Size: px
Start display at page:

Download ""


1 VericationonInniteStructures LehrstuhlInformatikV UniversitatDortmund BaroperStrae301 OlafBurkart DidierCaucal D-44221Dortmund GERMANY CampusdeBeaulieu F-35042Rennes FRANCE IRISA FaronMoller UniversityofWalesSwansea DeptofComputerScience SingletonPark,Sketty SwanseaSA28PP LehrstuhlInformatikV BernhardSteen WALES UniversitatDortmund D-44221Dortmund BaroperStrae301 GERMANY Abstract.Inthischapter,wepresentahierarchyofinnite-statesystems inetheequivalenceandregularitycheckingproblemsfortheseclasses,withspe- cialemphasisonbisimulationequivalence,stressingthestructuraltechniques branching-timetemporallogics. whichhavebeendevisedforsolvingtheseproblems.finally,weexplorethe modelcheckingproblemovertheseclasseswithrespecttovariouslinear-and hierarchyincludesavarietyofcommonly-studiedclassesofsystemssuchas context-freeandpushdownautomata,andpetrinetprocesses.wethenexam- basedontheprimitiveoperationsofsequentialandparallelcomposition;the position/computation,automaticverication,decidability,complexity,be- haviouralequivalences,bisimulation,equivalencechecking,regularitychecking, Keywords:innite-staterewritetransitionsystems,sequential/parallelcom- linear/branching-timetemporallogics,modelchecking

2 Introduction Contents 1ATaxonomyofInniteStateProcesses 1.1RewriteTransitionSystems ExpressivityResults FurtherClassesofProcesses LanguagesandBisimilarity TheEquivalenceCheckingProblem 2.1DecidabilityResultsforBPAandBPP AFiniteBisimulationBaseforBPA CompositionandDecomposition PolynomialTimeAlgorithmsforBPAandBPP APolynomialTimeAlgorithmforNormedBPA AFiniteBisimulationBaseforBPP ComputingaFiniteBisimulationBaseforBPA UndecidabilityResultsforMSA SummaryofResults APolynomialTimeAlgorithmforNormedBPP TheModelCheckingProblem 3.1TemporalLogics Linear-TimeLogics Branching-TimeLogics AlgorithmsforBranching-TimeLogics BPA BPPandPetriNets PushdownProcessesandExtensions AlgorithmsforLinear-TimeLogics PA GeneralProcesses Summary BPAandPushdownProcesses BPPandPetriNets PA

3 Introduction Thestudyofautomated(sequential)programvericationhasaninherenttheoreticalbarrierintheguiseofthehaltingproblemandformalundecidability. Thesimplestprogramswhichmanipulatethesimplestinnitedatatypessuch asintegervariablesimmediatelyfallfoulofthesetheoreticallimitations.during execution,suchaprogrammayevolveintoanyofaninnitudeofstates,and correctness,andtherearenowelegantandacceptedtechniquesforthesemantic hasnotpreventedaverysuccessfulattackontheproblemofprovingprogram asthehaltingstate,willingeneralbeimpossibletodetermine.however,this knowingiftheexecutionoftheprogramwillleadtoanyparticularstate,such analysisofsoftware. forcompletelyandexplicitlyexploringthereachablestatesofanygivensystem, strictlyasnite-statesystems,andformalanalysistoolshavebeendeveloped waresystems,,systemshavebeenmodelled Thehistorybehindthemodellingofconcurrentsystems,inparticularhard- forinstancewiththegoalofdetectingwhetherornotahalting,i.e.,deadlocked, stateisaccessible.thisabstractionhasbeenwarranteduptoapoint.real hardwarecomponentsareindeedniteentities,andprotocolstypicallybehave inaregularfashionirrespectiveofthediversityofmessageswhichtheymaybe designedtodeliver. modellinglanguage.suchformalismsfordescribingconcurrentsystemsare statespacesofthevariouscomponents,forexamplebylistingoutthestates andtransitionfunction,butrathertospecifythemusingsomehigher-level Inspecifyingconcurrentsystems,itisnottypicaltoexplicitlypresentthe notusuallysorestrictiveintheirexpressivepower.forexample,thetypical processalgebracanencodeintegerregisters,andwiththemcomputearbitrary computablefunctions;andpetrinetsconstituteagraphicallanguagefornitely ofthesystembeingspeciedissemantically,ifnotsyntactically,nite.for presentingtypicallyinnite-statesystems.however,toolswhichemploysuch example,agivenprocessalgebratoolmightsyntacticallycheckthatnostatic formalismsgenerallyrelyontechniquesforrstassuringthatthestatespace operatorssuchasparallelcompositionappearwithinthescopeofarecursive denition;andagivenpetrinettoolmightcheckthatanetissafe,thatis, thatnoplacemayacquiremorethanonetoken.havingveriedtheniteness toprovidepracticalvericationtools,isofcoursethatofstatespaceexplosion. ofthesystemathand,thesearchalgorithmcan,atleastinprinciple,proceed. exponentialinthenumberofcomponentswhichmakeupthesystem.hencea Thenumberofreachablestatesofasystemwilltypicallybeontheorderof Theproblemwiththeblindsearchapproach,whichhasthwartedattempts greatdealofresearcheorthasbeenexpendedontamingthisstatespace,typicallybydevelopingintelligentsearchstrategies.variouspromisingtechniques ofbdd(binarydecisiondiagram)encodingsofautomata[20].however,such statespacesfeasible;onepopularapproachtothisproblemisthroughtheuse havebeendevelopedwhichmakefortheautomatedanalysisofextremelylarge approachesareinherentlyboundtotheanalysisofnite-statesystems. Recently,interestinaddressingtheproblemofanalysinginnite-statesys- 3

4 motivationforthishasbeenbothtoprovideforthestudyofparallelprogram temshasblossomedwithintheconcurrencytheorycommunity.thepractical verication,whereinnitedatatypesaremanipulated,aswellastoallowfor morefaithfulrepresentationsofconcurrentsystems.forexample,real-timeand probabilisticmodelshavecomeintovogueduringthelastdecadetoreectfor system'sstructure.suchenhancementstotheexpressivepowerofamodelling modelshavebeendevelopedwhichallowforthedynamicrecongurationofa instancethetemporalandnondeterministicbehaviourofasynchronoushardwarecomponentsrespondingtocontinuously-changinganaloguesignals;and languageimmediatelygiverisetoinnite-statemodels,andnewparadigms systemsexpressedinsuchformalisms. notbasedonstatespacesearchneedtobeintroducedtosuccessfullyanalyse equivalencechecking,whichaimsatestablishingsomesemanticequivalence plementationofthespecicationgivenbytheother;andmodelchecking, betweentwosystems,oneofwhichistypicallyconsideredtorepresenttheim- Inthissurvey,weexplorethetwomajorstreamsinsystemverication: whichaimsatdeterminingwhetherornotagivensystemsatisessomepropertywhichistypicallypresentedinsomemodalortemporallogic.inthesurvey weconcentrateexclusivelyondiscretesystems,andneglectinnite-statestructuresrelatedto,e.g.,timedandhybridsystems.thevarietyofprocessclasses whichweconsideriscataloguedinsection1,wherewedetailtherelativeexpressivepowersoftheseclasses.thetwoapproachestosystemvericationare summarizedhere,wherewealsosketchthecontentsofthetworelevantsections ofthesurvey. systemverication.indeed,suchquestionshavealongtraditionintheeld Equivalencechecking,thatis,determiningwhentwo(innite-state)systems EquivalenceChecking areinsomesemanticsenseequal,isclearlyaparticularlyrelevantproblemin guagetheoristshavebeenstudyingtheequivalenceproblemoverclassesof automatawhichexpresslanguageswhicharemoreexpressivethantheclassof of(theoretical)computerscience.sincetheproofbymoore[121]in1956of thedecidabilityoflanguageequivalencefornite-stateautomata,formallan-,perlesand Shamir[6]werethersttodemonstrate,in1961,thattheclassoflanguages denedbycontext-freegrammarswastoowidetoadmitadecidabletheoryfor languageequivalence.shortlyafterthis,korenjakandhopcroft[95]demonstratedthatlanguageequivalencebetweensimple(deterministic)grammarsis decidable.onlyrecentlyhasthelong-openproblemoflanguageequivalence betweendeterministicpush-downautomata(dpda)beensettled(positively) bysenizergues[132,133]. withthethesisofhack[63].however,ithasonlybeeninthemuchmorerecent interestdriveninpartbyanalogiesdrawnbetweenclassesofconcurrentsystem pastthatamoreconcertedeorthasbeenfocussedonsuchquestions,withthe DecidabilityquestionsforPetrinetswereaddressedalreadytwodecadesago,[114]milner 4

