Basics on bioinformatics Lecture 2. Nunzio D Agostino

Save this PDF as:

Size: px
Start display at page:

Download "Basics on bioinformatics Lecture 2. Nunzio D Agostino;"


1 Basics on bioinformatics Lecture 2 Nunzio D Agostino

2 Database or databank? Initially o Databank(UK) o Database(USA) Solution The abbreviation db 2

3 Entity-Relationship(ER) modeling Notation uses three main constructs: o Data entities Represents a set or collection of objects in the real world that share the same properties. Person, place, object, event or concept about which data is to be maintained. o Attributes Named property or characteristic of an entity o Relationships Association between the instances of one or more entity types Relationships can be classified as either one to one 11 one to many 1N many to many NN Connectivity 3

4 Cardinality 1 : 1 1 : N N: M 4

5 ER example 5

6 database: basic structure Gi Accession Length Cultivar Dev.stag Tissue sequence CD Turning stage of fruit ripening Pericarp GTACTCCTAAAC BI TA days old callus CCACAACCACA AJ West Virginia dayspost anthesis fruit CAAATTTA.. Databases are composed of tables of data. Tables hold logically related sets of data. A table is essentially the same thing as a spreadsheet: a set of rows and columns 6

7 database: basic structure Gi Accession Length Cultivar Dev.stag Tissue sequence CD Turning stage of fruit ripening Pericarp GTACTCCTAAAC BI TA days old callus CCACAACCACA AJ West Virginia dayspost anthesis fruit CAAATTTA.. Each table has several records or entries : a record stores all the information for a given individual Records are therowsof a data table 7

8 database: basic structure Gi Accession Length Cultivar Dev.stag Tissue sequence CD Turning stage of fruit ripening Pericarp GTACTCCTAAAC BI TA days old callus CCACAACCACA AJ West Virginia dayspost anthesis fruit CAAATTTA.. Each record has several fields: A field is an individual piece of data, a single attribute of the record. Fields are thecolumnsof a data table 8

9 database: basic structure Gi Accession Length Cultivar Dev.stag Tissue sequence CD Turning stage of fruit ripening Pericarp GTACTCCTAAAC BI TA days old callus CCACAACCACA AJ West Virginia dayspost anthesis fruit CAAATTTA.. Each record (row) has a unique identifier, the primary key. the primary key serves to identify the data stored in this record across all the tables in the database. Databases are manipulated with a language called SQL (Structured Query Language). It s a baby English type of language: uses real words,butrigidintermsoftheorderandplacement. Various database software: Oracle, MS Access, MySQL, etc. 9

10 Why biological databases? omake biological data available to scientists Consolidation of data(gather data from different sources) Provide access to large dataset that cannot be published explicitly(genome, ) omake biological data available in computer-readable format Make data accessible for automated analysis 10

11 Biological db o Vary in size, quality, coverage, level of interest o Many of the major ones covered in the annual Database Issue of Nucleic Acids Research

12 Biological db 12

13 Biological db 13

14 What makes a good db? o comprehensiveness o accuracy o is up-to-date o good interface o batch search/download o API (web services, DAS, etc.) 14

15 must have item when using db o Remember the server, the database, and the program version used o Write down sequence identification numbers o Databases are not like good wine (use up-to-date builds) o Use local installs when it becomes necessary 15

16 Primary and derived data Primary databases: Databases consisting of data derived experimentally such as nucleotide sequences and three dimensional structures. Secondary databases: Those data that are derived from the analysis or treatment of primary data 16

17 Nucleotide sequence databases GenBank The 3 databases are synchronized on a daily basis, and the accession numbers are consistent. There are no legal restriction in the usage of these databases. However, there are some patented sequences in the database 17

18 GenBank sample record LOCUS AF bp DNA linear BCT 19-AUG-1999 DEFINITION Pseudomonas fluorescens ECF sigma factor SigX (sigx) gene, complete cds. ACCESSION AF VERSION AF GI: KEYWORDS. SOURCE Pseudomonas fluorescens. ORGANISM Pseudomonas fluorescens Bacteria; Proteobacteria; gamma subdivision; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 591) AUTHORS Brinkman,F.S., Schoofs,G., Hancock,R.E. and De Mot,R. TITLE Influence of a putative ECF sigma factor on expression of the major outer membrane protein, OprF, in Pseudomonas aeruginosa and Pseudomonas fluorescens JOURNAL J. Bacteriol. 181 (16), (1999) MEDLINE PUBMED REFERENCE 2 (bases 1 to 591) AUTHORS De Mot,R. TITLE Direct Submission JOURNAL Submitted (04-DEC-1998) F.A. Janssens Laboratory of Genetics, Applied Plant Sciences, K. Mercierlaan 92, Heverlee B-3001, Belgium FEATURES Location/Qualifiers source /organism="pseudomonas fluorescens" /strain="m114" /db_xref="taxon:294" gene /gene="sigx" CDS /gene="sigx" /codon_start=1 /transl_table=11 /product="ecf sigma factor SigX" /protein_id="aad " /db_xref="gi: " /translation="mnkaqtlstrydprelsdeelvarshtelfhvtrayeelmrryq RTLFNVCARYLGNDRDADDVCQEVMLKVLYGLKNLEGKSKFKTWLYSITYNECITQYR KERRKRRLMDALSLDPLEEASEEKALQPEEKGGLDRWLVYVNPIDRGILVLRFVAELE FQEIADIMHMGLSATKMRYKRALDKLREKFAGETET" BASE COUNT 157 a 133 c 170 g 131 t ORIGIN 1 atgaataaag cccaaacgct atccacgcgc tacgaccccc gcgagctctc tgatgaggag 61 ttggtcgcgc gctcgcatac cgagcttttt cacgtaacgc gcgcctatga agaactgatg 121 cggcgttacc agcgaacatt atttaacgtt tgtgcgagat atcttgggaa cgatcgcgac 181 gcagacgatg tctgtcagga agtcatgttg aaggtgctgt atggcctgaa gaacctcgag 241 gggaaatcga agttcaaaac gtggctctac agcatcacgt acaacgaatg tattacgcag 301 tatcggaagg aacggcgaaa gcgtcgcttg atggacgcat tgagtcttga ccccctcgag 361 gaagcgtccg aagaaaaggc gcttcaaccc gaggagaagg gcgggcttga tcgctggctg 421 gtgtatgtga acccgattga ccgtggaatt ctggtgcttc gatttgtcgc agagctggaa 481 tttcaggaga tcgcagacat catgcacatg ggtttgagtg cgacaaaaat gcgttacaaa 541 cgtgctctag ataaattgcg tgagaaattt gcaggcgaga ctgaaactta g header features sequence title taxonomy citation 18

