III III a IIOI OlD III OlD IIO III DID III 100 III0 II uii IIi

Size: px
Start display at page:

Download "III III a IIOI OlD III OlD IIO 1101 010 III DID III 100 III0 II uii IIi"

Transcription

1 III III a IIOI OlD III OlD IIO III DID III 100 III0 II uii IIi US oi ^^_._.,o.i ^,) United States (12) Patent Application Publication Buyse et al. (43) Pub. Date: Oct. 28, (54) HPV POLYEPITOPE CONSTRUCTS AND USES THEREOF (76) Inventors: Marie-Ange Buyse, Merelbeke (BE); Denise Baker, Poway, CA (US) Correspondence Address: NIXON & VANDERHYE, PC 901 NORTH GLEBE ROAD, 11TH FLOOR ARLINGTON, VA (US) (21) Appl. No.: 12/451,743 (22) PCT Filed: May 29, 2008 Related U.S. Application Data (60) Provisional application No. 60/924,778, filed on May 31, (30) Foreign Application Priority Data Jun. 12, 2007 (EP) (51) Int. Cl. A61K 39/12 C07K 7/06 C07H 21/04 C12N 15/63 C12N 5/10 A61P 31/12 (52) U.S. Cl... Publication Classification ( ) ( ) ( ) ( ) ( ) ( ) 424/204.1; 530/328; 536/23.1; 435/320.1; 435/325 (86) PCT No.: PCT/EP2008/ (57) ABSTRACT The present invention is directed to HPV polyepitope con- 371 (c)(1), struct and the use thereoffor the prevention and/or treatment (2), (4) Date Jul. 1, 2010 of HPV infection.

2 Patent Application Publication Oct. 28, 2010 Sheet 1 of 17 US 2010/ Al A. ATCVSHRGLY - STDLRDHIDY - ATMCRHYKR - ILYAHIQCL - GTLGIVCPV - CYSLYGTTF - DSVYGDTLER - QVVPAYNISK - LYNLLIRCF - FVYIPLFLI - YYMTDAGTW - VVLLLVRYK - ISDYRHYCY - TVSATQLVK - STAAALYWYK - FVVYRDSIPK - SYFGMSFIHF - YMLDLQPETV - VYDFAFRDLCI - LQDKIIDHY - TLHDIILECV - KLTNTGLYNV - SVICFVNSK - MYVCCHVPL - SLQDIEITCV - CLYLHIQSL - AATKYPLLK - VYVFCFLLPM - KQGAMLAVFK - LSQMVQWAY - PYAVCDKCF - TVYVFCFLL - ATLQDIVLH - KSLFGMSLMK - GTGCNGWFY - RFHNIRGRF - KLLSK LLCV - STVSVGTAK - VAWDSVYYM - GYNTFYIEF - LYGVSFSEL - QVDYYGLYY - KSAIVTLTY - TLEKLTNTGLY B. GLYYVHEGIRTYFVQ - FLNTVAIPDSVQILV - QRFHNIRGRWTGRCM - TNTGLYNLLIRCLRCQ - IEFITFLGALKSFLK - PEWIQRQTVLQHSFN - LFVVYRDSIPHAACHK - IRTLEDLLMGTLGIV - LDLQPETTDLYCYEQ - LQAIEL QLTLETIYN - FQQLFLNTLSFVCPW - WKHMRLECAIYYKAR - LCTELQTTIHDIILE - FKTLIQPFILYAHIQ - LYWYKTGISNISEVY - EVFEFAFKDLFVVYR - HKAIELQMALQGLAQ - AKFVAAWTLKAAA FIGURE 1