5 exploitstherelationshipbetweenregular(nite-state)automataasdiscussed bysalomaain[130]andregularbehaviourstopresentthedecidabilityanda completeaxiomatisationofbisimulationequivalencefornite-statebehaviours, whilstinhistextbook[115]hedemonstratesthatthehaltingproblemforturing machinescanbeencodedasabisimulationquestionforthefullccscalculus thusdemonstratingundecidabilityingeneral.thisnalfeatiscarriedout Theseresultsareasexpected;however,realinterestwasgeneratedwiththe elegantlyusingniterepresentationsofcountersinthethesisoftaubner[141]. discoverybybaeten,bergstraandklop[4,5]thatbisimulationequivalenceis decidableforafamilyofinnite-stateautomatageneratedbyageneralclassof context-freegrammars. lence,focussingonthevarioustechniquesexploitedineachcase.ourinterestin decidabilityandcomplexity,withparticularemphasisonbisimulationequiva- bisimulationequivalencestemspredominantlyfromitsmathematicaltractability.apartfrombeingthefundamentalnotionofequivalenceforseveralprocess algebraicformalisms,bisimulationequivalencepossessesseveralpleasingmathematicalproperties,notleastofwhichbeing asweshalldiscover thatitis undecidable,inparticularovertheclassofprocessesdenedbycontext-free decidableoverprocessclassesforwhichallothercommonequivalencesremain InSection2,wepresentanoverviewofvariousresultsobtainedregarding whenanalysingpropertiesofanotherequivalence.inparticular,bystudying soitissensibletoconcentrateonthemostmathematicallytractableequivalence grammars.furthermoreinaparticularlyinterestingclassofprocesses namely bisimulationequivalencewecanrediscoverstandardtheoremsaboutthedecidabilityoflanguageequivalence,aswellasprovidemoreecientalgorithmsfor thestructuraltechniqueswhichcanbeexploitedinthestudyofbisimulation thesedecidabilityresultsthanhavepreviouslybeenpresented.weexpectthat equivalencewillprovetobeusefulintacklingvariousotherlanguagetheoreticproblems.indeed,whilesenizergues'proofofthedecidabilityofdpdais extremelylongandcomplex,developedover70pagesofa166pagejournalsubmission,stirling[138]hassincepresentedafarsimplerproofofthisresultusing questionsregardingregularitychecking,thatis,determiningifagivensys- variationsonsomeofthestructuralanalysistechniquesexploredinsection2. temissemanticallynite-state.withinatypicalapplicationdomainsuchas themodellingofprotocols,wemightanalyseinnite-statesystemswhichwe Apartfromthebasicequivalencecheckingproblem,wealsosurveyrelated thenormeddeterministicprocesses allofthestandardequivalencescoincide, systemisnite-state,butthestatespaceoftheimplementationis(syntactically)innite.apositiveanswerfortheregularitycheckingproblemwould allowtheequivalencecheckingalgorithmtoexploitwell-developedtechniques foranalysingnite-statesystems(assumingthattheequivalentnite-statesystemcouldbeextractedfromfromthisanswer). intendtosemanticallyrepresentnite-statebehaviours:ourspecicationofthe 5

6 promisingapproachtotheformalvericationofdistributed,reactivesystems. ModelChecking Apartfromequivalencechecking,modelcheckingprovidesperhapsthemost nite-statesystemsmodelcheckingis,atleasttheoretically,alwaysapplicable, propertiesofasystem,anda(semi-)decisionprocedurethencheckswhether thegivensystemisamodeloftheformulaathand.inparticular,inthecaseof Inthisapproach,oneusesformulaeofatemporallogictospecifythedesired underconsiderationcaneectivelyprovideenoughinformationtosolvetheveri- sinceanexhaustivetraversalthroughthereachablestatespaceofthesystem prominentindustrialsuccessstories,despitetheomni-presentstatespaceexplosionthreat,makingitanindispensabletoolforhardwaredesign.thepractical cationproblem.infact,usingbdds,nite-statemodelcheckinghashadsome newly-publishedtextbookbyclarke,grumbergandpeled[41]. successofmodelcheckingcanbewitnessedbytheimmediatepopularityofthe techniques.thenewtechniqueswhichhavebeendevelopedformodelcheckinghavemainlybeeninuencedbyformallanguagetheory,wherethereexists alongtraditionofreasoningaboutnitely-presentedinniteobjects,inthis caseformallanguagesdescribedbyautomataorgrammars.consequently,notionsfromformallanguagetheoryformarecurringthemeinthevericationohaustivetraversalofthestatespace,theyareinherentlyincapableofverifying innite-statesystems,andmustbereplacedbyalgorithmsbasedondierent Again,asalgorithmsfornite-statemodelcheckingtypicallyinvolvetheex- decidability.expressivemodelsofcomputation,inconjunctionwithpowerfulspecicationformalisms,inevitablyleadtoanundecidablemodelchecking incharacterizingtheexpressivepowerofcertaintemporallogics. innite-statesystems,e.g.,asameansforthedescriptionofsuchsystems,or problem.however,takingweakermodelsand/orformalismsinordertorecover Onegeneralproblemis,however,thetrade-obetweenexpressivenessand decidabilityoftengreatlydiminishesitspracticalvalue.thegoalofthissurvey istoprovideasystematicpresentationoftheresultsobtainedsofarconcerningdecidabilityandcomplexityissuesinmodelcheckinginnite-statesystems, therebyidentifyingfeasiblecombinationsofprocessclassesandtemporallogics. consider,togetherwiththeirbranchingtimeandlineartimeclassications.we checkingforvariousclassesofinnite-statesystems,rstforbranchingtime thenproceedbypresentingdecidabilityandcomplexityresultsaboutmodel InSection3.1weprovideabriefintroductiontothetemporallogicswe logicsinsection3.2,andthenforlineartimelogicsinsection3.3.duetothe wealthoftechniqueswhichhavebeendevisedforuseinconjunctionwiththe oftherelevantresultsinthissurvey.thisgivesaconceptualandeasytoread widevarietyoflogicswhichonemayconsider,weonlysketchthemainideas overview,whichiscomplementedbytightlinkstotheoriginalliterature,thus AcknowledgementsSections1and2arebasedonthesurveyInniteResults[118]presentedatCONCUR'96,andtheoriginsofSection3arefound enablingtheinterestedreaderstoaccessallthetechnicaldetails. inthesurveymoreinniteresults[25]presentedatinfinity'96.however, 6

7 therehasbeenaoodofnewresultsintheinterveningyears,andtheseearlier surveysarevastlyextendedhere.wewishtothankrichardmayrandmarkus Mueller-Olmfordetailedcommentsonearlierdraftsofthissurvey. 7

8 1Concurrentsystemsaremodelledsemanticallyinavarietyofways.Theymay 1.1RewriteTransitionSystems ATaxonomyofInniteStateProcesses bedenedforexamplebytheinnitetracesorexecutionswhichtheymayperform,orbytheentiretyofthepropertieswhichtheysatisfyinsomeparticular processlogic,orasaparticularalgebraicmodelofsomeequationalspecication.inanycase,afundamentalunifyingviewistointerpretsuchsystemsitionemanates;thelabelonatransitionrepresentsaneventcorresponding systemoriginatinginthestaterepresentedbythenodefromwhichthetran- asedge-labelleddirectedgraphs,whosenodesrepresentthestatesinwhicha systemmayexist,andwhosetransitionsrepresentthepossiblebehaviourofthe totheexecutionofthattransition,whichwilltypicallyrepresentaninteractionwiththeenvironment.thestartingpointforourstudywillthusbesuch graphs,whichwillforusrepresentprocesses. Denition1AlabelledtransitionsystemisatuplehS;;?!;0;Fiwhere?!SSisatransitionrelation,writtena Sisasetofstates. isanitesetoflabels. FSisanitesetofnalstateswhichareterminal,meaningthatfor 02Sisadistinguishedstartstate.?!forh;a;i2?!. Thisnotionofalabelledtransitionsystemdiersfromthestandarddenitionof anite-stateautomaton(asforexamplegivenin[74])inthatthesetofstates each2fthereisnoa2and2ssuchthata?!. neednotbenite,andnalstatesmustnothaveanyoutgoingtransitions. Thislastrestrictionismildandjustiedinthatanalstatereferstothe successfulterminationofaconcurrentsystem.thiscontrastswithunsuccessful automatawhichacceptonemptystack.(analternativeapproachcouldbe whichcharacterisesawideclassoflabelledtransitionsystemsaspush-down Wecouldremovethisrestriction,butonlyattheexpenseofTheorem4below termination(ie,deadlock)whichisrepresentedbyallnon-nalterminalstates. donotpursuethisalternativehere.) takentorecovertheorem4basedonpdawhichacceptbynalstate,butwe belledtransitionsystemsdenedbyvariousrewritesystems.suchanapproach andtransitionsystemgenerators,alinkwhichisofparticularinterestwhenit providesuswithaclearlinkbetweenwell-studiedclassesofformallanguages WefollowtheexamplesetbyCaucal[32]andconsiderthefamiliesofla- Denition2Asequentiallabelledrewritetransitionsystemisatuple comestoexploitingprocess-theoretictechniquesinsolvingproblemsinclassical formallanguagetheory. hv;;p;0;fiwhere 8

9 Visanitesetofvariables;theelementsofVarereferredtoasstates. isanitesetoflabels. PVVisanitesetofrewriterules,writtena?!for h;a;i2p,whichareextendedbytheprexrewritingrule:ifa?! thena?!. 02Visadistinguishedstartstate. FVisanitesetofnalstateswhichareterminal. Aparallellabelledrewritetransitionsystemisdenedpreciselyasabove,exceptthattheelementsofVarereadmodulocommutativityofconcatenation,whichisthusinterprettedasparallel,ratherthansequential,composition. WecanthusconsiderstatesasmonomialsXk1 1Xk2 2Xkn noverthevariables V=fX1;X2;;Xng.Withthisinmind,weshallbeabletoexploitthefollowingresultduetoDickson[48]whichiseasilyprovedbyinductiononn. Lemma3(Dickson'sLemma)Givenaninnitesequenceofvectorsofnaturalnumbers~x1;~x2;~x3;:::2Nnwecanalwaysndindicesiandjwithi<j suchthat~xi~xj(whereisconsideredpointwise). ThestateXk1 1Xk2 2Xkn ncanbeviewedasthevector(k1;k2;:::;kn)2nn. Hence,Dickson'sLemmasaysthat,givenanyinnitesequence1;2;3;::: ofsuchstates,wecanalwaysndtwoofthese,iandjwithi<j,suchthat thenumberofoccurrencesofeachvariablexinjisatleastasgreatasini. Weshallfreelyextendthetransitionrelation?!homomorphicallytonite sequencesofactionsw2soastowrite"?!andaw?!whenevera?! w?!.also,werefertothesetofstatesintowhichtheinitialstatecanbe rewritten,thatis,suchthat0w?!forsomew2,asthereachablestates. Althoughwedonotinsistthatallstatesbereachable,weshallassumethatall variablesinvareaccessiblefromtheinitialstate,thatis,thatforallx2v thereissomew2and;2vsuchthat0w?!x. Thisdenitionisslightlymoregeneralthanthatgivenin[32],whichdoes nottakeintoaccountnalstatesnorthepossibilityofparallelrewritingasan alternativetosequentialrewriting.bydoingthis,weexpandthestudyofthe classesoftransitionsystemswhicharedened,andextendsomeoftheresults givenbycaucal,notablyinthecharacterisationofarbitrarysequentialrewrite systemsaspush-downautomata. Thefamiliesoftransitionsystemswhichcanbedenedbyrestrictedrewrite systemscanbeclassiedusingaformofchomskyhierarchy.thishierarchy providesanelegantclassicationofseveralimportantclassesoftransitionsystemswhichhavebeendenedandstudiedindependentoftheirappearanceas particularrewritesystems.thisclassicationispresentedinfigure1.(type1 rewritesystems,correspondingtocontext-sensitivegrammars,donotfeaturein thishierarchysincetherewriterulesbydenitionareonlyappliedtotheprex ofacomposition.)intheremainderofthissection,weexplaintheclassesof 9

