
Save this PDF as:

Size: px
Start display at page:

Download "2Proofbymathematicalinductionplaysacrucialroleinthevericationofprogramtrans-"


1 SubmissiontoJ.FunctionalProgrammingSpecialIssueonTheoremProving&FunctionalProgramming AutomaticVericationofFunctionswith DepartmentofComputing&ElectricalEngineering, AccumulatingParameters UniversityofEdinburgh,80SouthBridge, DepartmentofArticialIntelligence, Heriot-WattUniversity,Riccarton, Edinburgh,ScotlandEH144AS, Edinburgh,ScotlandEH11HN, ANDREWIRELAND ALANBUNDY 1Introduction 2Background 3LimitationsoftheBasicCritic Contents 4SpecifyingSinkTerms 2.3ACriticforDiscoveringGeneralizations 2.1ProofMethodsandCritics 2.2AMethodforGuidingInductiveProof InstantiatingSinkTerms 6OrganizingtheSearchSpace 5.1GuidingSecond-OrderUnication 5.2ListReversalRevisited 5.3TheBenetsofMeta-levelGuidance 4.1PrimarySinkTerms 4.2SecondarySinkTerms Conclusion References 9FutureWork 8RelatedWork 7ImplementationandTesting 7.1ExperimentalResults 7.2ACaseStudy

2 2Proofbymathematicalinductionplaysacrucialroleinthevericationofprogramtrans- formations.thispaperfocusesontheautomaticvericationoftransformationswhich izationstep.inearlierpaperswepresentedatechniqueforautomatingthegeneralization introduceaccumulatingparameters.suchvericationeortstypicallyrequireageneral- Abstract AndrewIrelandandAlanBundy tiontechniquetogetherwithsomepromisingexperimentalresults. stepbyanalysingfailedproofattempts.throughempiricaltestinganaturalgeneralization andextensionofthebasictechniqueemerged.herewedescribeourextendedgeneraliza- reversal: bookexample(henderson,1980).considerthefollowingnaivedenitionoflist 1980;Bird&Wadler,1988;Turner,1991)techniqueforderivingecientfunctional programs.inordertoillustratethebasicideaweuselistreversal,astandardtext Theintroductionofaccumulatorparametersisawelldocumented(Henderson, reverse(nil)=nil 1Introduction where::andappdenotelistconstructionandconcatenationrespectively.anequivalent,butmoreecient,versionisderivedbyintroducinganadditional\accumulator"parameter,i.e.rev(nil;z)=z reverse(x::y)=app(reverse(y);x::nil) Theresultingfunctionrevistail-recursive.Byexploitingthedirectcorrespondencebetweentail-recursionanditerationfurthereciencygainscanbeachieved however,isnotapurelymechanicalprocess.itrequiresustoproveaninductive conjectureoftheform: 8t:list(A):reverse(t)=rev(t;nil) rev(x::y;z)=rev(y;x::z) bypurelymechanicalmeans.establishingthecorrectnessofthistransformation, Inthispaperweareconcernedwithprovingsuchinductiveconjecturesautomatically.Anaiveattemptatproving(1)bystructuralinductiononthelisttfails.The andaninductiveconclusionoftheform: matchingtermstructures,i.e.app(:::;h::nil)ontheleft-hand-sideandh::::: Notethattheconclusionfailstomatchthehypothesisbecauseitcontainsmis- ontheright-hand-side.theproblemisthattheinductionhypothesisisnotstrong failureoccursinthestepcasewherewehaveaninductionhypothesisoftheform: app(reverse(t);h::nil)=rev(t;h::nil)

3 enough,i.e.itonlytellsusaboutthebehaviorofrevwhenitsaccumulatorparameterissettonil.thefailedproofattemptcanbeovercomebygeneralizing theconjecture.thegeneralizationinvolvestheintroductionofanewuniversally quantiedvariableintotheconjecture,i.e. AutomaticVericationofFunctionswithAccumulatingParameters3 aninnitebranchingpointintothesearchspace.itisknown(kreisel,1965)that ofinference.inagoal-directedframework,therefore,ageneralizationintroduces Wewillrefertothisasaccumulatorgeneralization.Thegeneralizedconjectureprovidesastrongerinductionhypothesiswhichenablesthestepcaseprooftosucceed. bymathematicalinduction.ageneralizationstepisunderpinnedbythecut-rule Theneedforgeneralizationrepresentsamajorobstacletotheautomationofproof 8t:list(A):8l:list(A):app(reverse(t);l)=rev(t;l) (2) ductionoftheapp(:::;l)termstructureontheleft-hand-sideof(2)motivated? isrequirediftheprocessistobefullyautomated.forinstance,howistheintro- stronghintastowherethenewuniversalvariableshouldoccurwithinthegeneralizedconjecture.however,evenwiththiselementaryexampleadditionalguidance thecut-eliminationtheoremdoesnotholdforinductivetheories.consequently heuristicsforcontrollinggeneralizationplayanimportantroleintheautomation ofinductiveproof. startingpointisameta-leveldescriptionofthecommonstructurewhichcharacterizesaninductiveproof.whenaproofattemptfailsthisdescriptioncanthenbe Returningtothelistreversalexample,theaccumulatorparameterprovidesa Weaddressthisquestionthroughtheuseofameta-levelreasoningtechnique.Our usedtobridgethegapbetweenthefailureandasubsequentsuccessfulproof.we arguethathavingsuchadescriptionprovidesahandleontheinnitesearchspace Webuilduponthenotionofaproofplan(Bundy,1988)andtactic-basedtheoremproving(Gordonetal.,1979).Whileatacticencodesthelow-levelstructure generatedbythegeneralizationproblem. automateddeduction,aproofplanguidesthesearchforaproof.thatis,givena ofafamilyofproofsaproofplanexpressesthehigh-levelstructure.intermsof collectionofgeneralpurposetacticstheassociatedproofplancanbeusedautomaticallytotailoraspecialpurposetactictoproveaparticularconjecture. 2.1ProofMethodsandCritics 2Background proofplanningframeworkwithanexceptionhandlingmechanismwhichenables (Ireland,1992)wehaveattemptedtoautomatethisprocess.Criticsprovidethe orsupplyingadditionallemmatatotheprover.throughthenotionofaproofcritic odsexpressthepreconditionsfortacticapplication.thebenetsofproofplanscan beseenwhenaproofattemptgoeswrong.experiencedusersoftheoremprovers, suchasnqthm,areusedtointerveningwhentheyobservethefailureofaproof attempt.suchinterventionstypicallyresultintheusergeneralizingtheirconjecture Thebasicbuildingblocksofproofplansaremethods.Usingameta-logic,meth-

4 4thepartialsuccessofaproofplantobeexploitedinsearchforaproof.Themech- anismworksbyallowingproofpatchestobeassociatedwithdierentpatternsof describedbelow.2.2amethodforguidinginductiveproof ofpatchinginductiveproofsbaseduponthepartialsuccessoftheripplemethod preconditionfailure.wepreviouslyreported(ireland&bundy,1996)variousways AndrewIrelandandAlanBundy Inthecontextofmathematicalinductiontheripplemethodplaysapivotalrolein berepresentedasfollows: ofrewriterulesinordertoprovestepcasegoals.schematicallyastepcasegoalcan guidingthesearchforaproof.theripplemethodcontrolstheselectiveapplication {z} hypothesis`p[c1(a);b] bec3(b)whichgivesrisetoagoaloftheform: wherec1(a)denotestheinductionterm.toachieveastepcasegoaltheconclusion Notethatinordertoapplytheinductionhypothesiswemustrstinstantiateb0to mustberewrittensoastoallowthehypothesistobeapplied: 8b0:P[a;b0]`c2(P[a;c3(b)]) {z} conclusion Inductionandrecursionarecloselyrelated.Theapplicationofaninductionhypothesiscorrespondstoarecursivecallwhiletheinstantiationofaninductionhypothesis correspondstothemodicationofanaccumulatorparameter.theneedtoinstantiateinductionhypothesesiscommonplaceininductiveproof.ourtechnique,as willbeexplainedbelow,exploitsthisfact. Syntacticallyaninductionhypothesisandconclusionareverysimilar.Moreformally,thehypothesiscanbeexpressedasanembeddingwithintheconclusionmizesthechancesofapplyinganinductionhypothesis.Thisisthebasicideabehind causethemismatchbetweenthehypothesisandconclusion.converselyanyterm givenabovetakestheform: sentwave-frontsandwave-holesrespectively,e.g.anannotatedversionofthegoal meta-levelannotationscalledwave-frontstodistinguishthetermstructureswhich structurewithintheconclusionwhichcorrespondstothehypothesisiscalledskeleton.ingeneral,embeddedwithineachwave-frontwillbepartsoftheskeletonterm structure,theseareknownaswave-holes.weuseaboxandanunderlinetorepre- theripplemethod.theapplicationoftheripplemethod,orrippling,makesuseof P[a;c3(b)]`c2(P[a;c3(b)]) Restrictingtherewritingoftheconclusionsoastopreservethisembeddingmaxiterm.Thearrowsareusedtoindicatethedirectioninwhichwave-frontscanbe Wewillrefertoawave-frontanditsassociatedwave-hole,e.g.c1(a)",asawave- 8b0:P[a;b0]`P[c1(a)";bbc]