19 Protein sequence database The mission of UniProt is to provide the scientific community with a comprehensive, high-quality and freely accessible resource of protein sequence and functional information. UniprotKB Knowledgebase is the central hub for the collection of functional information on proteins, with accurate, consistent and rich annotation. Swiss-Prot, which is manually annotated and reviewed. TrEMBL, which is automatically annotated and is not reviewed. The UniProtReference Clusters (UniRef), which is used to speed up sequence similarity searches. 19

20 UniProt entry 20

21 Protein data bank The PDB archive contains information about experimentally determined structures of proteins, nucleic acids, and complex assemblies.(xray, NMR, Computationally predicted) Mission: maintain a single archive of macromolecular structural data that is freely and openly available to the global community Number of Structures Available 21

22 PDB entry 22

23 Protein structure levels 23

24 The gene Ontology (GO) GO goals The GO Website 24

25 The gene Ontology (GO) GO is divided in 3 domain (levels of annotation): omolecular function - basic activities of a gene product at the molecular level o Biological process - set of molecular events with a defined beginning and an end o Cellular component - the parts of a cell or its extracellular environment 25

26 GO structure The structure of GO can be described in terms of direct acyclic graph (DAG), where each GO term is a node, and the relationships between the terms are arcs between the nodes nucleus chromosome mitochondrion part_of Is_a part_of Nuclear chromosome mitochondrial chromosome GO currently has 2 relationship types: Is_a An is_achild of a parent means that the child is a complete type of its parent, but can be discriminated in some way from other children of the parent. Part_of A part_ofchild of a parent means that the child is always a constituent of the parent that in combination with other constituents of the parent make up the parent. 26

27 Searching for papers

28 Querying GenBank Search from the Entrezmain page the gene whose accession number is BC o How many results we get in the Gene db? o What is the official name of the gene? Other possible names? o On which DNA strand is it located? o How many variants of splicing it has? o Which disease is the gene associated to? o Is it involved in the apoptosis process? o How long is the coding sequence of the first variant of slicing? 28

29 Querying GenBank NG_

30 What kind of molecule is it? Genomic DNA Querying GenBank 30

31 Querying GenBank Where is locate the promoter of the gene HBB? Upstream the nucleotide

32 Querying GenBank Indicate the number of exons= Indicate the length of the second exon= Indicate the number of introns = Indicate the length of the first intron= = 223 nts = 132 nts 32

33 Querying GenBank Indicate the location of the 5 'UTR = Indicate the length of the 5 'UTR = Indicate the location of the 3 'UTR = Indicate the length of the 3 'UTR = = 50 nts = 132 nts 33

34 Querying GenBank Indicate the nucleotide positions of the start codon = 70595,70596,

35 Querying GenBank Download in FASTA format the sequence of the HBB gene 35

36 Querying GenBank

37 Querying GenBank 37


39 Querying GenBank 39

40 Querying GenBank: link to geneid 40

41 Querying PUBMED How many articles did Nunzio D Agostino publish? 41

42 Querying PUBMED How many articles did Nunzio D Agostino publish? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] 42

43 Querying PUBMED How many articles did Nunzio D Agostino publish? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] How manyof theseare reletedto EST? 43

44 Querying PUBMED How many articles did Nunzio D Agostino publish? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] How manyof theseare reletedto EST? D'Agostino, Nunzio[Full Author Name] AND EST [Title/Abstract] 44

45 Querying PUBMED How many articles did Nunzio D Agostino publish? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] How manyof theseare reletedto EST? D'Agostino, Nunzio[Full Author Name] AND EST [Title/Abstract] How manyof theseare on the BMC GenomicsJournal? 45

46 Querying PUBMED How many articles did Nunzio D Agostino publish? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] How manyof theseare reletedto EST? D'Agostino, Nunzio[Full Author Name] AND EST [Title/Abstract] How manyof theseare on the BMC GenomicsJournal? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] AND BMC Genomics [journal] 46

47 Querying PUBMED How many articles did Nunzio D Agostino publish? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] How manyof theseare reletedto EST? D'Agostino, Nunzio[Full Author Name] AND EST [Title/Abstract] How manyof theseare on the BMC GenomicsJournal? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] AND BMC Genomics [journal] How many articles do include the word RNA-Seq in the title? 47