10 Restriction Type0 none ontherules a?!ofp none Restriction onf Sequential composition Parallel composition Type112 V=Q]? 2Q?where 2Q?and F=Q PDA MSA PN Type2 Type3 2V[f"g 2Vand F=f"g BPA FSA BPP Figure1:Ahierarchyoftransitionsystems. FSA transitionsystemswhicharerepresentedinthistable,workingupwardsstarting withthemostrestrictiveclass. thenitesetf2v:jjj0jg. restrictedtobeoftheformaa statesofboththesequentialandparalleltransitionsystemswillbeelementsof FSArepresentstheclassofnite-stateautomata.Clearlyiftherulesare?!BorAa '?!"witha;b2v,thenthereachable Example0Inthefollowingwepresenttwotype3(regular)rewritesystemsalongwiththeFSAtransitionsystemswhichtheinitialstatesXand A,respectively,denote. $ Yb Xa?!Y? Yc?!"?? "YX? a b c Aa?!B?!C?A Cc Bb?!" B= a a ~ " = ~ C & Thesetwoautomatabothrecognisethesame(regular)languagefab;acg. b c Klop[9],whicharethetransitionsystemsassociatedwithGreibachnormalform However,theyaresubstantiallydierentautomata. (GNF)context-freegrammarsinwhichonlyleft-mostderivationsarepermitted. BPArepresentstheclassofBasicProcessAlgebraprocessesofBergstraand% 10

11 ' statexdenotes. Example1Inthefollowingwepresentatype2(GNFcontext-freegrammar)rewritesystemalongwiththeBPAtransitionsystemwhichtheinitial$ Xc Xa?!XB R Bb X?!" & "? c a-xb a-xbb a- b B? cb BB? c b tensen[35]asaparallelanalogytobpa,andaredenedbythetransition Thisautomatonrecognisesthecontext-freelanguagefancbn:n0g. systemsassociatedwithgnfcontext-freegrammarsinwhicharbitrarygrammarderivationsarepermitted. ' followingbpptransitionsystemwithinitialstatex. Example2Thetype2rewritesystemfromExample1givesrisetothe$ Xc Xa?!XB R BPPrepresentstheclassofBasicParallelProcessesintroducedbyChris-% Bb X -XB -XBB -?!" "? c a a a b B? cbb BB? cb b & Thisautomatonrecognisesthelanguageconsistingofallstringsoftheform (a+b)cbwhichcontainanequalnumberofa'sandb'sinwhichnoprex containsmoreb'sthana's. fromtheinitalstate,thisimpliesthateachvariablesisonthelefthandsideof state.combinedwithourpreviousassumptionthateachvariableisreachable Weshallassumethatforalltype2rewritesystems,"istheonlyterminal% atleastonerule. stack.topresentsuchpdaasarestrictedformofrewritesystem,werst assumethatthevariablesetvispartitionedintodisjointsetsq(nitecontrol states)and?(stacksymbols).therewriterulesarethenoftheformpaa PDArepresentstheclassofpush-downautomatawhichacceptonempty withp;q2q,a2?and2?,whichrepresentstheusualpdatransition stack,youmayreadtheinputsymbola,moveintocontrolstateq,andreplace whichsaysthatwhileincontrolstatepwiththesymbolaatthetopofthe?!q thestackelementawiththesequence.finally,thesetofnalstatesisgiven byq,whichrepresentthepdacongurationsinwhichthestackisempty. 11

12 thetransitionsystemsareisomorphicuptothelabellingofstates.thestronger (type0)sequentialrewritesystemcanbepresentedasapda,inthesensethat result,inwhichnalstatesaretakenintoconsideration,actuallyholdsaswell. Caucal[32]demonstratesthat,disregardingnalstates,anyunrestricted Theideabehindtheencodingisasfollows.Givenanarbitraryrewritesystem hv;;p;0;fi,takensatisfying ThenletQ=fp:2Vandjj<ng; n>maxfjj:a nmaxfjj:a?!2pg;?!with2fg: and Everynaltransitionstate2FisrepresentedbythePDAstatep,thatis,?=fZ:2Vandjj=ng[fg: bythepdabeingincontrolstatepwithanemptystackdenotingacceptance; andeverynon-naltransitionsystemstate12k62fwithjj<nand bythepdabeingincontrolstatepwithwiththesequencez1z2zk jij=nfor1ik,isrepresentedinthepdabypz1z2zk,thatis, onitsstack.theneveryrewriteruleintroducesappropriatepdaruleswhich mimicitandrespectthisrepresentation.thuswearriveatthefollowingresult. Theorem4Everysequentiallabelledrewritetransitionsystemcanberepresented(uptothelabellingofstates)byaPDAtransitionsystem. ' Example3TheBPPtransitionsystemofExample2isgivenbythefollowingsequentialrewritesystem. $ statepx.(weomitrulescorrespondingtotheunreachablestates.) Bytheaboveconstruction,thisgivesrisetothefollowingPDAwithinitial Xa?!XB Xc?!" Bb?!" XBb?!X Xc Xa?!":?!XB:pXa pbb pxc?!p"zxbp"zxba?!p" p"zxbc p"zbbb?!pxzbbpxzbba?!pb pxzbbc pbzbbb?!p"zxbzbb ThisisexpressedmoresimplybythefollowingPDAwithinitialstatep. XBb?!X:p"ZXBb?!pX pxzbbb?!p"zxb?!p"zbb & pa pc?!pb?!q pba pbb pbc?!q?!pbb qb qbb?!q % 12

13 NotethatBPAcoincideswiththeclassofsingle-statePDA.However,weshall seeinsection1.3thatanypdapresentationofthetransitionsystemofexample2musthaveatleast2controlstates:thistransitionsystemisnotrepresented exceptthattheyhaverandomaccesscapabilitytothestack. \parallel"or\random-access"push-downautomata;theyaredenedasabove byanybpa. # MSArepresentstheclassofmultisetautomata,whichcanbeviewedas Example4TheBPAtransitionsystemofExample1isisomorphictothat " givenbythefollowingmsawithinitialstatepx. Notethatwhenthestackalphabethasonlyoneelement,PDAandMSAtriviallycoincide.AlsonotethatBPPcoincideswiththeclassofsingle-stateMSA.! pxa?!pbx pxc?!q qbb?!q WeshallseeinSection1.3thatanyMSApresentationofthetransitionsystem ofexample1musthaveatleast2controlstates:thistransitionsystemisnot representedbyanybpp. nets,asisevidentbythefollowinginterpretationofunrestrictedparallelrewrite systems.thevariablesetvrepresentsthesetofplacesofthepetrinet,and eachrewriterulea PNrepresentstheclassof(nite,labellled,weightedplace/transition)Petri NotethataBPPisacommunication-freePetrinet,oneinwhicheachtransition ontheinputandoutputarcsgivenbytherelevantmultiplicitiesinand. inputandoutputplacesrepresentedbyandrespectively,withtheweights?!representsapetrinettransitionlabelledawiththe hasauniqueinputplace. 13

14 ' Example5Thefollowingunrestrictedparallelrewritesystemwithinitial statexandnalstatey $ describesthepetrinetwhichinitsusualgraphicalrepresentationnetwould?!xa XABc?!X YAa berenderedasfollows.(theweightsonallofthearcsis1.) Xb?!XB Xd?!Y YBb?!Y Aa> = a > -X Y 6}?6- d ~ b} b c -B TheautomatonrepresentedbythisPetrinetrecognisesthelanguageconsistingofallstringsfrom(a+b+c)d(a+b)inwhichthenumberofc's j & b's;andinwhichthenumberofa's(respectivelyb's)beforetheoccurrence inanyprexisboundedabovebyboththenumberofa'sandthenumberof ofthedminusthenumberofc'sequalsthenumberofa's(respectivelyb's) aftertheoccurrenceofthed. holdintheparallelcase.weshallinfactdemonstratethattheautomaton rewritetransitionsystems,weshallseeinsection1.3thatthisresultfailsto Althoughinthesequentialcase,PDAconstitutesanormalformforunrestricted% associatedwiththeabovepnisnottheautomatonofanymsa. GivenalabelledtransitionsystemT=hS;;?!;0;Fi,wecandeneits 1.2LanguagesandBisimilarity ofactionswhichlabelrewritetransitionsleadingfromthegivenstatetoanal languagel(t)tobethelanguagegeneratedbyitsinitialstate0,wherethe languagegeneratedbyastateisdenedintheusualfashionasthesequences state. Denition5L()=fw2:w andarelanguageequivalent,writtenl,itheygeneratethesame language:l()=l().?!forsome2fg,andl(t)=l(0). systemisintheprocessofgeneratingaword,thenthepartialwordshould beextendibletoacompleteword.thatis,fromanyreachablestateofthe transitionsystem,analstateshouldbereachable.ifthetransitionsystem Withrespecttothelanguagesgeneratedbyrewritesystems,ifarewrite satisesthisproperty,itissaidtobenormed;otherwiseitisunnormed. 14