5 rippling-out:f1(:::(fn(c1(:::)")):::) AutomaticVericationofFunctionswithAccumulatingParameters5 rippling-in: rippling-sideways: f1(c1(:::)";:::;fi(:::);:::) before before f1(:::;:::;ci(fi(:::))#;:::) cn(f1(:::(fn(:::)):::))" after Anoutwardrippleinvolvesthemovementofwave-frontsintolessnestedtermtreepositions.Asidewaysripplesmoveswave-frontsbetweendistinctbranchesinthetermtree whileinwardripplesmovementofwave-frontsintomorenestedtermtreepositions.in general,awave-rulemaycombineallthreeforms. cn(f1(:::fn(:::):::))# before f1(:::fn(c1(:::)#):::) after after i.e.b:::c.aswillbeexplainedbelowsinksplayanimportantroleinidentifyingthe movedthroughthetermstructure.atermstructurewiththeannotationsremoved bematchedbyuniversalvariablesinthehypothesisweuseannotationscalledsinks, needforaccumulatorgeneralization.asuccessfulapplicationoftheripplemethod iscalledtheerasure.inordertodistinguishtermswithintheconclusionwhichcan Fig.1.Thethreebasicripplingpatterns canbecharacterizedasfollows: wave-frontannotationisnolongerrequired.ripplingrestrictsrewritingtoasyntacticclassofrulescalledwave-rules.wave-rulesmakeprogresstowardseliminating theripplegivenabovetakestheformy: 8b0:P[a;b0]`c2(P[a;bc3(b)c])" Notethatthetermc3(b),i.e.theinstantiationforb0,occurswithinasinksothe wave-frontswhilepreservingskeletontermstructure.awave-rulewhichachieves whicharesummariesedschematicallyingure1.thepreconditionsforapplying Wave-rulesarederivedautomaticallyfromdenitionsandlogicalpropertieslike requiremultiplewave-ruleapplications.therearethreebasicpatternsofrippling substitution,associativityanddistributivityetc.ingeneral,asuccessfulripplewill P[c1(X)";Y])c2(P[X;c3(Y)#])" etal.,1993;basin&walsh,1994).toillustrateoneofthebasicpatternsofrippling wave-rulesaregiveningure(2).foracompletedescriptionofripplingsee(bundy (3) aninductiveproofofconjecture(2)ispresented.structuralinductiononthelistt yweuse)todenoterewriterulesand!todenotelogicalimplication.

6 6Inputsequent:H`G[f1(c1(:::)";f2(b:::c);f3(c2(:::)"))] Methodpreconditions: 1.thereexistsasubtermTofGwhichcontainswave-front(s),e.g. AndrewIrelandandAlanBundy 3.thewave-ruleconditionfollowsfromthecontext,e.g. 2.thereexistsawave-rulewhichmatchesT,e.g. C!f1(c1(X)";Y;Z))c5(f1(X;c3(Y)#;c4(Z)#))" Outputsequent: 4.resultinginwarddirectedwave-frontsarepotentiallyremovable,e.g. :::c3(f2(b:::c))# {z} (sinkable):::or:::c4(f3(c2(:::)"))# H`C H`G[c5(f1(:::;c3(f2(b:::c))#;c4(f3(c2(:::)"))#))"] (cancellable)::: {z } hypothesistakestheform: structuresmustmatchḟig.2.preconditionsforapplyingwave-rules givesrisetoatrivialbasecase.wefocushereonthestepcasewheretheinduction Notethatinorderforawave-ruletobeapplicablebothobject-levelandmeta-levelterm andtheannotatedconclusiontakestheform: Theproofofthestepcaserequiresthedenitionsofreverse,revandapp,aswellas theassociativityofapp.thesedenitionsgiveriseto49wave-ruleswhichinclude: app(reverse(h::t");blc)=rev(h::t";blc) 8l0:list(A):app(reverse(t);l0)=rev(t;l0) (5) (4)

7 AutomaticVericationofFunctionswithAccumulatingParameters7 rule(6)appliesontheleft-hand-sideof(5)togive: Notethatallwave-rulesareavailableduringtheprocessofplanningaproof.Wave- app(app(x;y)";z))app(x;app(y;z)#) reverse(x::y"))app(reverse(y);x::nil)" rev(x::y";z))rev(y;x::z#) (7) (8) (6) Wave-rule(8)appliesontheleft-hand-sidegiving: Applyingwave-rule(7)ontheright-hand-sideof(9)gives: app(app(reverse(t);h::nil)";blc)=rev(h::t";blc) app(app(reverse(t);h::nil)";blc)=rev(t;bh::lc) (9) simpliestogive:app(reverse(t);bh::lc)=rev(t;bh::lc) Notethatthetermstructuredelimitedbythesinkannotationontheleft-hand-side Amatchbetween(10)and(4)isachievedbyinstantiatingl0tobeh::l.This completesthestepcaseproof. app(reverse(t);bapp(h::nil;l)c)=rev(t;bh::lc) 2.3ACriticforDiscoveringGeneralizations whereddenotesatermwhichdoesnotcontainanysinks.wecalltheoccurrenceof Intermsofthepreconditionsforapplyingwave-rules,theneedforanaccumulator ofwave-rule(3).theidenticationofablockagetermtriggersthegeneralization dablockagetermbecauseitblocksthesidewaysripple,inthiscasetheapplication generalizationcanbeexplainedbythefailureofprecondition4,i.e.amissingsink (seegure2).schematicallythisfailurepatterncanbecharacterisedasfollows: topartiallyspecifytheoccurrencesofasinkvariable.intheschematicexample critic.theassociatedproofpatchintroducesschematictermsintothegoalinorder presentedabovethisleadstoapatchedgoaloftheform: P[a;d]`P[c1(a)";d] 8l0:P[a;M(l0)]`8l:P[c1(a)";M(blc)]

8 8whereMdenotesasecond-ordermeta-variable.Notethatwave-rule(3)isnow applicable,givingrisetoarenedgoaloftheform: 8l0:P[a;M(l0)]`8l:c2(P[a;c3(M(blc))#])" AndrewIrelandandAlanBundy TheexpectationisthataninwardripplewilldeterminetheidentityofM. Notethattheoccurrenceofnilontheright-hand-sideisablockagetermbecause jecture(1)givesrisetothefollowingfailurepattern: Relatingthisproofpatchtothelistreversalexampleaninductiveproofofcon- itpreventstheapplicationofwave-rule(7).thepatchedgoaltakestheform: reverse(t)=rev(t;nil)` M2(reverse(h::t");blc)=rev(h::t";M1blc)(12) app(reverse(t);h::nil)"=rev(h::t";nil) {z} blocked (11) Usingwave-rule(6)thegoalbecomes: Wave-rule(7)isnowapplicableandgivesrisetoagoaloftheform: 8l0:list(A):M2(reverse(t);l0)=rev(t;M1(l0))` M2(app(reverse(t);h::nil)";blc)=rev(h::t";M1(blc)) Thebasiccriticdescribedinx2.3hasprovedverysuccessful(Ireland&Bundy, willbedetailedinx5.wewillrefertotheabovegeneralizationasthebasiccritic. Ourapproachtotheproblemofconstrainingtheinstantiationofschematicterms M2(app(reverse(t);h::nil)";blc)=rev(t;h::M1(blc)#) 1996).Throughourempiricaltesting,however,anumberoflimitationshavebeen observed: 2.Thebasiccriticwasdesignedinthecontextofequationalproofs.Asink 1.Certainclassesofexamplerequiretheintroductionofmultiplesinkvariables. Thebasiccriticonlydealswithsinglesinkvariables. 3LimitationsoftheBasicCritic variableisassumedtooccuronbothsidesofanequation.onthesideopposite totheblockagetermitisassumedthatintheresultinggeneralizedterm structurethesink(auxiliary)willoccurasanargumentoftheoutermost functor.

9 >Fromtheseobservationsanumberofnaturalextensionstothebasiccriticemerged. Theseextensionsaredescribedinthefollowingsections. 3.Sinktermoccurrenceswhicharemotivatedbyblockagetermsaremoreconstrainedthanthosewhicharenot.Thisisnotexploitedbythebasiccritic AutomaticVericationofFunctionswithAccumulatingParameters9 duringthesearchforageneralization. aboveweextendthemeta-levelannotationstoincludethenotionsofprimaryand tobeprimary.allotherwave-frontsaredesignatedtobesecondary.toillustrate, secondarywave-fronts.awave-frontwhichprovidesthebasisforasidewaysripple considerthefollowingschematicconclusion: Inordertoexploitthedistinctionbetweendierentsinktermoccurrenceshintedat butwhichisnotapplicablebecauseofthepresenceofablockagetermisdesignated 4SpecifyingSinkTerms Assumingthattheoccurrenceofdin(13)denotesablockagetermthenwave-rule andthefollowingwave-rules: f(c1(x;y)";z))f(x;c2(z;y)#) g(x;c1(y;z)"))c3(g(x;y);z)" g(f(c1(a;b)";d);c1(a;b)") (15) (13) i.e. Usingsubscriptsztodenoteprimaryandsecondarywave-frontsthentheanalysis (14)isnotapplicable.Wave-rule(15)isapplicableandenablesanoutwardsripple, presentedabovegivesrisetothefollowingclassicationofthewave-frontsappearing in(13): c3(g(f(c1(a;b)";d);a);b)" Notethattheripplingofthesecondarywave-frontsisundone.Thisincreasesthe numberofgeneralizationswhichmaybesubsequentlydiscovered.relatingthenotionofprimaryandsecondarywave-frontstoblockedgoal(11)givesriseto: reverse(h::t"2)=rev(h::t"1;nil) g(f(c1(a;b)"1;d);c1(a;b)"2) (16) znotethatwave-rulesmustalsotakeaccountoftheextensiontothewave-front annotations.