48 Querying PUBMED How many articles did Nunzio D Agostino publish? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] How manyof theseare reletedto EST? D'Agostino, Nunzio[Full Author Name] AND EST [Title/Abstract] How manyof theseare on the BMC GenomicsJournal? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] AND BMC Genomics [journal] How manyarticlesin PubMEDdo include the word RNA-Seq in the title? RNA-Seq[title] 48

49 Querying PUBMED How many articles did Nunzio D Agostino publish? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] How manyof theseare reletedto EST? D'Agostino, Nunzio[Full Author Name] AND EST [Title/Abstract] How manyof theseare on the BMC GenomicsJournal? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] AND BMC Genomics [journal] How manyarticlesin PubMEDdo include the word RNA-Seq in the title? RNA-Seq[title] How many reviews have been published in 2008 containing the word "transcriptome? 49

50 Querying PUBMED How many articles did Nunzio D Agostino publish? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] How manyof theseare reletedto EST? D'Agostino, Nunzio[Full Author Name] AND EST [Title/Abstract] How manyof theseare on the BMC GenomicsJournal? D'Agostino, Nunzio[Full Author Name] OR D Agostino, Nunzio[Full Author Name] AND BMC Genomics [journal] How manyarticlesin PubMEDdo include the word RNA-Seq in the title? RNA-Seq[title] How many reviews have been published in 2008 containing the word "transcriptome? transcriptome[title] AND review [Publication Type] AND 2008[publication date] 50

GenBank, Entrez, & FASTA

GenBank, Entrez, & FASTA GenBank, Entrez, & FASTA Nucleotide Sequence Databases First generation GenBank is a representative example started as sort of a museum to preserve knowledge of a sequence from first discovery great repositories,

More information

Lecture Outline. Introduction to Databases. Introduction. Data Formats Sample databases How to text search databases. Shifra Ben-Dor Irit Orr

Lecture Outline. Introduction to Databases. Introduction. Data Formats Sample databases How to text search databases. Shifra Ben-Dor Irit Orr Introduction to Databases Shifra Ben-Dor Irit Orr Lecture Outline Introduction Data and Database types Database components Data Formats Sample databases How to text search databases What units of information

More information

Biological Sequence Data Formats

Biological Sequence Data Formats Biological Sequence Data Formats Here we present three standard formats in which biological sequence data (DNA, RNA and protein) can be stored and presented. Raw Sequence: Data without description. FASTA

More information

Genome and DNA Sequence Databases. BME 110/BIOL 181 CompBio Tools Todd Lowe March 31, 2009

Genome and DNA Sequence Databases. BME 110/BIOL 181 CompBio Tools Todd Lowe March 31, 2009 Genome and DNA Sequence Databases BME 110/BIOL 181 CompBio Tools Todd Lowe March 31, 2009 Admin Reading: Chapters 1 & 2 Notes available in PDF format on-line (see class calendar page):

More information

Tutorial. Getting started with Ensembl Module 1 Introduction

Tutorial. Getting started with Ensembl  Module 1 Introduction Tutorial Getting started with Ensembl Ensembl provides genes and other annotation such as regulatory regions, conserved base pairs across species, and mrna protein mappings to the genome.

More information

Just the Facts: A Basic Introduction to the Science Underlying NCBI Resources

Just the Facts: A Basic Introduction to the Science Underlying NCBI Resources 1 of 8 11/7/2004 11:00 AM National Center for Biotechnology Information About NCBI NCBI at a Glance A Science Primer Human Genome Resources Model Organisms Guide Outreach and Education Databases and Tools

More information

Biological Databases and Protein Sequence Analysis

Biological Databases and Protein Sequence Analysis Biological Databases and Protein Sequence Analysis Introduction M. Madan Babu, Center for Biotechnology, Anna University, Chennai 25, India Bioinformatics is the application of Information technology to

More information


SICKLE CELL ANEMIA & THE HEMOGLOBIN GENE TEACHER S GUIDE AP Biology Date SICKLE CELL ANEMIA & THE HEMOGLOBIN GENE TEACHER S GUIDE LEARNING OBJECTIVES Students will gain an appreciation of the physical effects of sickle cell anemia, its prevalence in the population,

More information

Bioinformatics Grid - Enabled Tools For Biologists.

Bioinformatics Grid - Enabled Tools For Biologists. Bioinformatics Grid - Enabled Tools For Biologists. What is Grid-Enabled Tools (GET)? As number of data from the genomics and proteomics experiment increases. Problems arise for the current sequence analysis

More information

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison

RETRIEVING SEQUENCE INFORMATION. Nucleotide sequence databases. Database search. Sequence alignment and comparison RETRIEVING SEQUENCE INFORMATION Nucleotide sequence databases Database search Sequence alignment and comparison Biological sequence databases Originally just a storage place for sequences. Currently the

More information

Introduction to Bioinformatics. What are the goals of the course? Who is taking this course? Different user needs, different approaches

Introduction to Bioinformatics. What are the goals of the course? Who is taking this course? Different user needs, different approaches Introduction to Bioinformatics Who is taking this course? Monday, November 19, 2012 Jonathan Pevsner Bioinformatics M.E:800.707 People with very diverse backgrounds in biology

More information

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want

When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want 1 When you install Mascot, it includes a copy of the Swiss-Prot protein database. However, it is almost certain that you and your colleagues will want to search other databases as well. There are very