15 writtenn(),tobethelengthofashortestrewritetransitionsequencewhich Denition6Wedenethenormofanystateofalabelledtransitionsystem, takestoanalstate,thatis,thelengthofashortestwordinl().by convention,wedenen()=1ifthereisnosequenceoftransitionsfrom Notethat,duetotheassumptionfollowingDenition2ontheaccessibilityof toanalstate,thatis,l()=;.thetransitionsystemisnormedievery allthevariables,ifatype2rewritetransitionsystemisnormed,thenallofits reachablestatehasanitenorm;otherwiseitisunnormed. variablesmusthavenitenorm.thefollowingthenisabasicfactaboutthe normsoftype2(bpaandbpp)states. BPP),n()=n()+n(). Lemma7Givenanystateofatype2rewritetransitionsystems(BPAor u1u2un2l()andv1v2vn2l()g.theresultfollowseasilyfromthis. ProofForthesequentialcase,L()=L()L()=fuv:u2L()and v2l()g.fortheparallelcase,l()=l()kl()=fu1v1u2v2unvn: Denition8Tisdeterministiciforeveryreachablestateandeverylabel Afurthercommonpropertyoftransitionsystemsisthatofdeterminacy. 2 Forexample,thetwonitestateautomatapresentedinExample0areboth athereisatmostonestatesuchthata normedtransitionsystems,whileonlytherstisdeterministic.allotherexampleswhichwehavepresentedhavebeenbothnormedanddeterministic.?!. stratedierentdeadlockingcapabilitiesduetothenondeterministicbehaviour tobetoocoarseanequivalence.forexample,itequatesthetwotransition systemsofexample0whichgeneratethesamelanguagefab;acgyetdemon- Intherealmofconcurrencytheory,languageequivalenceisgenerallytaken exhibitedbythesecondtransitionsystem.manynerequivalenceshavebeen proposed,withbisimulationequivalencebeingperhapsthenestbehavioural concurrency'equivalencessuchasthosebasedonpartialorders.)bisimulationequivalencewasdenedbypark[125]andusedtogreateectbymilner[113,115].itsdenition,inthepresenceofnalstates,isasfollows. Denition9AbinaryrelationRonstatesofatransitionsystemisabisimulationiwhenever(;)2Rwehavethat ifa ifa?!0thena?!0thena?!0forsome0with(0;0)2r; equivalencestudied.(notethatwedonotconsiderhereanyso-called`true andarebisimulationequivalentorbisimilar,written,i(;)2r 2Fi2F.?!0forsome0with(0;0)2R; forsomebisimulationr.thatis,=sr:risabisimulationrelation. 15

16 Lemma10isthelargestbisimulationrelation. ProofAnarbitraryunionofbisimulationsisitselfabisimulation. Lemma11isanequivalencerelation. 2 sincethecompositionoftwobisimulationsisabisimulation. holdssincetheinverseofabisimulationisabisimulation;andtransitivityholds ProofReexivityholdssincetheidentityrelationisabisimulation;symmetry two-playergames[136,91].startingwithapairofstatesh;i,thetwoplayers Bisimulationequivalencehasanelegantcharacterisationintermsofcertain 2 alternatemovesaccordingtothefollowingrules. 1.Ifexactlyoneofthepairofstatesisanalstate,thenplayerIisdeemed tobethewinner.otherwise,playerichoosesoneofthestatesandmakes sometransitionfromthatstate(eithera impossible,duetobothstatesbeingterminal,thenplayeriiisdeemedto bethewinner.?!0ora?!0).ifthisproves 2.PlayerIImustrespondtothemovemadebyplayerIbymakingan a identically-labelledtransitionfromtheotherstate(eithera?!0).ifthisprovesimpossible,thenplayeriisdeemedtobethe?!0or Thefollowingresultisthenimmediatelyevident. 3.Theplaythenrepeatsitselffromthenewpairh0;0i.Ifthegame continuesforever,thenplayeriiisdeemedtobethewinner. Fact12iPlayerIIhasawinningstrategyinthebisimulationgame ProofAnybisimulationrelationdenesawinningstrategyforplayerIIfor gamestartingwiththepairh;i. Conversely,6iPlayerIhasawinningstrategyinthebisimulation pairiscontainedinthebisimulation. merelyhastorespondtomovesbytherstinsuchawaythattheresulting thebisimulationgamestartingfromapairintherelation:thesecondplayer thatpair,namelythecollectionofallpairswhichappearaftereveryexchange ingfromaparticularpairofstatesdenesabisimulationrelationcontaining ofmovesduringanyandallgamesinwhichplayeriiusesthisstrategy. Conversely,awinningstrategyforplayerIIforthebisimulationgamestart- 2 16

17 ' Example6ThestatesXandAfromExample0arelanguageequivalent, astheydenethesamelanguagefab;acg.however, seethis,wecandemonstrateanobviouswinningstrategyforplayeriin & IcannotrespondfromB,andinthelattercaseplayerImaymakethe exchangeofmoves,thenewpairofstatesmustbeeitherhy;biorhy;ci;in thebisimulationgamestartingwiththepairofstateshx;ai.aftertherst theformercase,playerimaymakethetransitionyc transitionyb?!"towhichplayer transitionsfromanygivenreachablestate;anditisimage-niteifthereare Atransitionsystemisnite-branchingifthereareonlyanitenumberof?!"towhichplayerIcannotrespondfromC. onlyanitenumberoftransitionswithagivenlabelfromanygivenreach-ablestate.forimage-nitetransitionsystems,wehavethefollowingstratied characterisationofbisimulationequivalence[115]. Denition13Thestratiedbisimulationrelationsnaredenedasfollows. k+1i 0forallstates. {ifa {ifa?!0thena?!0thena?!0forsome0with0k0; Intermsofthegamecharacterisationofbisimilarity,niPlayerIcannot {2Fi2F.?!0forsome0with0k0; forceawinwithintherstnexchangesofmoves. Lemma14Ifandareimage-nite,theninforalln0. isabisimulation. ProofIfthenaninductionproofgivesthatnforeachn0. Conversely,f(;):andareimage-niteandnforalln0g applies.itisequallyclearthateachoftherelationsnisdecidable,and Itisclearthatrewritetransitionsystemsareimage-nite,andthatthislemma 2 tems.hencethedecidabilityresultswouldfollowfromdemonstratingthesemi- decidabilityofbisimilarity. thatthereforenon-bisimilarityissemi-decidableoverrewritetransitionsys- 17

18 ' Example7Considerthefollowinginnite-branchingtransitionsystem. X $ A0Y A1 A2?6 RA3 Z I - a a Y a a a a & ThestatesXandYareclearlynotbisimilar,asthestateZcannotbebisimilartoAnforanyn0.However,XnYforeveryn0asZnAnfor itsaccompanyingcorollaryrelatingbisimulationequivalencetolanguageequivalence. Animmediatelyevidentyetimportantpropertyisthefollowinglemmawith% Lemma15Ifandw ProofGivenabisimulationRcontaining(;),aninductiononthelength that00.?!0withw2,thenw eachn0. ofw2demonstratesthatifw?!0thenw?!0forsome0such Corollary16IfthenL.?!0with(0;0)2R. 2 ProofIfthenw2L()iw thepreviouslemma holdsiw holdsiw2l().?!0where0isanalstate,whichinturn?!0where0isanalstate,which by algebraicformalisms,bisimilarityhasseveralpleasingmathematicalproperties Apartfrombeingthefundamentalnotionofequivalenceforseveralprocess 2 notsharedbyotherequivalencessuchaslanguageequivalence.furthermoreas overtheclassofnormeddeterministicprocesses. Lemma17Forstatesandofanormeddeterministictransitionsystem, givenbythefollowinglemma,languageequivalenceandbisimilaritycoincide iflthen.thus,takenalongwithcorollary16,landcoincide. statesofanormeddeterministictransitionsystemgisabisimulationrelation. ProofItsucestodemonstratethattherelationf(;):Land;are 18 2

19 ulationequivalencewheninvestigatingdecidabilityresultsforlanguageequiv- alencefordeterministiclanguagegenerators.weshallseeexamplesofthisin Section2. Henceitissensibletoconcentrateonthemoremathematicallytractablebisim- Thehierarchyfromabovegivesusthefollowingclassicationofprocesses. 1.3ExpressivityResults BPA (h) PDA (?) FSA (e) (?) (i) (f) BPP (g) (j) MSA PN Inthissectionwedemonstratethestrictnessofthishierarchybyprovidingexampletransitionsystemswhichliepreciselyinthegaps(a)-(j)indicatedinthe (a) (b) (c) (d) alsolanguage)equivalence.theseresultscomplementthosepresentedforthe infactdomorethanthisbygivingexamplesofnormeddeterministictransitionsystemswhichseparatealloftheseclassesuptobisimulation(andhence classication.(weleaveopenthequestionregardingthenaltwogaps.)we taxonomydescribedbyburkart,caucalandsteen[24]. (b)thetype2rewritesystemwiththetworulesaa (a)therstautomatoninexample0providesanormeddeterministicfsa. risetothesametransitionsystemregardlessofwhetherthesystemis sequentialorparallel;thisisanimmediateconsequenceofthefactthat itinvolvesonlyasinglevariablea.thistransitionsystemisdepictedas?!aaandab?!"gives follows. " braab-aaab -AAAab - Thisisanexampleofanormeddeterministictransitionsystemwhichis (c)examples2and3provideatransitionsystemwhichcanbedescribedby bothabpp(example2)andapda(example3).however,itcannot bothabpaandabppbutnotanfsa. bedescribeduptobisimilaritybyanybpa.toseethis,supposethat 19