10 10 sinktermisafunctionoftheblockagetermandiscomputedasfollows: theseasprimarysinkterms.thepositionofaprimarysinktermcorrespondsto Foreachprimarywave-frontanassociatedsinktermisintroduced.Wereferto thepositionoftheblockagetermwithintheconclusion.thestructureofaprimary AndrewIrelandandAlanBundy pri(x)=8><>:mi(blic) 4.1PrimarySinkTerms thesameobject-levelvariable.thisrepresentsachoicepointintheconstruction levelvariable.ingeneraldistinctprimarysinktermsmayormaynotneedtoshare NotethatMidenotesahigher-ordermeta-variablewhilelidenotesanewobject- ofprimarysinkterms.assumingddenotesaconstantthenpri(d)evaluatesto F(pri(Y1);:::;pri(Yn)) Mi(X;blic) wherexf(y1;:::;yn) otherwise ifxisawave-front ifxisaconstant Relatingthegeneralnotionofprimarysinktermstothespeciclistreversalexamplegives: M1(bl1c).Substitutingthissinktermfordin(16)givesaschematicconclusionof theform: reverse(h::t"2)=rev(h::t"1;m1(bl1c)) g(f(c1(a;b)"1;m1(bl1c));c1(a;b)"2) 4.2SecondarySinkTerms (17) computeasecondarysinktermasfollows: Foreachsecondarywave-frontweeagerlyattempttoapplyasidewaysrippleby introducingoccurrencesofthevariablesassociatedwiththeprimarysinkterms. theprimarysinkterms.toillustrate,consideragaintheschematicconclusion(17). eachsubterm,x,oftheconclusionwhichcontainsasecondarywave-front,we Theseoccurrencesarespeciedagainusingschematictermstructuresandarecalled TakingXtobec1(a;b)"2thentheprocessofintroducingsecondarysinkterms wherel1;:::;lmdenotethevectorofvariablesgeneratedbytheconstructionof secondarysinkterms.theconstructionofsecondarysinktermsareasfollows.for givesrisetoanewschematicconclusionoftheform: g(f(c1(a;b)"1;m1(bl1c));m2(c1(a;b)"2;bl1c)) sec(x)=mi(x;bl1c;:::;blmc) NotethattheselectionofXrepresentsachoicepointintheconstructionofsecondarysinkterms.Inthecaseof(17),anotheralternativeinstantiationforXexists, i.e. g(:::;c1(a;b)"2) (18)

11 Againrelatingthegeneralnotiontothespeciclistreversalexamplegivesriseto 2alternativepatchesoftheform: givingrisetoaschematicconclusionoftheform: AutomaticVericationofFunctionswithAccumulatingParameters11 reverse(m2(h::t"2;bl1c))=rev(h::t"1;m1(bl1c)) M2(g(f(c1(a;b)"1;M1(bl1c));c1(a;b)"2);bl1c) Notethatthesecondofthesecorrespondstothepatchedgoal(12). M2(reverse(h::t"2);bl1c)=rev(h::t"1;M1(bl1c)) (19) 5InstantiatingSinkTerms (20) beinstantiatedthroughtheunicationwithwave-rules.belowweshowindetail x7).inthisapplication,however,weonlyrequiresecond-orderunication.the Theprocessofinstantiatingthesinktermsintroducedbythegeneralizationcritic rulesinthepresenceofschematictermstructurerequireshigher-orderunication. Ourimplementationthereforeexploitsahigher-orderunicationprocedure(see howthemeta-levelannotationscanbeusedtoconstraintheunicationprocess goal-termrequiresnarrowing,i.e.rewritingwherefreevariablesintheredexcan applicationofwave-rulesinthepresenceofsecond-ordermeta-variableswithinthe isguidedbytheapplicationofwave-rules.ingeneral,theapplicationofwave- Ourmethodforconstrainingtheapplicationofrewriteruleswithinthecontext ingure3.second-orderunicationwill,ingeneral,leadtoanon-terminatingsequenceofwave-ruleapplications.forthisreasonprojectionsareusedtoeagerly terminateinwardripples.aprojectionisappliedwhenevertheimmediatesuper- ofskeletontermstructurewhichcontainssecond-ordermeta-variablesispresented termofasinktermisaninwarddirectedwave-front.analternativetooureager 5.1GuidingSecond-OrderUnication anddiscussthebenetsofthisapproach. sinktermsisthatitonlydealswithwave-frontswhichcontainsinglewave-holes. tracksandattemptsfurtherrippling.alimitationofourmethodforinstantiating respondingtobasecases.ondetectinganon-theoremthecriticmechanismback- conjecture.thecheckerevaluatesgroundinstancesoftheconjecture,typicallycor- counterexamplecheckerisusedtoltercandidateinstantiationsoftheschematic variablesmayofcoursegiverisetoanover-generalization,i.e.anon-theorem.a instantiationstrategyisdiscussedinx9.thestrategyofeagerinstantiationofmeta-

12 12 Goal-term(before): Wave-rule:f(bWc;c1(X;Y)"N;Z))f(bc2(Y)c;X;c3(Z;Y)#N) AndrewIrelandandAlanBundy Guidance: 1.Unifyallwave-termswithintheleft-hand-sideoftheselectedwave-rulewithwavetermswithintheselectedgoal-term.Successrequiresamatchbetweenwavedirections,wave-holesandwave-terms.Theprocessisrecursiveandworksfrom theinsideout,e.g. goal-term,e.g. f(m2(c1(a;b)"2;bl1c);c1(a;b)"2;m3(c1(a;b)"2;bl1c))) f(bwc;c1(a;b)"2;z))f(bc2(b)c;a;c3(z;b)#2) M1(c1(a;b)"2;bl1c) 2.Unifytheerasureoftheleft-hand-sideofthewave-rulewiththeerasureofthe Goal-term(after):f(bc2(b)c;a;c3(M3(c1(a;b)"2;bl1c);b)#2) 3.Matchallsinkswhichappearwithintheleft-hand-sideoftheselectedwave-rule withsinkswithintheselectedgoal-term. f(bl1c;c1(a;b)"2;m3(c1(a;b)"2;bl1c)))f(bc2(b)c;a;c3(m3(c1(a;b)"2;bl1c);b)#2) f(bc2(b)c;a;c3(m3(c1(a;b)"2;bl1c);b)#2) Notethatinstep3theremayexistmultiplesinksgivingrisetoalternativeprojections. egyduringtheplanningprocessenableseachalternativerippletobeexplored.although Eachprojectionresultsinadistinctripple.Ouruseofaniterativedeepeningsearchstrat- applicabletoinwarddirectedwave-fonts. illustratedintermsofanoutwarddirectedwave-front,theprocessdescribedaboveisalso Fig.3.AnnotatedSecond-OrderUnication

13 wave-rules(6)and(7)togive: Returningtothelistreversalexample,consideragainpatch(19)whichripplesby 8l0:list(A):reverse(M2(t;l0))=rev(t;M1(l0))` AutomaticVericationofFunctionswithAccumulatingParameters13 reverse(m2(h::t"2;blc))=rev(t;h::m1blc#2) 5.2ListReversalRevisited Notethatthewave-frontontheleft-hand-sideisnowclassiedassecondary.When- givesriseto: siedassecondary.sincebothwave-frontsareclassiedassecondarytheneither canberippledatthisstage.considerthewave-termontheleft-hand-side: everthemovementofawave-frontrequiressecond-orderunicationthenitisclas- Usingtheannotatedunicationprocessdescribedabovewave-rule(7)appliesand 8l0:list(A):reverse(rev(M3(t;l0);t)=rev(t;M1(l0))` reverse(rev(h::m3(h::t"2;blc)#2;t))=rev(t;h::m1blc#2) M2(h::t"2;blc) (21) givesrisetoagoaloftheform: instantiation,mentionedinx5.1,m1becomesx:xandm3tobex:y:y.this NotethatM2isinstantiatedtobex:y:rev(M3(x;y);x).Bytheprocessofeager Alternatively,ifpatch(20)isselectedthenwave-rules(6)and(7)applytogive: resultinggeneralizationcorrespondsto: Theinductionhypothesiscannowbeappliedbyinstantiatingl0tobeh::l.The 8l0:list(A):reverse(rev(l0;t)=rev(t;l0)` 8l0:list(A):M2(reverse(t);l0)=rev(t;M1(l0))` 8t:list(A):8l:list(A):reverse(rev(l;t))=rev(t;l) reverse(rev(bh::lc);t))=rev(t;bh::lc) Nowconsiderthewave-termontheleft-hand-sideoftheform: Usingtheannotatedunicationprocesswave-rule(8)nowappliestogive: M2(app(reverse(t);h::nil"2);blc)=rev(t;h::M1blc#2) app(reverse(t);app(h::nil;m3(app(reverse(t);h::nil)"2;blc))#2)=rev(t;h::m1blc#2) M2(app(reverse(t);h::nil)"2;blc) 8l0:list(A):app(reverse(t);M3(t;l0))=rev(t;M1(l0))` (22)

14 Simplifyingthesinkontheleft-hand-sideandinstantiatingl0tobeh::lenables NotethatM2isinstantiatedtobex:y:app(x;M3(x;y)).Againbytheprocess ofeagerinstantiationm1becomesx:xandm3tobex:y:ygiving: 148l0:list(A):app(reverse(t);l0)=rev(t;l0)` app(reverse(t);bapp(h::nil;l)c)=rev(t;bh::lc) AndrewIrelandandAlanBundy annotationstoguidetheunicationprocess.wecomparethebranchingrateswhen Usingthelistreversalexamplewenowconsiderthebenetsofusingmeta-level theapplicationofinductionhypothesis.notethattheresultinggeneralizationcorresponds(2).5.3thebenetsofmeta-levelguidancamplegivesriseto49wave-rules. applyingannotatedandunannotatedrewriterules.asmentionedinx2.2thisex- eliminatesallbutthefollowing4wave-rules: Firstly,consideragain(21),forthisgoal-termtheannotatedunicationprocess reverse(x::y"))app(reverse(y);x::nil)" Thisshouldbecomparedwithunannotatedunicationwhichgivesriseto18applicablerewriterules. Secondly,inthecaseof(22)theannotatedunicationprocessagaineliminates rev(y;x::z"))rev(x::y#;z) app(x::y";z))x::app(y;z)" rev(x::y";z))rev(y;x::z#) allbut4wave-rules,i.e. app(app(x;y)";z))app(x;app(y;z)#) app(x;app(y;z)"))app(app(x;y);z)" wave-rulesshouldthenbecomparedwiththeresultsofunannotatedunication whichagaingivesriseto18applicablerewriterules. Notethatonlytherstthreeofthesewillactuallyapplysincethethirdisruled-out byprecondition4oftheripplemethod,i.e.sink-ability.the3remainingapplicable app(reverse(y);x::nil)")reverse(x::y#) X::app(Y;Z)")app(X::Y;Z)" cationtheyalsoconstrainthenumberofuniers.toillustrate,consideragain Whiletheannotationsreducethenumberofwave-rulesconsideredforuni-