More information December 16, 2015 org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank accession numbers. December 16, 2015 org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank accession numbers. December 16, 2015 org.rn.egaccnum Map Entrez Gene identifiers to GenBank Accession Numbers org.rn.egaccnum is an R object that contains mappings between Entrez Gene identifiers and GenBank

More information

Bioinformatics Resources at a Glance

Bioinformatics Resources at a Glance Bioinformatics Resources at a Glance A Note about FASTA Format There are MANY free bioinformatics tools available online. Bioinformaticists have developed a standard format for nucleotide and protein sequences

More information

Using the NCBI Genome Databases to Compare the Genes for Human & Chimpanzee Beta Hemoglobin

Using the NCBI Genome Databases to Compare the Genes for Human & Chimpanzee Beta Hemoglobin Using the NCBI Genome Databases to Compare the Genes for Human & Chimpanzee Beta Hemoglobin Author(s) :Susan Offner Source: The American Biology Teacher, 72(4):252-256. 2010. Published By: National Association

More information

Module 1. Sequence Formats and Retrieval. Charles Steward

Module 1. Sequence Formats and Retrieval. Charles Steward The Open Door Workshop Module 1 Sequence Formats and Retrieval Charles Steward 1 Aims Acquaint you with different file formats and associated annotations. Introduce different nucleotide and protein databases.

More information

Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011

Sequence Formats and Sequence Database Searches. Gloria Rendon SC11 Education June, 2011 Sequence Formats and Sequence Database Searches Gloria Rendon SC11 Education June, 2011 Sequence A is the primary structure of a biological molecule. It is a chain of residues that form a precise linear

More information

Bioinformatics: Network Analysis

Bioinformatics: Network Analysis Bioinformatics: Network Analysis Molecular Cell Biology: A Brief Review COMP 572 (BIOS 572 / BIOE 564) - Fall 2013 Luay Nakhleh, Rice University 1 The Tree of Life 2 Prokaryotic vs. Eukaryotic Cell Structure

More information

Genomes and SNPs in Malaria and Sickle Cell Anemia

Genomes and SNPs in Malaria and Sickle Cell Anemia Genomes and SNPs in Malaria and Sickle Cell Anemia Introduction to Genome Browsing with Ensembl Ensembl The vast amount of information in biological databases today demands a way of organising and accessing

More information

A Tutorial in Genetic Sequence Classification Tools and Techniques

A Tutorial in Genetic Sequence Classification Tools and Techniques A Tutorial in Genetic Sequence Classification Tools and Techniques Jake Drew Data Mining CSE 8331 Southern Methodist University Sequence Characters IUPAC nucleotide

More information

Searching Nucleotide Databases

Searching Nucleotide Databases Searching Nucleotide Databases 1 When we search a nucleic acid databases, Mascot always performs a 6 frame translation on the fly. That is, 3 reading frames from the forward strand and 3 reading frames

More information



More information

FlipFlop: Fast Lasso-based Isoform Prediction as a Flow Problem

FlipFlop: Fast Lasso-based Isoform Prediction as a Flow Problem FlipFlop: Fast Lasso-based Isoform Prediction as a Flow Problem Elsa Bernard Laurent Jacob Julien Mairal Jean-Philippe Vert September 24, 2013 Abstract FlipFlop implements a fast method for de novo transcript

More information

GC3 Use cases for the Cloud

GC3 Use cases for the Cloud GC3: Grid Computing Competence Center GC3 Use cases for the Cloud Some real world examples suited for cloud systems Antonio Messina Trieste, 24.10.2013 Who am I System Architect

More information

DNA Sequence formats

DNA Sequence formats DNA Sequence formats [Plain] [EMBL] [FASTA] [GCG] [GenBank] [IG] [IUPAC] [How Genomatix represents sequence annotation] Plain sequence format A sequence in plain format may contain only IUPAC characters

More information

ID of alternative translational initiation events. Description of gene function Reference of NCBI database access and relative literatures

ID of alternative translational initiation events. Description of gene function Reference of NCBI database access and relative literatures Data resource: In this database, 650 alternatively translated variants assigned to a total of 300 genes are contained. These database records of alternative translational initiation have been collected

More information

The Steps. 1. Transcription. 2. Transferal. 3. Translation

The Steps. 1. Transcription. 2. Transferal. 3. Translation Protein Synthesis Protein synthesis is simply the "making of proteins." Although the term itself is easy to understand, the multiple steps that a cell in a plant or animal must go through are not. In order

More information

Medicel Integrator A platform for integrating and analysing biological data

Medicel Integrator A platform for integrating and analysing biological data March 14, 2007 Daniel Nicorici PhD, Application scientist Medicel Integrator A platform for integrating and analysing biological data Outline Medicel's Integrator platform Integration

More information

DNA and the Cell. Version 2.3. English version. ELLS European Learning Laboratory for the Life Sciences

DNA and the Cell. Version 2.3. English version. ELLS European Learning Laboratory for the Life Sciences DNA and the Cell Anastasios Koutsos Alexandra Manaia Julia Willingale-Theune Version 2.3 English version ELLS European Learning Laboratory for the Life Sciences Anastasios Koutsos, Alexandra Manaia and

More information

Chapter 10 Manipulating Genes

Chapter 10 Manipulating Genes How DNA Molecules Are Analyzed Chapter 10 Manipulating Genes Until the development of recombinant DNA techniques, crucial clues for understanding how cell works remained lock in the genome. Important advances