20 andletmbeatleastaslargeasthenormofanyofitsvariables.thenthe wehaveabpawhichrepresentsthistransitionsystemuptobisimilarity, transitionsmustleadtothebpastate,whilethetransitionsystemin BPAstatecorrespondingtoXBminExample2mustbeoftheformA wherea2vand2v+.butthenanysequenceofn(a)norm-reducing (d)thefollowingbppwithinitialstatex Bkwherek=n(). Example2hastwosuchnon-bisimilarderivedstates,namelyXBk-1and isnotlanguageequivalenttoanypda,asitslanguageiseasilyconrmed nottobecontextfree.(thewordsinthislanguageoftheformacbde Xa?!XB Xc?!XD Xe?!" Bb?!" Dd?!" (e)examples1and4provideatransitionsystemwhichcanbedescribedby areexactlythoseoftheformakcnbkdne,whichisclearlynotacontextfreelanguage.) bothabpa(example1)andamsa(example4).however,thecontextfreelanguagewhichitgenerates,fancbn:n0g,cannotbegenerated byanybpp,sothistransitionsystemisnotevenlanguageequivalentto BPPstateX.(Astheprocesshasnorm1,thestatemustconsistofa anybpp.toseethis,supposethatl(x)=fancbn:n0gforsome singlevariablex.)letkbeatleastaslargeasthenormofanyofthe nite-normedvariablesofthisbpp,andconsideratransitionsequence acceptingthewordakcbk: wherethec-transitionisgeneratedbythetransitionruleyc haven(y)=k+1>n(y),so6=";hencebi X?!Yc ak?!bk?!" i>0.thuswehavexak?!"andbk-i?!.wemust?!ybi?!yc?!bk-i?!"?!"forsome (f)thefollowingpdawithinitialstatepx fromwhichwegetthedesiredcontradiction:akbicbk-i2l(x)forsome i>0. coincideswiththemsawhichitdenes,sincethereisonlyonestack symbol.thistransitionsystemisdepictedasfollows. pxa?!pxx pxb?!q pxb?!r qxc?!q rxd?!r 20

Page 1 of 37 # $ $ " $# " #! " % $ &'(")"# *+,)#)./(0 1)2+)1*+, 3")#)./("*+4,%" )#)./(,,)#2+)( 3 %&'/ ",, &*)1*/252+))&1)1*'25 2+))6 " #% 6" " 6 " ",, ", #, 1+, 6 6,, " 3, )/, &'(" )/,6# 2+2(%,*(, 1, ")#).*+

More information

!' /%!' / / 8 ' 2 % / L ' % M " 7'' / 75,G ; M

!' /%!' / / 8 ' 2 % / L ' % M  7'' / 75,G ; M !' /% ' '/'' /%'' G " '' ''' M L 7%/% %% %% /!%,%%=>!' / / 5'=> 8 ' 2 % / ' 5'=> 7'/Q( /,%%=> L ' % M " 7'' / % /6 7%,5 6 7%,5=67> 7'E"/ % / L 2 % /,G 75,G ; M " ' /%,G. %/; , B 1 0.

More information

Polynomial Factoring. Ramesh Hariharan

Polynomial Factoring. Ramesh Hariharan Polynomial Factoring Ramesh Hariharan The Problem Factoring Polynomials overs Integers Factorization is unique (why?) (x^2 + 5x +6) (x+2)(x+3) Time: Polynomial in degree A Related Problem Factoring Integers

More information

Introduction to Predicate Logic. Ling324 Reading: Meaning and Grammar, pg

Introduction to Predicate Logic. Ling324 Reading: Meaning and Grammar, pg Introduction to Predicate Logic Ling324 Reading: Meaning and Grammar, pg. 113-141 Usefulness of Predicate Logic for Natural Language Semantics While in propositional logic, we can only talk about sentences

More information

CROSS REFERENCE. Cross Reference Index 110-122. Cast ID Number 110-111 Connector ID Number 111 Engine ID Number 112-122. 2015 Ford Motor Company 109

CROSS REFERENCE. Cross Reference Index 110-122. Cast ID Number 110-111 Connector ID Number 111 Engine ID Number 112-122. 2015 Ford Motor Company 109 CROSS REFERENCE Cross Reference Index 110-122 Cast ID Number 110-111 Connector ID Number 111 112-122 2015 Ford Motor Company 109 CROSS REFERENCE Cast ID Number Cast ID Ford Service # MC Part # Part Type

More information

Chapter 12. The Straight Line

Chapter 12. The Straight Line 302 Chapter 12 (Plane Analytic Geometry) 12.1 Introduction: Analytic- geometry was introduced by Rene Descartes (1596 1650) in his La Geometric published in 1637. Accordingly, after the name of its founder,

More information

US Code (Unofficial compilation from the Legal Information Institute)

US Code (Unofficial compilation from the Legal Information Institute) US Code (Unofficial compilation from the Legal Information Institute) TITLE 26 - INTERNAL REVENUE CODE Subtitle D - Miscellaneous Excise Taxes CHAPTER 43 QUALIFIED PENSION, ETC., PLANS Please Note: This

More information


COMPRESSION SPRINGS: STANDARD SERIES (INCH) : STANDARD SERIES (INCH) LC 014A 01 0.250 6.35 11.25 0.200 0.088 2.24 F F M LC 014A 02 0.313 7.94 8.90 0.159 0.105 2.67 F F M LC 014A 03 0.375 9.52 7.10 0.126 0.122 3.10 F F M LC 014A 04 0.438 11.11 6.00

More information

Second-Order Linear Differential Equations

Second-Order Linear Differential Equations Second-Order Linear Differential Equations A second-order linear differential equation has the form 1 Px d 2 y dx 2 dy Qx dx Rxy Gx where P, Q, R, and G are continuous functions. We saw in Section 7.1

More information

DTR Part II: Change Requests 4 June 2015 Cargo Movement

DTR Part II: Change Requests 4 June 2015 Cargo Movement II: Change s 4 June 2015 Appendix E II 6/4/4015 USAF Figure E-6 Revised figure TOC II 6/4/4015 CSC Definitions TOC II 6/4/4015 CSC Website Revised definitions 3, 61, 63, 75, 177, 178, 223, 382, 456, and

More information

Chapter 1. Affine and Euclidean Geometry. 1.1 Points and vectors. 1.2 Linear operations on vectors

Chapter 1. Affine and Euclidean Geometry. 1.1 Points and vectors. 1.2 Linear operations on vectors Chapter 1 Affine and Euclidean Geometry 1.1 Points and vectors We recall coordinate plane geometry from Calculus. The set R 2 will be called the plane. Elements of R 2, that is ordered pairs (x, y) of

More information

Predicates and Quantifiers. Niloufar Shafiei

Predicates and Quantifiers. Niloufar Shafiei Predicates and Quantifiers Niloufar Shafiei Review Proposition: 1. It is a sentence that declares a fact. 2. It is either true or false, but not both. Examples: 2 + 1 = 3. True Proposition Toronto is the

More information

I Have...Who Has... Multiplication Game

I Have...Who Has... Multiplication Game How to play the game: Distribute the cards randomly to your students. Some students may get more than one card. Select a student to begin by reading their card aloud. (example: 35. who has 4x4?) 35 4 x

More information


SECOND-ORDER LINEAR DIFFERENTIAL EQUATIONS SECOND-ORDER LINEAR DIFFERENTIAL EQUATIONS A second-order linear differential equation has the form 1 Px d y dx dy Qx dx Rxy Gx where P, Q, R, and G are continuous functions. Equations of this type arise

More information

ให p, q, r และ s เป นพห นามใดๆ จะได ว า

ให p, q, r และ s เป นพห นามใดๆ จะได ว า เศษส วนของพห นาม ให A และ B เป นพห นาม พห นามใดๆ โดยท B 0 เร ยก B A ว า เศษส วนของพห นาม การดาเน นการของเศษส วนของพห นาม ให p, q, r และ s เป นพห นามใดๆ จะได ว า Q P R Q P Q R Q P R Q P Q R R Q P S P Q

More information

Section 3.7 Rational Functions

Section 3.7 Rational Functions Section 3.7 Rational Functions A rational function is a function of the form where P and Q are polynomials. r(x) = P(x) Q(x) Rational Functions and Asymptotes The domain of a rational function consists

More information

C relative to O being abc,, respectively, then b a c.