15 theunicationofgoal-term(22)andtheleft-hand-sideofwave-rule(8).secondorderunicationgeneratestwopossibleuniers,i.e.x:y:app(x;m3(x;y))and skeletonpreservation(seex2.2),soisrejectedbytheannotatedunicationprocess. x:y:app(h::t;m2(x;y)).notethattherstisbaseduponprojectionthesecond usesimitation.theimitation,however,violatesthekeypropertyofrippling,i.e. AutomaticVericationofFunctionswithAccumulatingParameters15 Incontrollingthesearchforageneralizationweplaceanumberofconstraintson theproofplanningprocess: Planninginthecontextofschematictermstructuresrequiresabounded tobethesequence(s)oftermtreepositionswhichcanbereachedbythe ofripplepaths.givenawave-front,itsassociatedripplepathsaredened searchstrategy.weuseaniterativedeepeningstrategybaseduponthelength 6OrganizingtheSearchSpace Backtrackingovertheconstructionofsecondarysinktermsdealswiththe Sinceprimarysinktermsaremoreconstrainedthansecondarysinkterms choicepointissueraisedinx4.2. bethenumberofwave-ruleapplicationsusedinitsconstruction. applicationofwave-rules.thelengthofaparticularripplepathisdenedto Theextensionstothebasiccriticdescribedabovedirectlyaddressthelimitations highlightedinx3: priorityisgiventotheripplingofprimarywave-fronts. 2.Theissueofpositioningauxiliarysinkvariablesisdealtwithbytheability 1.Thelinkageofblockagetermswiththeintroductionofprimarysinkterms torevisetheconstructionofsecondarysinkterms. withintheschematicconjectureaddressestheissueofmultiplesinkvariables. 7ImplementationandTesting planner(bundyetal.,1990).theimplementationmakesuseofthehigher-order featuresof-prolog(miller&nadathur,1988).belowwedocumentthetestingof OurextendedcritichasbeenimplementedandintegratedwithintheCLAMproof ourimplementation.7.1experimentalresults 3.Byextendingthemeta-logictoincludethenotionsofprimaryandsecondary wave-frontsweareabletoexploittheobservationthatcertainsinktermsare moreconstrainedthanothersduringthesearchforgeneralizations. whichthebasiccriticmissed.moreover,anumberofnewexamplesweregeneralizedbytheextendedcriticforwhichtheapplicationofthebasiccriticresultedin bytheextendedcritic.theextendedcritic,however,discoveredgeneralizations Theresultspresentedin(Ireland&Bundy,1996)forthebasiccriticwerereplicated

16 proverssuchasnqthm(boyer&moore,1979).therelativeperformanceofthe failure.ourresultsaredocumentedinthetablesgiveninappendixc.theexampleconjecturesforwhichtheextendedcriticimprovesupontheperformanceofthe basicandextendedcriticsontheexampleconjecturesisrecordedintableii.the AndrewIrelandandAlanBundy 16 basiccriticarepresentedintablei.alltheexamplesrequireaccumulatorgeneralizationandthereforecannotbeprovedautomaticallybyotherinductivetheorem lemmatausedinmotivatingthegeneralizationsarepresentedintableiiiwhilethe actualgeneralizedconjecturesaregivenintableiv.allthesegeneralizationsare discoveredautomatically,i.e.nouserintervention. funatendxnil=(x::nil) funsplitxy=split11xnily; valatend=fn:'a->'alist-> siderthefunctionsdenedingure4.rewriterulesderivedfromthesedenitions Wenowillustrateourgeneralizationtechniqueusingamorerealisticexample.Con- atendx(y::z)=y::(atendxz);valsplit=fn:nat->'alist 7.2ACaseStudy funsplit1vwxnil=(x::nil) valapp=fn:'alist->'alist then if(v>w) else split1vwx(y::z)= x::(split12w(y::nil)z)valmap=fn:('a->'b)->'alist funmapxnil=nil funappnilz=z mapx(y::z)=(xy)::(mapxz); app(x::y)z=x::(appyz); ->'alistlist valsplit1=fn:nat->nat (split1v+1w(atendyx)z);funreducexnil=nil ->'alist->'alist reducex(y::z)= areamongthosegiveninappendixa.usingthesedenitionswecanspecifyan ->'alistlist Fig.4.Examplelistprocessingfunctions valreduce=fn:('a->'blist-> 'blist)->'alist-> (xy(reducexz)); aconjectureoftheform: equivalencebetweenasingleandadistributedapplicationofthemapfunctionby Thisconjecturewasprovidedbyanindependentresearchgroupworkingonthe astomakesitesofpotentialparallelismexplicit.conjecture(23)issuchatransformation.provingthecorrectnessoftransformationsiscurrentlyundertakenby 8t:list(A):8f:A!B:8n:IN: developmentofparallelsystemsfromfunctionalprototypes(michaelson&scaife, 1995).Theirdevelopmentprocessinvolvestransformingfunctionalprototypesso map(f;t)=reduce(x:y:app(x;y);map(x:map(f;x);split(n;t)))(23)

17 techniquesweresuccessfulinautomaticallyndingaproofof(23). handandrepresentsatimeconsuminghurdletotheresearchproject.havingfailed ofrewriterule(26)givesrisetoarenedgoaloftheform: toproveconjecture(23)byhanditwaspassedtousasachallengetheorem.our Inordertoprove(23)wemustrstunfoldthedenitionofsplit.Anapplication AutomaticVericationofFunctionswithAccumulatingParameters17 derforaninductiveproofattempttosucceed.anaccumulatorgeneralizationis required.thegeneralizedconjecturetakestheform: Aproofof(24)requiresinduction.However,(24)mustrstbegeneralizedinor- 8t:list(A):8f:A!B:8n:IN: map(f;t)=reduce(x:y:app(x;y);map(x:map(f;x);split1(1;n;nil;t)))(24) roleourextendedcriticplaysinautomatingthediscoveryof(25),therequired Notethetwonewuniversallyquantiedvariablesl1andl2.Wefocusuponthe 8t:list(A):8f:A!B:8n:IN:8l1:IN:8l2:list(A): derivedfromdenitions.7.2.1firstproofattempt: generalization,anditsproof.thewave-rulesrequiredforthisproofaregivenin appendixb.withtheexceptionofwave-rules(31)and(32)allthewave-rulesare map(f;app(l2;t))= reduce(x:y:app(x;y);map(x:map(f;x);split1(l1;n;l2;t)))(25) Aninductiveproofof(24)requiresinductiononthestructureofthelistt.The basecasegoalistrivial.wefocushereonthestepcasegoalwhichgivesrisetoan inductionhypothesisoftheform: 8f0:A!B:8n0:IN: andaninductionconclusionoftheform: map(bfc;h::t")= map(f0;t)=reduce(x:y:app(x;y);map(x:map(f0;x);split1(1;n0;nil;t))) theblockageterms1andnilwhichoccurintherstandthirdargumentpositionsofsplit1.triggeredbytheseblockagetermstheextendedgeneralizationcritic 8f0:A!B:8n0:IN:8l01:IN:8l02:list(A) Wave-rule(29)isapplicable,however,wave-rules(28)and(27)arenotbecauseof generatesaschematichypothesisoftheform: reduce(x:y:app(x;y);map(x:map(bfc;x);split1(1;bnc;nil;h::t") blocked {z })) map(f0;m3(t;l01;l02))= reduce(x:y:app(x;y);map(x:map(f0;x);split1(m1(l01);n0;m2(l02);t)))

18 map(bfc;m3(h::t"2;bl1c;bl2c))= whiletheschematicconclusiontakestheform: 18reduce(x:y:app(x;y); map(x:map(bfc;x);split1(m1(bl1c);bnc;m2(bl2c);h::t"1))) AndrewIrelandandAlanBundy Notethattheblockageterms1andnilhavebeenreplacedbyprimarysinkterms sideofthegoalequationisclassiedassecondaryandconsequentlyitisassociated withasecondarysinktermwhichcontainsoccurrencesofl1andl2. M1(bl1c)andM2(bl2c)respectively.Notealsothatthewave-frontontheleft-hand- ripplingofprimarywave-frontssothereisnochoiceastowhichwave-rulesshould beinitiallyapplied.theintroductionofsinktermsm1(bl1c)andm2(bl2c)enable Theripplemethodisnowappliedtotheschematicgoal.Priorityisgiventothe wave-rules(27)and(28)tobeapplied.jointlytheymotivateacasesplitonm1(l1) andn Secondproofattempt: Usingwave-rule(27)theright-hand-sideoftheconclusionripplestogive: Notethattheconstraintsoftheannotatedunicationprocess(seegure3,step :::=reduce(x:y:app(x;y); map(x:map(bfc;x);l2::split1(b2c;bnc;bh::nilc;t)"1) Case:M1(l1)>n: rule(30)gives: Notethatthewave-fronthasbeen-reduced.Afurtheroutwardrippleusingwave- 3)instantiateM1andM2tobex:x.Bywave-rule(29)theconclusionripples furthertogive: :::=reduce(x:y:app(x;y); Theleft-hand-sideoftheconclusioncontainsasecondarysinktermsorippling :::=app(map(f;l2);reduce(:::;map(:::;split1(b2c;bnc;bh::nilc;t))))"1 map(f;l2)::map(:::;split1(b2c;bnc;bh::nilc;t))"1 involvesmoresearch.asmentionedinx6aniterativedeepeningsearchstrategyis employed.usingannotatedunicationwave-rule(31)appliesgivingriseto: app(map(f;l2);map(bfc;app(bh::nilc;t)))"2=:::