More information



More information

Processing Genome Data using Scalable Database Technology. My Background

Processing Genome Data using Scalable Database Technology. My Background Johann Christoph Freytag, Ph.D. Stanford University, February 2004 PhD @ Harvard Univ. Visiting Scientist, Microsoft Res. (2002)

More information

GenBank: A Database of Genetic Sequence Data

GenBank: A Database of Genetic Sequence Data GenBank: A Database of Genetic Sequence Data Computer Science 105 Boston University David G. Sullivan, Ph.D. An Explosion of Scientific Data Scientists are generating ever increasing amounts of data. Relevant

More information

Transcription and Translation of DNA

Transcription and Translation of DNA Transcription and Translation of DNA Genotype our genetic constitution ( makeup) is determined (controlled) by the sequence of bases in its genes Phenotype determined by the proteins synthesised when genes

More information

Web-Based Genomic Information Integration with Gene Ontology

Web-Based Genomic Information Integration with Gene Ontology Web-Based Genomic Information Integration with Gene Ontology Kai Xu 1 IMAGEN group, National ICT Australia, Sydney, Australia, Abstract. Despite the dramatic growth of online genomic

More information

Protein Synthesis How Genes Become Constituent Molecules

Protein Synthesis How Genes Become Constituent Molecules Protein Synthesis Protein Synthesis How Genes Become Constituent Molecules Mendel and The Idea of Gene What is a Chromosome? A chromosome is a molecule of DNA 50% 50% 1. True 2. False True False Protein

More information

RJE Database Accessory Programs

RJE Database Accessory Programs RJE Database Accessory Programs Richard J. Edwards (2006) 1: Introduction...2 1.1: Version...2 1.2: Using this Manual...2 1.3: Getting Help...2 1.4: Availability and Local Installation...2 2: RJE_DBASE...3

More information

Introduction to Bioinformatics 2. DNA Sequence Retrieval and comparison

Introduction to Bioinformatics 2. DNA Sequence Retrieval and comparison Introduction to Bioinformatics 2. DNA Sequence Retrieval and comparison Benjamin F. Matthews United States Department of Agriculture Soybean Genomics and Improvement Laboratory Beltsville, MD 20708

More information

Name Date Period. 2. When a molecule of double-stranded DNA undergoes replication, it results in

Name Date Period. 2. When a molecule of double-stranded DNA undergoes replication, it results in DNA, RNA, Protein Synthesis Keystone 1. During the process shown above, the two strands of one DNA molecule are unwound. Then, DNA polymerases add complementary nucleotides to each strand which results

More information

Lecture Series 7. From DNA to Protein. Genotype to Phenotype. Reading Assignments. A. Genes and the Synthesis of Polypeptides

Lecture Series 7. From DNA to Protein. Genotype to Phenotype. Reading Assignments. A. Genes and the Synthesis of Polypeptides Lecture Series 7 From DNA to Protein: Genotype to Phenotype Reading Assignments Read Chapter 7 From DNA to Protein A. Genes and the Synthesis of Polypeptides Genes are made up of DNA and are expressed

More information


THE GENBANK SEQUENCE DATABASE Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Second Edition Andreas D. Baxevanis, B.F. Francis Ouellette Copyright 2001 John Wiley & Sons, Inc. ISBNs: 0-471-38390-2 (Hardback);

More information

Introduction to Genome Annotation


More information

EMBL Identity & Access Management

EMBL Identity & Access Management EMBL Identity & Access Management Rupert Lück EMBL Heidelberg e IRG Workshop Zürich Apr 24th 2008 Outline EMBL Overview Identity & Access Management for EMBL IT Requirements & Strategy Project Goal and

More information

Gene Models & Bed format: What they represent.

Gene Models & Bed format: What they represent. GeneModels&Bedformat:Whattheyrepresent. Gene models are hypotheses about the structure of transcripts produced by a gene. Like all models, they may be correct, partly correct, or entirely wrong. Typically,

More information

The human gene encoding Glucose-6-phosphate dehydrogenase (G6PD) is located on chromosome X in cytogenetic band q28.

The human gene encoding Glucose-6-phosphate dehydrogenase (G6PD) is located on chromosome X in cytogenetic band q28. Tutorial Module 5 BioMart You will learn about BioMart, a joint project developed and maintained at EBI and OiCR How to use BioMart to quickly obtain lists of gene information from Ensembl

More information


FINDING RELATION BETWEEN AGING AND FINDING RELATION BETWEEN AGING AND TELOMERE BY APRIORI AND DECISION TREE Jieun Sung 1, Youngshin Joo, and Taeseon Yoon 1 Department of National Science, Hankuk Academy of Foreign Studies, Yong-In, Republic

More information

Check Your Data Freedom: A Taxonomy to Assess Life Science Database Openness

Check Your Data Freedom: A Taxonomy to Assess Life Science Database Openness Check Your Data Freedom: A Taxonomy to Assess Life Science Database Openness Melanie Dulong de Rosnay Fellow, Science Commons and Berkman Center for Internet & Society at Harvard University This article

More information

Lecture What does data mean in Bio-sciences? Bioinformatics course. Definitions. Bioinformatics

Lecture What does data mean in Bio-sciences? Bioinformatics course. Definitions. Bioinformatics W pliku nie można odnaleźć części obrazu z identyfikatorem relacji rid2. 2014-10-06 What does data mean in Bio-sciences? Lecture 1 Introduction to bioinformatics Basic definitions Scope of the course Internet

More information

A Primer of Genome Science THIRD

A Primer of Genome Science THIRD A Primer of Genome Science THIRD EDITION GREG GIBSON-SPENCER V. MUSE North Carolina State University Sinauer Associates, Inc. Publishers Sunderland, Massachusetts USA Contents Preface xi 1 Genome Projects:

More information

Life. In nature, we find living things and non living things. Living things can move, reproduce, as opposed to non living things.