C relative to O being abc,, respectively, then b a c. 2 EP-Program - Strisuksa School - Roi-et Math : Vectors Dr.Wattana Toutip - Department of Mathematics Khon Kaen University 200 :Wattana Toutip 2. Vectors A

More information

Homework #2 Solutions

Homework #2 Solutions MAT Spring Problems Section.:, 8,, 4, 8 Section.5:,,, 4,, 6 Extra Problem # Homework # Solutions... Sketch likely solution curves through the given slope field for dy dx = x + y...8. Sketch likely solution

More information

LOCUS Definition: The set of all points (and only those points) which satisfy the given geometrical condition(s) (or properties) is called a locus. Eg. The set of points in a plane which are at a constant

More information

Chapter 9 Deflections of Beams

Chapter 9 Deflections of Beams Chapter 9 Deflections of Beams 9.1 Introduction in this chapter, we describe methods for determining the equation of the deflection curve of beams and finding deflection and slope at specific points along

More information

DHA Lahore Ballot 2016

DHA Lahore Ballot 2016 Page 1 of 5 1 R001 Residential 1/L/000159 2 Kanal A 32,500,000 2 R002 Residential 1/N/00056/1 2 Kanal A 42,000,000 3 R003 Residential 2/S/00087/1 2 Kanal B 39,647,778 4 R004 Residential 2/V/00017 2 Kanal

More information

Chapter 4. Linear Second Order Equations. ay + by + cy = 0, (1) where a, b, c are constants. The associated auxiliary equation is., r 2 = b b 2 4ac 2a

Chapter 4. Linear Second Order Equations. ay + by + cy = 0, (1) where a, b, c are constants. The associated auxiliary equation is., r 2 = b b 2 4ac 2a Chapter 4. Linear Second Order Equations ay + by + cy = 0, (1) where a, b, c are constants. ar 2 + br + c = 0. (2) Consequently, y = e rx is a solution to (1) if an only if r satisfies (2). So, the equation

More information

West Virginia. 79n. Revision: ECFA-PM-91-10 DECEMBER 1991 (BPD) State/Territory:

West Virginia. 79n. Revision: ECFA-PM-91-10 DECEMBER 1991 (BPD) State/Territory: 79n Revision: ECFA-PM-91-10 Sees. 1902(a (28, 1919 ( e (1 and (2, and 1919(f(2, 101-239 (Sees. 6901(b (3 and 4.38 (a (b The State assures that the requirements of 42 CFR 483.150(a, which relate to individuals

More information

Partial Fractions Examples

Partial Fractions Examples Partial Fractions Examples Partial fractions is the name given to a technique of integration that may be used to integrate any ratio of polynomials. A ratio of polynomials is called a rational function.

More information

6 Commutators and the derived series. [x,y] = xyx 1 y 1.

6 Commutators and the derived series. [x,y] = xyx 1 y 1. 6 Commutators and the derived series Definition. Let G be a group, and let x,y G. The commutator of x and y is [x,y] = xyx 1 y 1. Note that [x,y] = e if and only if xy = yx (since x 1 y 1 = (yx) 1 ). Proposition

More information

Mathematical induction & Recursion

Mathematical induction & Recursion CS 441 Discrete Mathematics for CS Lecture 15 Mathematical induction & Recursion Milos Hauskrecht 5329 Sennott Square Proofs Basic proof methods: Direct, Indirect, Contradiction, By Cases,

More information

2. Let H and K be subgroups of a group G. Show that H K G if and only if H K or K H.

2. Let H and K be subgroups of a group G. Show that H K G if and only if H K or K H. Math 307 Abstract Algebra Sample final examination questions with solutions 1. Suppose that H is a proper subgroup of Z under addition and H contains 18, 30 and 40, Determine H. Solution. Since gcd(18,

More information

Pump Front Cartr. GPM Rear Cartr. GPM Shaft Equipment Series From 955H 955H 950F 950F 966F 966F E 926E

Pump Front Cartr. GPM Rear Cartr. GPM Shaft Equipment Series From 955H 955H 950F 950F 966F 966F E 926E 3A1692 3G1266 30 9J5090 955H 60A 001-UP 3A1692 3G1266 30 9J5090 955H 72A 001-UP 6E2063 6E2396 35 4T2626 21 4T2111 950F 6YG 001-UP 6E2063 6E2396 35 4T2626 21 4T2111 950F 7ZF 001-UP 6E2064 6E2387 50 1U2667

More information


UPDATED 24/06/16 O-RINGS 1 WEEK DELIVERY STOCK PRIOR TO SALES PAGE 1 / 55 UPDATED 24/06/16 O-RINGS 1 WEEK DELIVERY STOCK PRIOR TO SALES PAGE 1 / 55 PARKER P/N BOX Q.TY STOCK AA150 2-227 224 244 E1257 2-013 1342 1122 E1257 2-117 100 320 F00VE24026 5000 500 LM158 2-012 5000 120

More information

Community College of Philadelphia Calling Code 218 Employer Scan Client Approved: November 17, 2005 Region (CIRCLE) City MSA

Community College of Philadelphia Calling Code 218 Employer Scan Client Approved: November 17, 2005 Region (CIRCLE) City MSA Community College of Philadelphia Calling Code 218 Employer Scan Client Approved: November 17, 2005 Region (CIRCLE) City MSA Zip V0 V1 V2 Month/ Day/ Year of Contact: Business Name: Address: V3 City: V4

More information

Reducibility of Second Order Differential Operators with Rational Coefficients

Reducibility of Second Order Differential Operators with Rational Coefficients Reducibility of Second Order Differential Operators with Rational Coefficients Joseph Geisbauer University of Arkansas-Fort Smith Advisor: Dr. Jill Guerra May 10, 2007 1. INTRODUCTION In this paper we

More information


EXTENSION SPRINGS: STANDARD SERIES (INCH) LE 014A 01 0.500 12.70 2.000 0.0360 0.990 25.15 L L LE 014A 02 0.563 14.30 1.650 0.0290 1.153 29.29 L L LE 014A 03 0.625 15.88 1.400 0.0250 1.325 33.66 L L LE 014A 04 0.750 19.05 1.080 0.0190 1.660 42.16

More information

4. Matrix inverses. left and right inverse. linear independence. nonsingular matrices. matrices with linearly independent columns

4. Matrix inverses. left and right inverse. linear independence. nonsingular matrices. matrices with linearly independent columns L. Vandenberghe EE133A (Spring 2016) 4. Matrix inverses left and right inverse linear independence nonsingular matrices matrices with linearly independent columns matrices with linearly independent rows

More information

Predicate Logic. Example: All men are mortal. Socrates is a man. Socrates is mortal.

Predicate Logic. Example: All men are mortal. Socrates is a man. Socrates is mortal. Predicate Logic Example: All men are mortal. Socrates is a man. Socrates is mortal. Note: We need logic laws that work for statements involving quantities like some and all. In English, the predicate is

More information

2Matrix Algebra. Matrix Addition, Scalar Multiplication, and Transposition

2Matrix Algebra. Matrix Addition, Scalar Multiplication, and Transposition Matrix Algebra Section. Matrix Addition, Scalar Multiplication, and Transposition In the study of systems of linear equations in Chapter, we found it convenient to manipulate the augmented matrix of the

More information

Consider: N 2 (g) + 3H 2 (g) 2NH 3 (g) G = -32.90 kj/mol. conc. time

Consider: N 2 (g) + 3H 2 (g) 2NH 3 (g) G = -32.90 kj/mol. conc. time 5.111 Lecture Summary #19 CHEMICAL EQUILIBRIUM (Chapter 9 Section 9.0-9.9) Topics Nature of Chemical Equilibrium Meaning of K Relationship between Equilibrium Expressions External Effects on K 19.1 Chemical

More information

Visa Smart Debit/Credit Certificate Authority Public Keys

Visa Smart Debit/Credit Certificate Authority Public Keys CHIP AND NEW TECHNOLOGIES Visa Smart Debit/Credit Certificate Authority Public Keys Overview The EMV standard calls for the use of Public Key technology for offline authentication, for aspects of online

More information

Sec36NotesDone.notebook April 19, Sec. 3.6 Rational Functions and their Graphs. A rational function is of the form:

Sec36NotesDone.notebook April 19, Sec. 3.6 Rational Functions and their Graphs. A rational function is of the form: Sec. 3.6 Rational Functions and their Graphs A rational function is of the form: where P(x) and Q(x) are Polynomials The Domain of r(x) is all values of x where Q(x) is not equal to zero. The simplest

More information

Introduction to polynomials

Introduction to polynomials Worksheet 4.5 Polynomials Section 1 Introduction to polynomials A polynomial is an expression of the form p(x) = p 0 + p 1 x + p 2 x 2 + + p n x n, (n N) where p 0, p 1,..., p n are constants and x os

More information

Solving First Order ODEs. Table of contents

Solving First Order ODEs. Table of contents Solving First Order ODEs Table of contents Solving First Order ODEs............................................... 1 1. Introduction...................................................... 1 Side: Two ways

More information

Foundations of Geometry 1: Points, Lines, Segments, Angles

Foundations of Geometry 1: Points, Lines, Segments, Angles Chapter 3 Foundations of Geometry 1: Points, Lines, Segments, Angles 3.1 An Introduction to Proof Syllogism: The abstract form is: 1. All A is B. 2. X is A 3. X is B Example: Let s think about an example.

More information

Angle bisectors of a triangle in I 2

Angle bisectors of a triangle in I 2 Mathematical Communications 3(008), 97-05 97 Angle bisectors of a triangle in I Zdenka Kolar Begović,Ružica Kolar Šuper and Vladimir Volenec Abstract. The concept of an angle bisector of the triangle will

More information

1.7. Partial Fractions. 1.7.1. Rational Functions and Partial Fractions. A rational function is a quotient of two polynomials: R(x) = P (x) Q(x).

1.7. Partial Fractions. 1.7.1. Rational Functions and Partial Fractions. A rational function is a quotient of two polynomials: R(x) = P (x) Q(x). .7. PRTIL FRCTIONS 3.7. Partial Fractions.7.. Rational Functions and Partial Fractions. rational function is a quotient of two polynomials: R(x) = P (x) Q(x). Here we discuss how to integrate rational

More information

List of Part Numbers Manufacturer's No. / Hella No.