19 rule(33)theripplingoftheconclusioniscomplete: map(bfc;app(bh::nilc;t))= Theapplicationof(31)instantiatesM3tobex:y:z:app(z;x).Finally,bywave- Theinductionhypothesiscanbeappliedbyinstantiatingl01tobe2andl02to reduce(x:y:app(x;y);map(x:map(bfc;x);split1(b2c;bnc;bh::nilc;t))) AutomaticVericationofFunctionswithAccumulatingParameters19 remainingbranchofthecasesplit.case:l1n: Usingwave-rule(28)asidewaysripplecanbeappliedtotheright-hand-sideofthe beh::nil.theinstantiationsform1,m2andm3arepropagatedthroughthe conclusion: Theleft-hand-sideoftheconclusionisoftheform: :::=reduce(x:y:app(x;y); map(x:map(bfc;x);split1(bl1+1c;bnc;batend(h;l2)c;t))) Theripplinginthisbranchofthecasesplitiscomplete: towhichwave-rule(32)appliesgiving: map(bfc;app(batend(h;l2)c;t))= map(bfc;app(batend(h;l2)c;t))=::: map(bfc;app(bl2c;h::t"1))=::: canbeconstructedbyclamcompletelyautomatically. automaticallygenerated(25),therequiredgeneralizationof(24).aproofof(25) Theinductionhypothesiscanbeappliedbyinstantiatingl01tobel1+1andl02to beatend(h;l2). Tosummarize,theripplemethodinconjunctionwiththeextendedcritichave reduce(x:y:app(x;y);map(x:map(bfc;x); split1(bl1+1c;bnc;batend(h;l2)c;t))) generalizationsbaseduponthefailureofanunfoldingstrategy.basicallyheused InAubin'sthesis(Aubin,1976)hepresentsatechniquefordiscoveringaccumulator ofwhatwecallprimarysinks.withregardtosecondarysinks,aubinappealstoa notionofanequationbeing\balanced".thatis,asinkshouldoccuronbothsides ofanequality. themismatchbetweentheconclusionandhypothesistosuggesttheintroduction 8RelatedWork eralizationinthecontextofproofplanningandrippling.herapproach,however, Heskethinherthesis(Hesketh,1991)tackledtheproblemofaccumulatorgen-

20 didnotdealwithmultiplesinks.byintroducingtheprimaryandsecondaryclassicationofwave-frontswebelievethatourapproachprovidesgreatercontrolin thesearchforgeneralizations.thisbecomescrucialasthecomplexityxofexamplesincreases.inaddition,weusesinkannotationsexplicitlyinselectingpotential projectionsforhigher-ordermeta-variables. Jane'swork,however,wasmuchbroaderthanoursinthatsheuniedanum- AndrewIrelandandAlanBundy 20 areembeddedwithintheactualunicationalgorithm. berofdierentkindsofgeneralization.moreover,shewasalsoabletosynthesize Kohlhase,1997)whereessentiallythestructurepreservationconstraintsofrippling 1992). tail-recursivefunctionsgivenequivalentnaiverecursivedenitions(heskethetal., Analternativetoourstrategyofannotatedunicationispresentedin(Hutter& tothatofaninductionhypothesiswithinastepcaseproof.asaresult,theripple tures.thisisreectedatthelevelofproofwheretheinvariantplaysarolesimilar belowwhereweoutlinethekeyareaswherewearedevelopingthiswork. Ourresultsfortheextendedcritichavebeenpromising.Webelievethatourtechniqueisnotrestrictedtoreasoningaboutfunctionalprograms.Thisisdiscussed Thereexistsastrongconnectionbetweenloopinvariantsandinductiveconjec- 9FutureWork typicallyseenasthemajoreurekastepintheprocessofverifyinganimperative usingthecriticmechanism(ireland&stark,1997).discoveringaloopinvariantis ants.ourworkonproofcriticsisbeingtransferredacrosstothisnewdomain.in particular,wehavebeguntoinvestigatetheautomaticdiscoveryofloopinvariants techniquecanbeusedtoguidethesearchforaproofwhenverifyingloopinvari- samepatternofsidewaysripplingwhichoccurswithininductiveproofwheresinks areexploited.initialexperimentshavedemonstratedthatourcriticforaccumulator notionofatailinvariant(kaldewaij,1990)representsonesuchwayofderivingan program.acommonstrategyfordiscoveringinvariantsistostartwithadesired generalizationcanalsoplayaroleinthediscoveryoftailinvariants. invariant.usingripplingtoguidethevericationoftailinvariantsgivesrisetothe post-conditionfromwhichtheinvariantisderivedbyaprocessofweakening.the interaction.ashighlightedinx5,thecritic'smechanismmaygenerateapartialgeneralization.aninteractiveversionofthecriticmechanismhasbeenimplementeever,thatthecriticmechanismalsoprovidesabasisfordevelopingeectiveuser (Irelandetal.,1997)whichinvitesausertocompletetheinstantiationofsuch partialgeneralizations. proverwhichwasmorerobustthanconventionalprovers.thehigh-levelrepresentationprovidedbyaproofplanenabledustoachievethisgoal.webelieve,how- Thecriticmechanismwasmotivatedbyadesiretobuildanautomatictheorem xthatis,asthenumberofdenitionsandlemmataavailabletotheproverincreases. Wealsobelievethatourtechniqueisapplicableinthecontextofhardwareveri-

Number of objects. 16 32 64 128 256 512 1k 2k 4k 8k 16k 32k 64k 128k256k512k 1m 2m 4m 8m

Number of objects. 16 32 64 128 256 512 1k 2k 4k 8k 16k 32k 64k 128k256k512k 1m 2m 4m 8m GarbageCollectionforLargeMemoryJava AndreasKrallandPhilippTomsich Applications InstitutfurComputersprachen,TechnischeUniversitatWien Argentinierstrae8,A{1040Wien,Austria tolarge,data-intensivescienticapplicationsallocatingmemoryinthe

More information

NetworksofWorkstationswithBalanced SNOWBALL:ScalableStorageon RadekVingraleky YuriBreitbartz Load GerhardWeikumx performanceparallelanddistributedsystems.exploitingnetworksofwork- Abstract stationsformassivedatamanagementposesexcitingchallenges.wecon-

More information

threads threads threads

threads threads threads AHybridMultithreading/Message-PassingApproachforSolving IrregularProblemsonSMPClusters Jan-JanWu InstituteofInformationScience AcademiaSinica Taipei,Taiwan,R.O.C. Chia-LienChiang Nai-WeiLin Dept.ComputerScience

More information

GateLevelDescriptionofSynchronous ThesisfortheDegreeofDoctorofPhilosophy AutomaticVericationBasedon Hardware TheoremProving and PerBjesse ChalmersUniversityofTechnologyandGoteborgUniversity DepartmentofComputingScience

More information


However,duetoboththescaleandthecomplexityoftheInternet,itisunlikelythatameasure- Part1:AServer-BasedMeasurementInfrastructure NetworkPerformanceMeasurementandAnalysis Y.ThomasHou (ConceptPaper) AsInternettraccontinuestogrowexponentially,itisessentialforboththeusersandserviceproviders

More information

1 Plane and Planar Graphs. Definition 1 A graph G(V,E) is called plane if

1 Plane and Planar Graphs. Definition 1 A graph G(V,E) is called plane if Plane and Planar Graphs Definition A graph G(V,E) is called plane if V is a set of points in the plane; E is a set of curves in the plane such that. every curve contains at most two vertices and these

More information

CallForwarding: ASimpleInterproceduralOptimizationTechnique. fordynamicallytypedlanguages

CallForwarding: ASimpleInterproceduralOptimizationTechnique. fordynamicallytypedlanguages CallForwarding: ASimpleInterproceduralOptimizationTechnique fordynamicallytypedlanguages KoenDeBosschere;ySaumyaDebray;zDavidGudeman;zSampathKannanz ydepartmentofelectronics UniversiteitGent B-9000Gent,Belgium

More information

Get started with common support tasks

Get started with common support tasks Get started with common support tasks CRM Online Spring '14 or CRM 013 Service Pack 1 (on-premises) Go to the Service work area and get started with creating cases. 1 3 4 Before you create a new customer

More information

AmyP.Felty1,DouglasJ.Howe1,andFrankA.Stomp2 ProtocolVericationinNuprl? 2Dept.ofComp.Sci.,UCDavis,Davis,CA95616,USA.stomp@cs.ucdavis.edu 1BellLabs,MurrayHill,NJ07974,USA.ffelty,howeg@bell-labs.com whileretainingexistingadvantagesofthesystem,anddescribesapplicationoftheprovertoverifyingthescicachecoherenceprotocol.the

More information

68HC12 and HCS12 Instruction Set

68HC12 and HCS12 Instruction Set A 68HC12 and HCS12 Instruction Set Used with permission of Motorola, Inc. A-1 A-2 68HC12 and HCS12 Instruction Set Appendix A Appendix A 68HC12 and HCS12 Instruction Set A-3 CPU12 REFERENCE GUIDE A-4 68HC12

More information


Ourmainaiminthispaperistovisuallyunderstandthespatialrelationshipsbetween ClassVisualizationofHigh-DimensionalDatawith InderjitS.Dhillon,DharmendraS.Modha,andW.ScottSpangler Emailforcorrespondence:dmodha@almaden.ibm.com 65HarryRoad,SanJose,CA9512-699 IBMAlmadenResearchCenter

More information

Automated Software Testing With Macro Scheduler

Automated Software Testing With Macro Scheduler Automated Software Testing With Macro Scheduler Copyright 2005 MJT Net Ltd Introduction Software testing can be a time consuming task. Traditionally QA technicians and/or programmers would sit in front

More information

Homework Three Solution CSE 355

Homework Three Solution CSE 355 Homework Three Solution CSE 355 Due: 06 March 2012 Please note that there is more than one way to answer most of these questions. The following only represents a sample solution. Problem 1: Linz 4.1.13

More information

The Prime Numbers. Definition. A prime number is a positive integer with exactly two positive divisors.