Life. In nature, we find living things and non living things. Living things can move, reproduce, as opposed to non living things. Computat onal Biology Lecture 1 Life In nature, we find living things and non living things. Living things can move, reproduce, as opposed to non living things. Both are composed of the same atoms and

More information

Unit I: Introduction To Scientific Processes

Unit I: Introduction To Scientific Processes Unit I: Introduction To Scientific Processes This unit is an introduction to the scientific process. This unit consists of a laboratory exercise where students go through the QPOE2 process step by step

More information

The Ensembl Core databases and API

The Ensembl Core databases and API The Ensembl Core databases and API Useful links Installation instructions: Schema description:

More information

CD-HIT User s Guide. Last updated: April 5, 2010.

CD-HIT User s Guide. Last updated: April 5, 2010. CD-HIT User s Guide Last updated: April 5, 2010 Program developed by Weizhong Li s lab at UCSD 1. Introduction

More information

A Multiple DNA Sequence Translation Tool Incorporating Web Robot and Intelligent Recommendation Techniques

A Multiple DNA Sequence Translation Tool Incorporating Web Robot and Intelligent Recommendation Techniques Proceedings of the 2007 WSEAS International Conference on Computer Engineering and Applications, Gold Coast, Australia, January 17-19, 2007 402 A Multiple DNA Sequence Translation Tool Incorporating Web

More information

Developing a Database for GenBank Information

Developing a Database for GenBank Information Developing a Database for GenBank Information By Nathan Mann B.S., University of Louisville, 2003 A Thesis Submitted to the Faculty of the University of Louisville Speed Scientific School As Partial Fulfillment

More information

Integration of data management and analysis for genome research

Integration of data management and analysis for genome research Integration of data management and analysis for genome research Volker Brendel Deparment of Zoology & Genetics and Department of Statistics Iowa State University 2112 Molecular Biology Building Ames, Iowa

More information

M110.726 The Nucleus M110.727 The Cytoskeleton M340.703 Cell Structure and Dynamics

M110.726 The Nucleus M110.727 The Cytoskeleton M340.703 Cell Structure and Dynamics of Biochemistry and Molecular Biology 1. Master the knowledge base of current biochemistry, molecular biology, and cellular physiology Describe current knowledge in metabolic transformations conducted

More information

Algorithms in Computational Biology (236522) spring 2007 Lecture #1

Algorithms in Computational Biology (236522) spring 2007 Lecture #1 Algorithms in Computational Biology (236522) spring 2007 Lecture #1 Lecturer: Shlomo Moran, Taub 639, tel 4363 Office hours: Tuesday 11:00-12:00/by appointment TA: Ilan Gronau, Taub 700, tel 4894 Office

More information

Euro-BioImaging European Research Infrastructure for Imaging Technologies in Biological and Biomedical Sciences

Euro-BioImaging European Research Infrastructure for Imaging Technologies in Biological and Biomedical Sciences Euro-BioImaging European Research Infrastructure for Imaging Technologies in Biological and Biomedical Sciences WP11 Data Storage and Analysis Task 11.1 Coordination Deliverable 11.2 Community Needs of

More information

Final Project Report

Final Project Report CPSC545 by Introduction to Data Mining Prof. Martin Schultz & Prof. Mark Gerstein Student Name: Yu Kor Hugo Lam Student ID : 904907866 Due Date : May 7, 2007 Introduction Final Project Report Pseudogenes

More information

1. Which of the following correctly organizes genetic material from the broadest category to the most specific category?

1. Which of the following correctly organizes genetic material from the broadest category to the most specific category? DNA and Genetics 1. Which of the following correctly organizes genetic material from the broadest category to the most specific category? A. genome chromosome gene DNA molecule B. genome chromosome DNA

More information

Lecture Data Warehouse Systems

Lecture Data Warehouse Systems Lecture Data Warehouse Systems Eva Zangerle SS 2013 PART A: Architecture Chapter 1: Motivation and Definitions Motivation Goal: to build an operational general view on a company to support decisions in

More information


G E N OM I C S S E RV I C ES GENOMICS SERVICES THE NEW YORK GENOME CENTER NYGC is an independent non-profit implementing advanced genomic research to improve diagnosis and treatment of serious diseases. capabilities. N E X T- G E

More information

1 Mutation and Genetic Change

1 Mutation and Genetic Change CHAPTER 14 1 Mutation and Genetic Change SECTION Genes in Action KEY IDEAS As you read this section, keep these questions in mind: What is the origin of genetic differences among organisms? What kinds

More information

NSilico Life Science Introductory Bioinformatics Course

NSilico Life Science Introductory Bioinformatics Course NSilico Life Science Introductory Bioinformatics Course INTRODUCTORY BIOINFORMATICS COURSE A public course delivered over three days on the fundamentals of bioinformatics and illustrated with lectures,