List of Part Numbers Manufacturer's No. / Hella No. List of Part Numbers Manufacturer's No. / No. List of part numbers.02-.09 Manufacturer's no. / no..-.53 Note: The original numbers listed in the manufacturer number - number comparison serve exclusively

More information LENGTH OF THE PERPENDICULAR FROM A POINT TO A STRAIGHT LINE AND DISTANCE BETWEEN TWO PAPALLEL LINES THEOREM The perpendicular distance from a point P(x 1, y 1 ) to the line ax + by + c 0 is ax1+ by1+ c

More information

Operations with Algebraic Expressions: Multiplication of Polynomials

Operations with Algebraic Expressions: Multiplication of Polynomials Operations with Algebraic Expressions: Multiplication of Polynomials The product of a monomial x monomial To multiply a monomial times a monomial, multiply the coefficients and add the on powers with the

More information

Commutants of middle Bol loops. 1. Introduction

Commutants of middle Bol loops. 1. Introduction Quasigroups and Related Systems 22 (2014), 81 88 Commutants of middle Bol loops Ion Grecu and Parascovia Syrbu Abstract. The commutant of a loop is the set of all its elements that commute with each element

More information

Factoring, Solving. Equations, and Problem Solving REVISED PAGES

Factoring, Solving. Equations, and Problem Solving REVISED PAGES 05-W4801-AM1.qxd 8/19/08 8:45 PM Page 241 Factoring, Solving Equations, and Problem Solving 5 5.1 Factoring by Using the Distributive Property 5.2 Factoring the Difference of Two Squares 5.3 Factoring

More information

CANape CCP Communication Version 1.1 02/06/03 Application Note AN-AMC-1-100

CANape CCP Communication Version 1.1 02/06/03 Application Note AN-AMC-1-100 Version 1.1 02/06/03 Application Note AN-AMC-1-100 Author(s) Restrictions Abstract Kim Lemon Public Document This application note concentrates on explaining the fundamental concepts about CANape and CCP

More information

Officials Authorized to Provide Documentation of VHA Program Office Non-Research Operations Activities Per VHA Handbook 1058.05

Officials Authorized to Provide Documentation of VHA Program Office Non-Research Operations Activities Per VHA Handbook 1058.05 The Officials listed below are authorized under VHA Handbook 1058.05 to document the status of non-research operations activities that are funded, mandated, managed, sponsored, or otherwise supported by

More information

Inverses. Stephen Boyd. EE103 Stanford University. October 27, 2015

Inverses. Stephen Boyd. EE103 Stanford University. October 27, 2015 Inverses Stephen Boyd EE103 Stanford University October 27, 2015 Outline Left and right inverses Inverse Solving linear equations Examples Pseudo-inverse Left and right inverses 2 Left inverses a number

More information

Vehicle Identification Numbering System 00.03

Vehicle Identification Numbering System 00.03 Vehicle Identification Numbering System 00.03 IMPORTANT: See Subject 050 for the vehicle identification numbering system for vehicles built before May 1, 2000. Federal Motor Vehicle Safety Standard 115

More information

equations Karl Lundengård December 3, 2012 MAA704: Matrix functions and matrix equations Matrix functions Matrix equations Matrix equations, cont d

equations Karl Lundengård December 3, 2012 MAA704: Matrix functions and matrix equations Matrix functions Matrix equations Matrix equations, cont d and and Karl Lundengård December 3, 2012 Solving General, Contents of todays lecture and (Kroenecker product) Solving General, Some useful from calculus and : f (x) = x n, x C, n Z + : f (x) = n x, x R,

More information



More information

calculating the result modulo 3, as follows: p(0) = 0 3 + 0 + 1 = 1 0,

calculating the result modulo 3, as follows: p(0) = 0 3 + 0 + 1 = 1 0, Homework #02, due 1/27/10 = 9.4.1, 9.4.2, 9.4.5, 9.4.6, 9.4.7. Additional problems recommended for study: (9.4.3), 9.4.4, 9.4.9, 9.4.11, 9.4.13, (9.4.14), 9.4.17 9.4.1 Determine whether the following polynomials

More information

Compatibility list for SIMATIC software packages with various versions of the STEP 7 Standard package.

Compatibility list for SIMATIC software packages with various versions of the STEP 7 Standard package. Compatibility list for SIMATIC software packages with various versions of the STEP 7 Standard package. Description of characters: X = combination perwithted = combination not perwithted ( ) = combintion

More information

Factoring Polynomials

Factoring Polynomials Factoring a Polynomial Expression Factoring a polynomial is expressing the polynomial as a product of two or more factors. Simply stated, it is somewhat the reverse process of multiplying. To factor polynomials,

More information

Projective Geometry. Stoienescu Paul. International Computer High School Of Bucharest,

Projective Geometry. Stoienescu Paul. International Computer High School Of Bucharest, Projective Geometry Stoienescu Paul International Computer High School Of Bucharest, Abstract. In this note, I will present some olympiad problems which can be solved using projective

More information

Manual for SOA Exam MLC.

Manual for SOA Exam MLC. Chapter 6. Benefit premiums. Extract from: Arcones Fall 2010 Edition, available at 1/77 Fully discrete benefit premiums In this section, we will consider the funding of insurance

More information

Functions and Equations

Functions and Equations Centre for Education in Mathematics and Computing Euclid eworkshop # Functions and Equations c 014 UNIVERSITY OF WATERLOO Euclid eworkshop # TOOLKIT Parabolas The quadratic f(x) = ax + bx + c (with a,b,c

More information


DHL EXPRESS CANADA E-BILL STANDARD SPECIFICATIONS DHL EXPRESS CANADA E-BILL STANDARD SPECIFICATIONS 1 E-Bill Standard Layout A B C D E F G Field/ DHL Account Number Billing Customer Name Billing Customer Address Billing Customer City Billing Customer

More information

tegrals as General & Particular Solutions

tegrals as General & Particular Solutions tegrals as General & Particular Solutions dy dx = f(x) General Solution: y(x) = f(x) dx + C Particular Solution: dy dx = f(x), y(x 0) = y 0 Examples: 1) dy dx = (x 2)2 ;y(2) = 1; 2) dy ;y(0) = 0; 3) dx

More information


4. PRINCIPLE OF MATHEMATICAL INDUCTION 4 PRINCIPLE OF MATHEMATICAL INDUCTION Ex Prove the following by principle of mathematical induction 1 1 + 2 + 3 + + n 2 1 2 + 2 2 + 3 2 + + n 2 3 1 3 + 2 3 + 3 3 + + n 3 + 4 (1) + (1 + 3) + (1 + 3 + 5)

More information

Worksheet 4.7. Polynomials. Section 1. Introduction to Polynomials. A polynomial is an expression of the form

Worksheet 4.7. Polynomials. Section 1. Introduction to Polynomials. A polynomial is an expression of the form Worksheet 4.7 Polynomials Section 1 Introduction to Polynomials A polynomial is an expression of the form p(x) = p 0 + p 1 x + p 2 x 2 + + p n x n (n N) where p 0, p 1,..., p n are constants and x is a

More information

Math 201 Lecture 12: Cauchy-Euler Equations

Math 201 Lecture 12: Cauchy-Euler Equations Mah 20 Lecure 2: Cauchy-Euler Equaions Feb., 202 Many examples here are aken from he exbook. The firs number in () refers o he problem number in he UA Cusom ediion, he second number in () refers o he problem

More information

Polynomials. Solving Equations by Using the Zero Product Rule

Polynomials. Solving Equations by Using the Zero Product Rule mil23264_ch05_303-396 9:21:05 06:16 PM Page 303 Polynomials 5.1 Addition and Subtraction of Polynomials and Polynomial Functions 5.2 Multiplication of Polynomials 5.3 Division of Polynomials 5.4 Greatest

More information

In the above, the number 19 is an example of a number because its only positive factors are one and itself.

In the above, the number 19 is an example of a number because its only positive factors are one and itself. Math 100 Greatest Common Factor and Factoring by Grouping (Review) Factoring Definition: A factor is a number, variable, monomial, or polynomial which is multiplied by another number, variable, monomial,

More information

CBOE Research Circular #RS DATE: November 2, 2005 TO: Members RE: New Listings

CBOE Research Circular #RS DATE: November 2, 2005 TO: Members RE: New Listings CBOE Research Circular #RS05-775 DATE: November 2, 2005 TO: Members RE: New Listings Arena Pharmaceuticals, Inc. (ARNA) Cabot Oil & Gas Corp. (COG) Centene Corp. (CNC) Active Date - 11/3/2005 Active Date

More information

Series Solutions of Differential Equations. Table of contents

Series Solutions of Differential Equations. Table of contents Series Solutions of Differential Equations Table of contents Series Solutions of Differential Equations..................................... Power series solutions..................................................

More information

Induction. Mathematical Induction. Induction. Induction. Induction. Induction. 29 Sept 2015

Induction. Mathematical Induction. Induction. Induction. Induction. Induction. 29 Sept 2015 Mathematical If we have a propositional function P(n), and we want to prove that P(n) is true for any natural number n, we do the following: Show that P(0) is true. (basis step) We could also start at

More information

To Advise the Market of the Annual Reporting to Calculate Syndicates' Deductibles

To Advise the Market of the Annual Reporting to Calculate Syndicates' Deductibles market bulletin Ref: Y4967 Title US Terrorism Risk Insurance Act of 2002, as amended ("TRIPRA 2015"). TRIA reporting Purpose Type From To Advise the Market of the Annual Reporting to Calculate Syndicates'

More information

Ź Ź ł ź Ź ś ź ł ź Ś ę ż ż ł ż ż Ż Ś ę Ż Ż ę ś ź ł Ź ł ł ż ż ź ż ż Ś ę ż ż Ź Ł Ż Ż Ą ż ż ę ź Ń Ź ś ł ź ż ł ś ź ź Ą ć ś ś Ź Ś ę ę ć ż Ź Ą Ń Ą ł ć ć ł ł ź ę Ś ę ś ę ł ś ć ź ś ł ś ł ł ł ł ć ć Ś ł ź Ś ł

More information


CLOGGING INDICATORS SUMMING-UP DESCRIPTION SUMMINGUP CLGGING INDICATRS PRESSURE FILTERS INDICATRS Pressure gauges Pressure switches Differential, visual Differential, electrical Differential, el. + LED Differential, el. + thermostat Differential,