The Prime Numbers. Definition. A prime number is a positive integer with exactly two positive divisors. The Prime Numbers Before starting our study of primes, we record the following important lemma. Recall that integers a, b are said to be relatively prime if gcd(a, b) = 1. Lemma (Euclid s Lemma). If gcd(a,

More information

! "#"$%$%&'$% ($& )*( &+,% (&'$% -&&'$%.&/$(% )&""4( *,,3" ท มา : ส าน กนายกร ฐมนตร www.opm.go.th/opminter/download/download.

! #$%$%&'$% ($& )*( &+,% (&'$% -&&'$%.&/$(% )&4( *,,3 ท มา : ส าน กนายกร ฐมนตร www.opm.go.th/opminter/download/download. ! "#"$%$%&'$% ($& )*( &+,% (&'$% -&&'$%.&/$(% *(012)"0,3" )&""4( *,,3" )&"+&5)&""& %3 ท มา : ส าน กนายกร ฐมนตร www.opm.go.th/opminter/download/download.html หน า 1 ท มา : ส าน กนายกร ฐมนตร www.opm.go.th/opminter/download/download.html

More information

SCHOOLOFCOMPUTERSTUDIES RESEARCHREPORTSERIES UniversityofLeeds Report95.23. AutomaticDetectionofKeySignature usingnotedistribution

SCHOOLOFCOMPUTERSTUDIES RESEARCHREPORTSERIES UniversityofLeeds Report95.23. AutomaticDetectionofKeySignature usingnotedistribution SCHOOLOFCOMPUTERSTUDIES RESEARCHREPORTSERIES UniversityofLeeds Report95.23 AutomaticDetectionofKeySignature usingnotedistribution DivisionofArticialIntelligence,SchoolofComputerStudies K.C.Ng,R.D.Boyle&D.Coopery

More information


programsitproduces.finally,weshowhowtoproduceecient,optimizingprogramgeneratorsby TopicsinOnlinePartialEvaluation TechnicalReport:CSL-TR-93-563 (alsofusememo93-14) March,1993 ErikRuf DepartmentsofElectricalEngineering&ComputerScience ComputerSystemsLaboratory Partialevaluationisaperformanceoptimizationtechniqueforcomputerprograms.Whenaprogram

More information

MulticastGroupCommunicationasaBasefora Load-BalancingReplicatedDataService 2BasserDept.ofCS,MadsenF09,UniversityofSydney,NSW2006,Australia. 1MITLCS,545TechnologySquare,NE43-365,Cambridge,MA02139,USA. RogerKhazan1,AlanFekete2,andNancyLynch1

More information

MobileCodeParadigmsandTechnologies: CarloGhezziandGiovanniVigna ACaseStudy Dip.ElettronicaeInformazione,PolitecnicodiMilano P.zaL.DaVinci23,20100Milano,Italy Abstract.TheopportunitiesoeredbytheInternetareencouraging

More information

Math Released Set 2015. Algebra 1 PBA Item #13 Two Real Numbers Defined M44105

Math Released Set 2015. Algebra 1 PBA Item #13 Two Real Numbers Defined M44105 Math Released Set 2015 Algebra 1 PBA Item #13 Two Real Numbers Defined M44105 Prompt Rubric Task is worth a total of 3 points. M44105 Rubric Score Description 3 Student response includes the following

More information

Finding Rates and the Geometric Mean

Finding Rates and the Geometric Mean Finding Rates and the Geometric Mean So far, most of the situations we ve covered have assumed a known interest rate. If you save a certain amount of money and it earns a fixed interest rate for a period

More information

AGraphDrawingandTranslationServiceon StinaBridgeman,AshimGargandRobertoTamassia DepartmentofComputerScience thewww*

AGraphDrawingandTranslationServiceon StinaBridgeman,AshimGargandRobertoTamassia DepartmentofComputerScience thewww* AGraphDrawingandTranslationServiceon StinaBridgeman,AshimGargandRobertoTamassia DepartmentofComputerScience thewww* Abstract.Bothpractitionersandresearcherscantakebetteradvantageofthelatestdevelopmentsingraphdrawingifimplementationsof

More information

At the Post Office. Everyday Dialogues ESL Lesson Plans ESL-Images.com. At the Post Office

At the Post Office. Everyday Dialogues ESL Lesson Plans ESL-Images.com. At the Post Office A. Dialogue Postal Clerk: Can I help you? Customer: Yes. I d like to send this package to Toronto, Canada. Postal Clerk: How would you like to send it? Customer: How much will it be by airmail? Postal

More information

!!! Luxury!Institute s!21 st!century!career!advice!you!can t!afford!to!ignore:! An!Open!Letter!to!Luxury!Retail!Sales!Associates!!!

!!! Luxury!Institute s!21 st!century!career!advice!you!can t!afford!to!ignore:! An!Open!Letter!to!Luxury!Retail!Sales!Associates!!! LuxuryInstitute s21 st CenturyCareerAdviceYouCan taffordtoignore: AnOpenLettertoLuxuryRetailSalesAssociates ByMiltonPedraza,CEOoftheLuxuryInstitute,LLC (NewYork)April6,2016 InastalledU.S.economywheretheaverageyoung

More information

Get started with common support tasks in Microsoft Dynamics CRM

Get started with common support tasks in Microsoft Dynamics CRM Get started with common support tasks in Microsoft Dynamics CRM CRM Online Spring '14 or CRM 2013 Service Pack 1 or later (on-premises) If your screen looks like this (latest version): On the nav bar,

More information

Mathematical Induction

Mathematical Induction Mathematical Induction Definition of Structures A powerful proof technique for proving theorems about recursively defined data structures is mathematical induction. It goes beyond first-order logic. It

More information

JasonMcHugh,SergeAbiteboul,RoyGoldman,DallanQuass,JenniferWidom. fmchughj,abitebou,royg,quass,widomg@db.stanford.edu

JasonMcHugh,SergeAbiteboul,RoyGoldman,DallanQuass,JenniferWidom. fmchughj,abitebou,royg,quass,widomg@db.stanford.edu Lore:ADatabaseManagementSystemforSemistructuredData JasonMcHugh,SergeAbiteboul,RoyGoldman,DallanQuass,JenniferWidom StanfordUniversity fmchughj,abitebou,royg,quass,widomg@db.stanford.edu http://www-db.stanford.edu/lore

More information

Types, Polymorphism, and Type Reconstruction

Types, Polymorphism, and Type Reconstruction Types, Polymorphism, and Type Reconstruction Sources This material is based on the following sources: Pierce, B.C., Types and Programming Languages. MIT Press, 2002. Kanellakis, P.C., Mairson, H.G. and

More information

Department of Mathematics Exercises G.1: Solutions

Department of Mathematics Exercises G.1: Solutions Department of Mathematics MT161 Exercises G.1: Solutions 1. We show that a (b c) = (a b) c for all binary strings a, b, c B. So let a = a 1 a 2... a n, b = b 1 b 2... b n and c = c 1 c 2... c n, where

More information

Your Bill explained PDF. Your bills explained. A comprehensive guide to understanding your bill. npm9919/05.12

Your Bill explained PDF. Your bills explained. A comprehensive guide to understanding your bill. npm9919/05.12 1 Your bills explained A comprehensive guide to understanding your bill 2 Your details This is the address where we send your bills and where your gas and electricity is normally supplied to. If your energy

More information


ACCOUNTS PAYABLE VOUCHER ADJUSTMENT ACCOUNTS PAYABLE VOUCHER ADJUSTMENT TRANSACTION ENTRY OVERVIEW Use Vision Transaction Center to enter and maintain data on various types of transactions, such as disbursements, expenses, invoices, and

More information

obelis media ObelisMedia.com PROPOSAL Prepared for: Affordable Pumping Services Prepared by: Robbie Bright-Poole

obelis media ObelisMedia.com PROPOSAL Prepared for: Affordable Pumping Services Prepared by: Robbie Bright-Poole ROPOSAL obelis media ObelisMedia.com PROPOSAL Prepared for: Affordable Pumping Services Prepared by: Robbie Bright-Poole (877) 962-3547 RobbiePoole@obelismedia.com Introduction Obelis Media is pleased

More information

Desktop Client Application User Guide

Desktop Client Application User Guide Desktop Client Application User Guide Version 6 8/21/2009 OAISYS 7965 S. Priest Drive, Suite 105 Tempe, AZ 85284 (480) 496-9040 OAISYS Desktop Client Application User Guide 1 Installation Browse to your

More information

Switch To Volunteer State Bank

Switch To Volunteer State Bank Switch To Volunteer State Bank It s Quick and Easy... Just print the forms below and follow these instructions. Step 1: Complete our New Account Information Form, so we ll have what we need to open your

More information

Please note that there is more than one way to answer most of these questions. The following only represents a sample solution.

Please note that there is more than one way to answer most of these questions. The following only represents a sample solution. HOMEWORK THREE SOLUTION CSE 355 DUE: 10 MARCH 2011 Please note that there is more than one way to answer most of these questions. The following only represents a sample solution. (1) 2.4 and 2.5 (b),(c),(e),(f):

More information

Switch To Walworth State Bank It s Quick and Easy...