More information

Teaching Bioinformatics to Undergraduates

Teaching Bioinformatics to Undergraduates Teaching Bioinformatics to Undergraduates Stuart M. Brown Research Computing, NYU School of Medicine I. What is Bioinformatics? II. Challenges of teaching bioinformatics

More information

Linear Sequence Analysis. 3-D Structure Analysis

Linear Sequence Analysis. 3-D Structure Analysis Linear Sequence Analysis What can you learn from a (single) protein sequence? Calculate it s physical properties Molecular weight (MW), isoelectric point (pi), amino acid content, hydropathy (hydrophilic

More information

RNA & Protein Synthesis

RNA & Protein Synthesis RNA & Protein Synthesis Genes send messages to cellular machinery RNA Plays a major role in process Process has three phases (Genetic) Transcription (Genetic) Translation Protein Synthesis RNA Synthesis

More information

Exercise with Gene Ontology - Cytoscape - BiNGO

Exercise with Gene Ontology - Cytoscape - BiNGO Exercise with Gene Ontology - Cytoscape - BiNGO This practical has material extracted from In this exercise we will analyze microarray

More information

RNA and Protein Synthesis Biology Mr. Hines

RNA and Protein Synthesis Biology Mr. Hines RNA and Protein Synthesis 12.3 Biology Mr. Hines Now we know how DNA (genes) are copied. But how is it used to make a living organism? Most of the structures inside of a cell are made of protein - so we

More information

DNA Technology Mapping a plasmid digesting How do restriction enzymes work?

DNA Technology Mapping a plasmid digesting How do restriction enzymes work? DNA Technology Mapping a plasmid A first step in working with DNA is mapping the DNA molecule. One way to do this is to use restriction enzymes (restriction endonucleases) that are naturally found in bacteria

More information

Next Generation Sequencing Data Visualization

Next Generation Sequencing Data Visualization Next Generation Sequencing Data Visualization GBrowse2 from GMOD Andreas Gisel Institute for Biomedical Technologies CNR Bari - Italy GMOD is the Generic Model Organism Database project GMOD is a collection

More information

Guide for Bioinformatics Project Module 3

Guide for Bioinformatics Project Module 3 Structure- Based Evidence and Multiple Sequence Alignment In this module we will revisit some topics we started to look at while performing our BLAST search and looking at the CDD database in the first

More information

Tutorial. Reference Genome Tracks. Sample to Insight. November 27, 2015

Tutorial. Reference Genome Tracks. Sample to Insight. November 27, 2015 Reference Genome Tracks November 27, 2015 Sample to Insight CLC bio, a QIAGEN Company Silkeborgvej 2 Prismet 8000 Aarhus C Denmark Telephone: +45 70 22 32 44 Reference

More information

Human Genome Complexity, Viruses & Genetic Variability

Human Genome Complexity, Viruses & Genetic Variability Human Genome Complexity, Viruses & Genetic Variability (Learning Objectives) Learn the types of DNA sequences present in the Human Genome other than genes coding for functional proteins. Review what you

More information

Case Study Life Sciences Data

Case Study Life Sciences Data Case Study Life Sciences Data Centre for Integrative Systems Biology and Bioinformatics Sarah Butcher Bio-data

More information

The EcoCyc Curation Process

The EcoCyc Curation Process The EcoCyc Curation Process Ingrid M. Keseler SRI International 1 HOW OFTEN IS THE GOLDEN GATE BRIDGE PAINTED? Many misconceptions exist about how often the Bridge is painted. Some say once every seven

More information

Molecular Biology of The Cell - An Introduction

Molecular Biology of The Cell - An Introduction Molecular Biology of The Cell - An Introduction Nguyen Phuong Thao School of Biotechnology International University Contents Three Domain of Life The Cell Eukaryotic Cell Prokaryotic Cell The Genome The

More information

Cells. DNA and Heredity

Cells. DNA and Heredity Cells DNA and Heredity ! Nucleic acids DNA (deoxyribonucleic acid) and RNA (ribonucleic acid) Determines how cell function " change the DNA and you change the nature of the organism Changes of DNA allows

More information

Opening Activity: Where in the cell does transcription take place? Latin Root Word: Review of Old Information: Transcription Video New Information:

Opening Activity: Where in the cell does transcription take place? Latin Root Word: Review of Old Information: Transcription Video New Information: Section 1.4 Name: Opening Activity: Where in the cell does transcription take place? Latin Root Word: Review of Old Information: Transcription Video New Information: Protein Synthesis: pages 193-196 As

More information

Efficient Parallel Execution of Sequence Similarity Analysis Via Dynamic Load Balancing

Efficient Parallel Execution of Sequence Similarity Analysis Via Dynamic Load Balancing Efficient Parallel Execution of Sequence Similarity Analysis Via Dynamic Load Balancing James D. Jackson Philip J. Hatcher Department of Computer Science Kingsbury Hall University of New Hampshire Durham,

More information

A Simply Fruity DNA Extraction

A Simply Fruity DNA Extraction A Simply Fruity DNA Extraction Category: Biology Type: Experiment (60 min class) Rough Parts List: 1 Strawberry 1 Plastic freezer bag 100 mls Water 100 mls Soap 1 Tbsp Salt 15 mls Ice cold 91% isopropyl

More information

Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism )

Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism ) Biology 1406 Exam 3 Notes Structure of DNA Ch. 10 Genetic information (DNA) determines structure of proteins DNA RNA proteins cell structure 3.11 3.15 enzymes control cell chemistry ( metabolism ) Proteins