More information

Exercise 1: Set up the Environment

Exercise 1: Set up the Environment RFID Lab Gildas Avoine, 2014 Contact: Objective: Learn how much it is easy to read contactless tags, possibly simulate/clone. Requirement: Hardware: Reader SCL3711 or ACR122, Reader

More information

Polynomials. Key Terms. quadratic equation parabola conjugates trinomial. polynomial coefficient degree monomial binomial GCF

Polynomials. Key Terms. quadratic equation parabola conjugates trinomial. polynomial coefficient degree monomial binomial GCF Polynomials 5 5.1 Addition and Subtraction of Polynomials and Polynomial Functions 5.2 Multiplication of Polynomials 5.3 Division of Polynomials Problem Recognition Exercises Operations on Polynomials

More information


REAL NUMBERS AND RADICALS CHAPTER REAL NUMBERS AND RADICALS Traditionally, we use units such as inches or meters to measure length, but we could technically measure with any sized unit.two line segments are called commeasurable

More information

Scilab Textbook Companion for Digital Electronics: An Introduction To Theory And Practice by W. H. Gothmann 1

Scilab Textbook Companion for Digital Electronics: An Introduction To Theory And Practice by W. H. Gothmann 1 Scilab Textbook Companion for Digital Electronics: An Introduction To Theory And Practice by W. H. Gothmann 1 Created by Aritra Ray B.Tech Electronics Engineering NIT-DURGAPUR College Teacher Prof. Sabyasachi

More information

Electronic Multi-Measuring Instrument

Electronic Multi-Measuring Instrument MITSUBISHI Electronic Multi-Measuring Instrument Programming Manual (CC-Link) For ver.1 remote device station Model ME96NSR-MB or ME96NSR with Optional Plug-in Module : ME-0040C-NS96 ME96SSH-MB or ME96SSR-MB

More information

!"#$%&'!"#$% & $$'# &#!"#$%&'!"] C ] ^ +!"!"#$%&' & ( )*!"+, -"./01 '!#$ ()*+,-.*!&#/0*1 ] C ] ^!"#$%&' C]^,]C #$%&!" Z #$%& ' $ $% (W) & * #"+ D ]^,

!#$%&'!#$% & $$'# &#!#$%&'!] C ] ^ +!!#$%&' & ( )*!+, -./01 '!#$ ()*+,-.*!&#/0*1 ] C ] ^!#$%&' C]^,]C #$%&! Z #$%& ' $ $% (W) & * #+ D ]^, !"#$%&'!" ()*+,-./' ' 01 23./' 456789:; + 2 < 3./' =>!"?@AB' 2 < 3 C B1 DE4 " 5 ' FGHIJ&KLMNO ' 5 FGHIJ&K MPQRSTUVW XY H HIJ&K Z [\ ]^_`HIa& bc RHIJ& @ 6) HIJ& H HIJ&K H HIJ&K ) ) HI1 J 5 ' Y G R F HIJ

More information

Homework 9 Solutions and Test 4 Review

Homework 9 Solutions and Test 4 Review Homework 9 Solutions and Test 4 Review Dr. Holmes May 6, 2012 1 Homework 9 Solutions This is the homework solution set followed by some test review remarks (none of which should be surprising). My proofs

More information


ON SOME CLASSES OF REGULAR ORDER SEMIGROUPS Commun. Korean Math. Soc. 23 (2008), No. 1, pp. 29 40 ON SOME CLASSES OF REGULAR ORDER SEMIGROUPS Zhenlin Gao and Guijie Zhang Reprinted from the Communications of the Korean Mathematical Society Vol.

More information

MATH 3795 Lecture 7. Linear Least Squares.

MATH 3795 Lecture 7. Linear Least Squares. MATH 3795 Lecture 7. Linear Least Squares. Dmitriy Leykekhman Fall 2008 Goals Basic properties of linear least squares problems. Normal equation. D. Leykekhman - MATH 3795 Introduction to Computational

More information

MATH 304 Linear Algebra Lecture 24: Scalar product.

MATH 304 Linear Algebra Lecture 24: Scalar product. MATH 304 Linear Algebra Lecture 24: Scalar product. Vectors: geometric approach B A B A A vector is represented by a directed segment. Directed segment is drawn as an arrow. Different arrows represent

More information

512B/513B Transcoding and FEC for 100 Gb/s Backplane and Copper Links

512B/513B Transcoding and FEC for 100 Gb/s Backplane and Copper Links 512B/513B Transcoding and FEC for 0 Gb/s Backplane and Copper Links IEEE 802.3 0 Gb/s Backplane and Copper Cable Study Group Chicago, September 13-14, 2011 Roy Cideciyan - Motivation for 512B/513B transcoding

More information

Derivatives and Graphs. Review of basic rules: We have already discussed the Power Rule.

Derivatives and Graphs. Review of basic rules: We have already discussed the Power Rule. Derivatives and Graphs Review of basic rules: We have already discussed the Power Rule. Product Rule: If y = f (x)g(x) dy dx = Proof by first principles: Quotient Rule: If y = f (x) g(x) dy dx = Proof,

More information

Sniffing SAP R GUI Passwords

Sniffing SAP R GUI Passwords Sniffing SAP R GUI Passwords 6. Juli 2009, Andreas Baus, René Ledosquet Abstract This paper describes a practical attack against the protocol used by SAP R for client server communication. The purpose

More information

Sticky Rice Cooking School Voted A Top 3 HotSpot in SA 2009. Sticky News. sticky rice cooking school newsletter

Sticky Rice Cooking School Voted A Top 3 HotSpot in SA 2009. Sticky News. sticky rice cooking school newsletter R C V T 3 H 29 N #4 29 j v M C R C P Y z K R Gvv H K L K D Cb 1 v M C Dv T F T b b Dv T I b b T x R C C v 8 b Dv T v Nvb 29 x 1 v q b b b 3 M C L C R P P W G T W bzz C v T C v b v b q v x x b C x C M L

More information

The set consisting of all natural numbers that are in A and are in B is the set f1; 3; 5g;

The set consisting of all natural numbers that are in A and are in B is the set f1; 3; 5g; Chapter 5 Set Theory 5.1 Sets and Operations on Sets Preview Activity 1 (Set Operations) Before beginning this section, it would be a good idea to review sets and set notation, including the roster method

More information


HEAVY DUTY MANUAL TRANSMISSION P. 23 23B 48 132 133 148 190 208 208 390F 390G 390H 390FGH P. 1000 1000 X 145 145 146 149 149 X 159 159 160H 184 188H 19 201H 202 203F 204H 205 206 207 211 25 395FGH 395F 395G 395H 43 H CP CK CK 250/1/

More information

x n = 1 x n In other words, taking a negative expoenent is the same is taking the reciprocal of the positive expoenent.

x n = 1 x n In other words, taking a negative expoenent is the same is taking the reciprocal of the positive expoenent. Rules of Exponents: If n > 0, m > 0 are positive integers and x, y are any real numbers, then: x m x n = x m+n x m x n = xm n, if m n (x m ) n = x mn (xy) n = x n y n ( x y ) n = xn y n 1 Can we make sense

More information

Hoe fraudeurs de draad kwijtraken

Hoe fraudeurs de draad kwijtraken Hoe fraudeurs de draad kwijtraken Bekkers, R.N.A.; Bongers, F.; Segers, J.; Schellekens, M.P.G.; Lim, A.S. Published: 01/01/2004 Document Version Publisher s PDF, also known as Version of Record (includes

More information

A Brief Review of Elementary Ordinary Differential Equations

A Brief Review of Elementary Ordinary Differential Equations 1 A Brief Review of Elementary Ordinary Differential Equations At various points in the material we will be covering, we will need to recall and use material normally covered in an elementary course on

More information

Interface Protocol v1.2

Interface Protocol v1.2 Interface Protocol v1.2 Uart Configure on PC Baud Rate Bits Stop bits Parity 9600 bps 8 Bits 1 Bit No Parity Basic Uart Transfer Format Start 0/1 : These bytes are both 0x55. Control : This byte is controling

More information

Pain-Free Injections

Pain-Free Injections T N S Bk P-F Ij I P Bk DV Dv Iv D D - I 8 8 9 1 D v C U C Y N D j I W U v v I k I W j k T k z D M I v 965 1 M Tk C P 1 2 v T I C G v j V T D v v A I W S DD G v v S D @ v DV M I USA! j DV - v - j I v v

More information


SIMSON S THEOREM MARY RIEGEL SIMSON S THEOREM MARY RIEGEL Abstract. This paper is a presentation and discussion of several proofs of Simson s Theorem. Simson s Theorem is a statement about a specific type of line as related to a given

More information

Entex Adventurevision Technical Specs V1.2 By Daniel Boris 12/18/2005

Entex Adventurevision Technical Specs V1.2 By Daniel Boris 12/18/2005 Entex Adventurevision Technical Specs V1.2 By Daniel Boris 12/18/2005 Disclaimer: All the information in this document comes from studying the actual Adventurevision hardware. The only technical document

More information


SERVER CERTIFICATES OF THE VETUMA SERVICE Page 1 Version: 3.5, 4.11.2015 SERVER CERTIFICATES OF THE VETUMA SERVICE 1 (18) Page 2 Version: 3.5, 4.11.2015 Table of Contents 1. Introduction... 3 2. Test Environment... 3 2.1 Vetuma test environment...

More information

KALE: A High-Degree Algebraic-Resistant Variant of The Advanced Encryption Standard

KALE: A High-Degree Algebraic-Resistant Variant of The Advanced Encryption Standard KALE: A High-Degree Algebraic-Resistant Variant of The Advanced Encryption Standard Dr. Gavekort c/o Vakiopaine Bar Kauppakatu 6, 41 Jyväskylä FINLAND Abstract. We have discovered that the

More information