Switch To Walworth State Bank It s Quick and Easy... Switch To Walworth State Bank It s Quick and Easy... Just print the forms below and follow these instructions. The forms can also be filled out online and then printed. Step 1: Complete our New Account

More information

6 Commutators and the derived series. [x,y] = xyx 1 y 1.

6 Commutators and the derived series. [x,y] = xyx 1 y 1. 6 Commutators and the derived series Definition. Let G be a group, and let x,y G. The commutator of x and y is [x,y] = xyx 1 y 1. Note that [x,y] = e if and only if xy = yx (since x 1 y 1 = (yx) 1 ). Proposition

More information


NOTES ON CATEGORIES AND FUNCTORS NOTES ON CATEGORIES AND FUNCTORS These notes collect basic definitions and facts about categories and functors that have been mentioned in the Homological Algebra course. For further reading about category

More information

Solving Linear Equations in One Variable. Worked Examples

Solving Linear Equations in One Variable. Worked Examples Solving Linear Equations in One Variable Worked Examples Solve the equation 30 x 1 22x Solve the equation 30 x 1 22x Our goal is to isolate the x on one side. We ll do that by adding (or subtracting) quantities

More information

Lesson Plan Solving One-Step Linear Inequalities. Teacher Candidate: Grade Level/Subject Unit Title Lesson Title Duration Lesson Outcomes

Lesson Plan Solving One-Step Linear Inequalities. Teacher Candidate: Grade Level/Subject Unit Title Lesson Title Duration Lesson Outcomes Teacher Candidate: Grade Level/Subject Unit Title Lesson Title Duration Lesson Outcomes Chiara Shah 9 th /Algebra I Unit 4: Solving and Graphing Inequalities 6.1 Solving One-Step Linear Inequalities 45

More information

Exponent Properties Involving Products

Exponent Properties Involving Products Exponent Properties Involving Products Learning Objectives Use the product of a power property. Use the power of a product property. Simplify expressions involving product properties of exponents. Introduction

More information

Hands-on Practice. Using Microsoft PowerPoint Software on a SMART Board Interactive Whiteboard

Hands-on Practice. Using Microsoft PowerPoint Software on a SMART Board Interactive Whiteboard Using Microsoft PowerPoint Software on a SMART Board Interactive Whiteboard You make presentations for a reason to communicate a message. With a SMART Board interactive whiteboard, you can focus the attention

More information

COMMUTATIVE RINGS. Definition: A domain is a commutative ring R that satisfies the cancellation law for multiplication:

COMMUTATIVE RINGS. Definition: A domain is a commutative ring R that satisfies the cancellation law for multiplication: COMMUTATIVE RINGS Definition: A commutative ring R is a set with two operations, addition and multiplication, such that: (i) R is an abelian group under addition; (ii) ab = ba for all a, b R (commutative

More information

When will my money be available in the Transfer To account?

When will my money be available in the Transfer To account? Transfers FAQs Transferring money When will you transfer my money? We ll initiate the transfer on the date you specified when you set up the transfer. To check the status of a pending transfer, click Transfer

More information

A Hajós type result on factoring finite abelian groups by subsets II

A Hajós type result on factoring finite abelian groups by subsets II Comment.Math.Univ.Carolin. 51,1(2010) 1 8 1 A Hajós type result on factoring finite abelian groups by subsets II Keresztély Corrádi, Sándor Szabó Abstract. It is proved that if a finite abelian group is

More information

PayPal Usage Document

PayPal Usage Document For the Administrator, PayPal Usage Document Before choosing the PayPal as the default payment gateway, the Administrator must know some things. First, the DUT system only accepts the Completed payment

More information

Switch To The First National Bank of Eagle Lake

Switch To The First National Bank of Eagle Lake Switch To The First National Bank of Eagle Lake It s Quick and Easy... Just print the forms below and follow these instructions. Step 1: Complete our New Account Information Form, so we ll have what we

More information

WebScheduler TotalFBO TotalFBO Initial Installation TotalFBO Connecting to a Database TotalFBO

WebScheduler TotalFBO TotalFBO Initial Installation TotalFBO Connecting to a Database TotalFBO WebScheduler WebScheduler is a plug-in to TotalFBO which provides an online interface to your database. This enables customers and staff to view, change, and delete their own appointments as well as print

More information

A Beginner s Guide to Google Analytics. by Ben Barden

A Beginner s Guide to Google Analytics. by Ben Barden A Beginner s Guide to Google Analytics by Ben Barden Third Edition Updated 19/10/2014 Contents Getting Started... 3 Introduction... 3 Get the code... 3 Orientation... 4 Jargon Buster... 4 Understanding

More information

Towards Interface Types for Haskell

Towards Interface Types for Haskell Towards Interface Types for Haskell Work in Progress Peter Thiemann Joint work with Stefan Wehr Universität Freiburg, Germany WG 2.8 Meeting, Nesjavellir, Island, 17.07.2007 What is a type class? A type

More information

Appeals: Eligibility & Health Plan Decisions in the Health Insurance Marketplace

Appeals: Eligibility & Health Plan Decisions in the Health Insurance Marketplace Appeals: Eligibility & Health Plan Decisions in the Health Insurance Marketplace There are 2 kinds of appeals you can make once you ve applied and enrolled in coverage through the Health Insurance Marketplace:

More information

Online event registration User guidelines

Online event registration User guidelines Online event registration User guidelines Outlined below are detailed guidelines on how to register for CEDA events at www.ceda.com.au. Read through the guidelines or click the links below to jump to a

More information

Note: This information copied with permission. Thanks to Kevin K. Custer W3KKC, Masters Communications, Inc.

Note: This information copied with permission. Thanks to Kevin K. Custer W3KKC, Masters Communications, Inc. TV Channel, CATV and FM Broadcast Frequencies Note: This information copied with permission. Thanks to Kevin K. Custer W3KKC, Masters Communications, Inc. Newsgroups: sci.electronics From: andy@cbrown.claremont.edu

More information

Figure 1.1. The visualizations you ll develop.


More information


Thepurposeofahospitalinformationsystem(HIS)istomanagetheinformationthathealth FederatedDatabaseSystemsforReplicatingInformationin UniversityofDortmund,DepartmentofComputerScience,Informatik10 ExtendingtheSchemaArchitectureof E-mail:willi@ls10.informatik.uni-dortmund.de HospitalInformationSystems

More information

Newton s Law of Universal Gravitation

Newton s Law of Universal Gravitation Newton s Law of Universal Gravitation The greatest moments in science are when two phenomena that were considered completely separate suddenly are seen as just two different versions of the same thing.

More information

Guest Quick Guide PC and Mac Users Updated to version 3.5.8 March 2015

Guest Quick Guide PC and Mac Users Updated to version 3.5.8 March 2015 Guest Quick Guide PC and Mac Users Updated to version 3.5.8 March 2015 Table of Contents Welcome to imeet 3 Sign in and join a meeting (via the imeet desktop app) 4 Sign in and join a meeting (via a Web

More information

Internet!of!Services! Project!IntroducMon!

Internet!of!Services! Project!IntroducMon! Internet!of!Services! Project!IntroducMon! Prof.!Dr.!Küpper,!S.!Göndör,!S.!Zickau,!M.!Slawik,!et!al.! ServiceIcentric!Networking! Telekom!InnovaMon!Laboratories!and!TU!Berlin! Introduc)on* Project!OrganizaMon!!

More information

Personal Loan. This document sets out your loan s terms and conditions. Some key information about your loan. Terms and Conditions

Personal Loan. This document sets out your loan s terms and conditions. Some key information about your loan. Terms and Conditions Personal Loan Terms and Conditions This document sets out your loan s terms and conditions In this document we ve explained the terms and conditions applying to your ANZ Personal Loan. It includes key

More information

Crossing the Bridge at Night

Crossing the Bridge at Night A1:01 Crossing the Bridge at Night Günter Rote Freie Universität Berlin, Institut für Informatik Takustraße 9, D-14195 Berlin, Germany rote@inf.fu-berlin.de A1:02 August 21, 2002 A1:03 A1:04 Abstract We

More information

Banner Document Management (BDM) Basics

Banner Document Management (BDM) Basics Banner Document Management (BDM) Basics Banner Document Management (BDM) (previously called BDMS, BXS, or WebXtender) is the University s program for storing and viewing images of financial documents such

More information

Dutch Parallel Corpus

Dutch Parallel Corpus Dutch Parallel Corpus Lieve Macken lieve.macken@hogent.be LT 3, Language and Translation Technology Team Faculty of Applied Language Studies University College Ghent November 29th 2011 Lieve Macken (LT

More information

How to Pay My Bill - Students and Authorized Payers

How to Pay My Bill - Students and Authorized Payers How to Pay My Bill - Students and Authorized Payers How to Pay my Bill Students can pay their ebill by going to their HUB Student Center, under the Finances section and clicking on the payment options

More information

c::: .=::J PI ES MIL-STD-704 DC tests ITZENBERGER

c::: .=::J PI ES MIL-STD-704 DC tests ITZENBERGER MIL-STD-704 DC tests - avionic test standard Part 2 - DC supply systems at a glance Aircraft electrical DC power characteristics The relating standards: RTCA DO 160 Airbus ABD 0100.1.8.(A380) Airbus ABD

More information


SEMINAR NOTES: G-BUNDLES, STACKS AND BG (SEPT. 15, 2009) SEMINAR NOTES: G-BUNDLES, STACKS AND (SEPT. 15, 2009) DENNIS GAITSGORY 1. G-bundles 1.1. Let G be an affine algebraic group over a ground field k. We assume that k is algebraically closed. Definition 1.2.