More information

Databases and Information Management

Databases and Information Management Databases and Information Management Reading: Laudon & Laudon chapter 5 Additional Reading: Brien & Marakas chapter 3-4 COMP 5131 1 Outline Database Approach to Data Management Database Management Systems

More information

Basic Concepts of DNA, Proteins, Genes and Genomes

Basic Concepts of DNA, Proteins, Genes and Genomes Basic Concepts of DNA, Proteins, Genes and Genomes Kun-Mao Chao 1,2,3 1 Graduate Institute of Biomedical Electronics and Bioinformatics 2 Department of Computer Science and Information Engineering 3 Graduate

More information

Lecture 11 Data storage and LIMS solutions. Stéphane LE CROM

Lecture 11 Data storage and LIMS solutions. Stéphane LE CROM Lecture 11 Data storage and LIMS solutions Stéphane LE CROM Various steps of a DNA microarray experiment Experimental steps Data analysis Experimental design set up Chips on catalog

More information

Information and Data Sharing Policy* Genomics:GTL Program

Information and Data Sharing Policy* Genomics:GTL Program Appendix 1 Information and Data Sharing Policy* Genomics:GTL Program Office of Biological and Environmental Research Office of Science Department of Energy Appendix 1 Final Date: April 4, 2008 Introduction

More information

Core Bioinformatics. Degree Type Year Semester. 4313473 Bioinformàtica/Bioinformatics OB 0 1

Core Bioinformatics. Degree Type Year Semester. 4313473 Bioinformàtica/Bioinformatics OB 0 1 Core Bioinformatics 2014/2015 Code: 42397 ECTS Credits: 12 Degree Type Year Semester 4313473 Bioinformàtica/Bioinformatics OB 0 1 Contact Name: Sònia Casillas Viladerrams Email:

More information

7 Nucleic acids. Chapter summary a reminder of the issues to be revised

7 Nucleic acids. Chapter summary a reminder of the issues to be revised 7 Nucleic acids Chapter summary a reminder of the issues to be revised 1 DNA, an extremely long, thread-like macromolecule, consists of two anti-parallel polynucleotide strands, paired together and held

More information

13.4 Gene Regulation and Expression

13.4 Gene Regulation and Expression 13.4 Gene Regulation and Expression Lesson Objectives Describe gene regulation in prokaryotes. Explain how most eukaryotic genes are regulated. Relate gene regulation to development in multicellular organisms.

More information

Genomic Data at the British Oceanographic Data Centre

Genomic Data at the British Oceanographic Data Centre Genomic Data at the British Oceanographic Data Centre A data management project for the NERC Marine and Freshwater Microbial Biodiversity Thematic Programme Gwen Moncoiffé British Oceanographic Data Centre,

More information

Transcription Activity Guide

Transcription Activity Guide Transcription Activity Guide Teacher Key Ribonucleic Acid (RNA) Introduction Central Dogma: DNA to RNA to Protein Almost all dynamic functions in a living organism depend on proteins. Proteins are molecular

More information

Guideline for the submission of DNA sequences and associated annotations within the framework of Directive 2001/18/EC and Regulation (EC) No 1829/2003

Guideline for the submission of DNA sequences and associated annotations within the framework of Directive 2001/18/EC and Regulation (EC) No 1829/2003 Guideline for the submission of DNA sequences and associated annotations within the framework of Directive 2001/18/EC and Regulation (EC) No 1829/2003 European Reference Laboratory for Genetically Modified

More information

Control of Gene Expression

Control of Gene Expression Control of Gene Expression What is Gene Expression? Gene expression is the process by which informa9on from a gene is used in the synthesis of a func9onal gene product. What is Gene Expression? Figure

More information

Biotechnology. Selective breeding Use of microbes (bacteria & yeast)

Biotechnology. Selective breeding Use of microbes (bacteria & yeast) Biotechnology bio and technology The use of living organisms to solve problems or make useful products. Biotechnology has been practiced for the last 10,000 years. Selective breeding Use of microbes (bacteria

More information

Global and Discovery Proteomics Lecture Agenda

Global and Discovery Proteomics Lecture Agenda Global and Discovery Proteomics Christine A. Jelinek, Ph.D. Johns Hopkins University School of Medicine Department of Pharmacology and Molecular Sciences Middle Atlantic Mass Spectrometry Laboratory Global

More information

No growth: Mutant cells cannot grow and divide Minimal medium. Classes of Neurospora crassa. Class I mutants Class II mutants Class III mutants

No growth: Mutant cells cannot grow and divide Minimal medium. Classes of Neurospora crassa. Class I mutants Class II mutants Class III mutants EXPERIMENT Growth: Wild-type cells growing and dividing No growth: Mutant cells cannot grow and divide Minimal medium RESULTS Minimal medium (MM) (control) Wild type Classes of Neurospora crassa Class

More information

Genetics Notes C. Molecular Genetics

Genetics Notes C. Molecular Genetics Genetics Notes C Molecular Genetics Vocabulary central dogma of molecular biology Chargaff's rules messenger RNA (mrna) ribosomal RNA (rrna) transfer RNA (trna) Your DNA, or deoxyribonucleic acid, contains

More information

Scientific databases. Biological data management

Scientific databases. Biological data management Scientific databases Biological data management The term paper within the framework of the course Principles of Modern Database Systems by Aleksejs Kontijevskis PhD student The Linnaeus Centre for Bioinformatics

More information