Medicine Associate Medical Director,
Managing the risks of commencing insulin therapy for patients with type 2 diabetes
Managing the risks of commencing insulin therapy for patients with type 2 diabetes Laila King June 213 213 The Health Foundation Insulin is a remedy primarily for the wise, and not for the foolish, whether
Nursing 113. Pharmacology Principles
Nursing 113 Pharmacology Principles 1. The study of how drugs enter the body, reach the site of action, and are removed from the body is called a. pharmacotherapeutics b. pharmacology c. pharmacodynamics
ETIOLOGIC CLASSIFICATION. Type I diabetes Type II diabetes
DIABETES MELLITUS DEFINITION It is a common, chronic, metabolic syndrome characterized by hyperglycemia as a cardinal biochemical feature. Resulting from absolute lack of insulin. Abnormal metabolism of
Insulin Pump Therapy and Continuous Glucose Sensor Use in the Management of Diabetes Mellitus
Insulin Pump Therapy and Continuous Glucose Sensor Use in the Management of Diabetes Mellitus Louis Haenel, IV, DO, FACOI, FACE Endocrinology Roper Hospital Charleston, SC Dr. Louis Haenel IV has disclosed
Review INSULIN ANALOGS AND INTENSIVE INSULIN THERAPY IN TYPE 1 DIABETES Ved V. Gossain
Review INSULIN ANALOGS AND INTENSIVE INSULIN THERAPY IN TYPE 1 DIABETES Ved V. Gossain ABSTRACT Unless contraindicated, intensive insulin therapy should be the treatment of choice for patients with type
Workshop A Tara Kadis
Workshop A Tara Kadis Considerations/barriers in decision making about insulin verses GLP-1 use in people with type 2 diabetes Which Insulin regimes should we consider? Diabetes is a progressive multi-system
Chapter 8 Insulin: Types and Activit y
Chapter 8 Insulin: Types and Activit y H. Peter Chase, MD Satish Garg, MD INSULIN Before insulin was discovered in 1921, there was little help for people who had type 1 diabetes. Since then, millions of
Discovery and history of Insulin
Discovery and history of Insulin In Germany, Oskar Minkowski and Joseph von Mering observed that total pancreatectomy in experimental animals leads to the development of severe diabetes mellitus and begun
Insulin: A Practice Update. Department of Nursing Staff Development Elizabeth Borgelt, MS, RN
Insulin: A Practice Update Department of Nursing Staff Development Elizabeth Borgelt, MS, RN Learning Outcome The learner will be able to identify the different types of insulins available, their actions,
INSULIN GLARGINE CHEMISTRY AND PHARMACOLOGY
CHAPTER 2 INSULIN GLARGINE CHEMISTRY AND PHARMACOLOGY OVERVIEW 27 MOLECULAR CHEMISTRY OF INSULIN GLARGINE 28 Insulin glargine hexamerization 29 Insulin glargine exists as a solution at ph 4 3 PRE-CLINICAL
Insulin. Regimens Characteristics / categorization Pharmacokinetics / pharmacodynamics Adverse effects Compatibility Costs
Insulin Regimens Characteristics / categorization Pharmacokinetics / pharmacodynamics Adverse effects Compatibility Costs Insulins Rapid-acting Inhaled Short-acting Basal/ Intermediate Basal Pre-mixed