More information


http://office.microsoft.com/client/15/help/preview?assetid=ha103466460&lcid=1033&n... Page 1 of 5 Lync Web Scheduler Microsoft Lync Web Scheduler is a web-based program that you can use to create Lync Meetings if you don t have Microsoft Outlook, or are on an operating system not based

More information

Combined Business Loan

Combined Business Loan Combined Business Loan Terms and Conditions This document sets out your loan or facility s terms and conditions In this document we ve explained the terms and conditions applying to your ANZ Business Loan

More information

MRS Title 9-A 8-103. Definitions and rules of construction

MRS Title 9-A 8-103. Definitions and rules of construction 9-A 8-103. Definitions and rules of construction The text included in this publication was prepared by the Maine Bureau of Financial Institutions and is current through July 15, 2008. It is a version that

More information

1.4 Compound Inequalities

1.4 Compound Inequalities Section 1.4 Compound Inequalities 53 1.4 Compound Inequalities This section discusses a technique that is used to solve compound inequalities, which is a phrase that usually refers to a pair of inequalities

More information

A Consumer s Guide to...

A Consumer s Guide to... A Consumer s Guide to... Selling Your Life Insurance Policy What You Should Know About Viatical and Life Settlements Paul R. LePage Governor Eric Cioppa Superintendent Table of Contents Definitions Get

More information

Sums of Generalized Harmonic Series (NOT Multiple Zeta Values)

Sums of Generalized Harmonic Series (NOT Multiple Zeta Values) Sums of Series (NOT Multiple Zeta Values) Michael E. Hoffman USNA Basic Notions 6 February 2014 1 2 3 harmonic series The generalized harmonic series we will be concerned with are H(a 1, a 2,..., a k )

More information

Change Control Plan Preparation Guidelines

Change Control Plan Preparation Guidelines Change Control Plan Preparation Guidelines TABLE OF CONTENTS 1. Purpose of Document 1 2. Objectives of Change Control Process 1 3. Terms, Acronyms and Abbreviations 1 4. Approval Authority for Changes

More information

Tree isomorphism. Alexander Smal. Joint Advanced Student School St.Petersburg State University of Information Technologies, Mechanics and Optics

Tree isomorphism. Alexander Smal. Joint Advanced Student School St.Petersburg State University of Information Technologies, Mechanics and Optics Tree isomorphism Alexander Smal St.Petersburg State University of Information Technologies, Mechanics and Optics Joint Advanced Student School 2008 1 / 22 Motivation In some applications the chemical structures

More information

2.1. Inductive Reasoning EXAMPLE A

2.1. Inductive Reasoning EXAMPLE A CONDENSED LESSON 2.1 Inductive Reasoning In this lesson you will Learn how inductive reasoning is used in science and mathematics Use inductive reasoning to make conjectures about sequences of numbers

More information

Comparing What s New in Blackboard Collaborate 12 to Blackboard Collaborate 11

Comparing What s New in Blackboard Collaborate 12 to Blackboard Collaborate 11 Comparing What s New in Blackboard Collaborate 12 to Blackboard Collaborate 11 Audio Echo Cancellation Blackboard Collaborate web conferencing has built-in echo cancellation which allows you to participate

More information

MERCHANT CHARGEBACK GUIDE. How to manage Inquiries and Upfront Chargebacks

MERCHANT CHARGEBACK GUIDE. How to manage Inquiries and Upfront Chargebacks MERCHANT CHARGEBACK GUIDE How to manage Inquiries and Upfront Chargebacks UNDERSTANDING MERCHANT CHARGEBACKS This guide is intended to provide general guidance on how to manage Inquiries and Chargebacks.

More information

LR Product Documentation Documentation

LR Product Documentation Documentation LR Product Documentation Documentation Release 2.5 The LR Team February 10, 2015 Contents 1 Getting Started Guide 1 1.1 Overview................................................. 1 1.2 About the Examples...........................................

More information

Home & Business Phone. Features User Guide

Home & Business Phone. Features User Guide Home & Business Phone Features User Guide 1 Welcome to ACN s Home and Business Phone Features This guide will help you use your phone features and discover what they can do for you. You now have some great

More information

Instructions for Bridge Line Scheduling

Instructions for Bridge Line Scheduling What is a Bridge Line Conference Call? A bridge line call is for three or more callers who want to conference together by telephone to conduct a meeting. Participants (callers) dial individually into the

More information

ANZ CashBack. programme guide

ANZ CashBack. programme guide ANZ CashBack programme guide CashBack rewards you for purchases you make with your CashBack card. Using your card CashBack Rewards CashBack rewards you for purchases you make with your CashBack card.

More information

DHA Lahore Ballot 2016

DHA Lahore Ballot 2016 Page 1 of 5 1 R001 Residential 1/L/000159 2 Kanal A 32,500,000 2 R002 Residential 1/N/00056/1 2 Kanal A 42,000,000 3 R003 Residential 2/S/00087/1 2 Kanal B 39,647,778 4 R004 Residential 2/V/00017 2 Kanal

More information

How to Overcome the Top Ten Objections in Credit Card Processing

How to Overcome the Top Ten Objections in Credit Card Processing How to Overcome the Top Ten Objections in Credit Card Processing Section #1: Handling the Red Flags Just Fax Your Rates Response: I ll be happy to do that, but until we know if this is truly a fit for

More information

Approximability of Two-Machine No-Wait Flowshop Scheduling with Availability Constraints

Approximability of Two-Machine No-Wait Flowshop Scheduling with Availability Constraints Approximability of Two-Machine No-Wait Flowshop Scheduling with Availability Constraints T.C. Edwin Cheng 1, and Zhaohui Liu 1,2 1 Department of Management, The Hong Kong Polytechnic University Kowloon,

More information

Kennesaw State University s Department of Sports and Recreation

Kennesaw State University s Department of Sports and Recreation Kennesaw State University s Department of Sports and Recreation Request for Information for A facility management software system that includes a group fitness scheduling and tracking solution STATEMENT

More information

Subnetting Examples. There are three types of subnetting examples I will show in this document:

Subnetting Examples. There are three types of subnetting examples I will show in this document: Subnetting Examples There are three types of subnetting examples I will show in this document: 1) Subnetting when given a required number of networks 2) Subnetting when given a required number of clients

More information

Solutions for Practice problems on proofs

Solutions for Practice problems on proofs Solutions for Practice problems on proofs Definition: (even) An integer n Z is even if and only if n = 2m for some number m Z. Definition: (odd) An integer n Z is odd if and only if n = 2m + 1 for some

More information



More information


YOUR CONTROL PANEL PANEL YOUR CONTROL PANEL PANEL To change your pass code, please contact Frontpoint Support at: 877-602-5276 support@frontpointsecurity.com Frontpoint Support: 877-602-5276 The Control Panel: System Codes After

More information

The Assessment Scales

The Assessment Scales Hong Kong Diploma of Secondary Education Examination The Assessment Scales HKEAA Dec 2009 SBA Requirements (1) The SBA comprises two tasks: (a) one task on mathematical investigation or problem-solving

More information

Business Loan. This document sets out your loan s terms and conditions. Contents of these terms and conditions. Terms and Conditions

Business Loan. This document sets out your loan s terms and conditions. Contents of these terms and conditions. Terms and Conditions Business Loan Terms and Conditions This document sets out your loan s terms and conditions In this document we ve explained the terms and conditions applying to your ANZ Business Loan. It includes key

More information

Sometimes it is easier to leave a number written as an exponent. For example, it is much easier to write

Sometimes it is easier to leave a number written as an exponent. For example, it is much easier to write 4.0 Exponent Property Review First let s start with a review of what exponents are. Recall that 3 means taking four 3 s and multiplying them together. So we know that 3 3 3 3 381. You might also recall

More information

The Two Envelopes Problem

The Two Envelopes Problem 1 The Two Envelopes Problem Rich Turner and Tom Quilter The Two Envelopes Problem, like its better known cousin, the Monty Hall problem, is seemingly paradoxical if you are not careful with your analysis.

More information

ImprovingRooftopDetectioninAerialImages MarcusA.Maloofy(maloof@apres.stanford.edu) ThroughMachineLearning PatLangleyy(langley@newatlantis.isle.org) ThomasBinfordz(binford@cs.stanford.edu) yinstituteforthestudyoflearningandexpertise

More information

Using the ecommerce Features in Drupal 6.0

Using the ecommerce Features in Drupal 6.0 Using the ecommerce Features in Drupal 6.0 Table of Contents Basics... 3 Creating a Product or Donation... 3 General Information... 3 Great Gathering Information... 3 Product Information... 4 Working with

More information

Patient Transport Service (PTS) Advice for Patients and Carers

Patient Transport Service (PTS) Advice for Patients and Carers Patient Transport Service (PTS) Advice for Patients and Carers What is the Patient Transport Service (PTS)? The non-emergency PTS is available for suitable patients referred for consultations, treatment

More information


User Guide FOR TOSHIBA STORAGE PLACE User Guide FOR TOSHIBA STORAGE PLACE (This page left blank for 2-sided "book" printing.) Table of Contents Overview... 5 System Requirements... 5 Storage Place Interfaces... 5 Getting Started... 6 Using

More information

Buy Online through AT&T Premier and Pick Up in Store

Buy Online through AT&T Premier and Pick Up in Store Buy Online through AT&T Premier and Pick Up in Store Release Notes April 2014 Buy online in Premier and pick up in store Your Corporate Responsibility Users (CRUs) and Individual Responsibility Users (IRUs)

More information

Creating Responsive Drip Campaigns

Creating Responsive Drip Campaigns Creating Responsive Drip Campaigns www.salesnexus.com Creating Responsive Drip Campaigns z 2 Sending a drip campaign to a prospect or a client is a great way to engage them without taking your staff s

More information

Copyright 2006 TechSmith Corporation. All Rights Reserved.

Copyright 2006 TechSmith Corporation. All Rights Reserved. TechSmith Corporation provides this manual as is, makes no representations or warranties with respect to its contents or use, and specifically disclaims any expressed or implied warranties or merchantability

More information

Why should I back up my certificate? How do I create a backup copy of my certificate?

Why should I back up my certificate? How do I create a backup copy of my certificate? Why should I back up my certificate? You should always keep a backup copy of your ACES Business Certificate on a location external to your computer. Since it s stored locally on your computer, in the Windows

More information