3 Patent Application Publication Oct. 28, 2010 Sheet 2 of 17 US 2010/ Al A. FYSKVSEFRW RTEVYQFAFR VTTRYPLLR VFTFPNPFPF YTNWKFIYL - SVYGETLEK AVMCRHYKR VYGTTLEKL VVFIYIPLF KLLEKLLCI - GTGCNG WFY QTEPDTSNY PYLHSRLVVF LTDVSIACVY HYTNWKFIF FIYIPLFVI MVMLMLVRFK NTELYNLLI FLFTDLTIV FLLCFCVLL ATTPIIHLK - KLTNKG ICDL LQDKILDHY NTGILTVTY VMDDSEIAY STWHWTGCNK SYFGMSFIHF LSSALEIPY LSQMVQWAY SLVFLLCFSV TLYAHIQCL VFTFPHAFPF RQMNMSQWIK TLQEIVLHV AFTDLTIVY -ISFAGIVTK YVVWDSIYYI - YYITETG IW FYSRIRELRF VYQFAFKDL FLLCFSVCL YQFAFKDLCV SVYGTTLER KVSEFRWYRY ELDPVDLLCY STAAALYWYR VYVCAFAWLL B. EIVLHLEPQNELDPV IRILQELLMGSFGIV TGRCIACWRRPRTET WKHIRLECVLMYKAR LCIVYRDCIAYAACH PEWIERQTVLQHSFN PINISKSKAHKAIEL LRTLQQLFLSTLSFV FHSIAGQYRGQCNTC TTPIIHLKGDANILK DWVMAIFGVNPTVAEGF PRKLHELSSALEIPY FKTLIKPATLYAHIQ TIPNSVQISVGYMTI NGWFYVEAVIDRQTG VLDFAFTDLTIVYRD AKFVAAWTLKAAA FIGURE 2

4 Patent Application Publication Oct. 28, 2010 Sheet 3 of 17 US 2010/ Al AFTDLTIVY - STWHWTGCNK - KLLEKLLCI YQFAFKDLCV MVMLMLVRFK LQDKILDHY FLLCFCVLL SVYGTTLER VTTRYPLLR TLQEIVLHV YYITETGIW VVFIYIPLF QTEPDTSNY ELDPVDLLCY LTDVSIACVY RTEVYQFAFR PYLHSRLVVF ISFAGIVTK VMDDSEIAY FYSRIRELRF FIYIPLFVI VFTFPHAFPF FYSKVSEFRW SLVFLLCFSV STAAALYWYR TLYAHIQCL HYTNWKFIF NTELYNLLI SYFGMSFIHF KLTNKGICDL SVYGETLEK VYVCAFAWLL VYGTTLEKL LSQMVQWAY YVVWDSIYYI GTGCNGWFY AVMCRHYKR FLLCFSVCL VYQFAFKDL KVSEFRWYRY YTNWKFIYL LSSALEIPY FLFTDLTIV ATTPIIHLK RQMNMSQWIK NTGILTVTY VET FPNPFPF FIGURE 3

5 Patent Application Publication Oct. 28, 2010 Sheet 4 of 17 US 2010/ Al KSLFGMSLMK STDLRDHIDY LQDKIIDHY LYNLLIRCF AATKYPLLK QVDYYGLYY VVLLLVRYK STVSVGTAK KSAIVTLTY FVVYRDSIPK GTLGIVCPV STAAALYWYK ISDYRHYCY CLYLHIQSL FVYIPLFLI VYVFCFLLPM YYMTDAGTW SYFGMSFIHF LSQMVQWAY DSVYGDTLER SLQDIEITCV SVICFVNSK CYSLYGTTF VAWDSVYYM QVVPAYNISK GYNTFYIEF ATLQDIVLH TVYVFCFLL ILYAHIQCL TVSATQLVK TLHDIILECV PYAVCDKCF KLLSKLLCV KLTNTGLYNV MYVCCHVPL VYDFAFRDLI TLEKLTNTGLY GTGCNGWFY LYGVSFSEL KQGAMLAVFK - ATMCRHYKR - ATCVSHRGLY - RFHNIRGRF ;I YMLDLQPETV FIGURE 4

6 Patent Application Publication Oct. 28, 2010 Sheet 5 of 17 US 2010/ Al FIGURE 5 A. ICCG6137 Amino acid sequence MGMQVQIQSLFLLLLWVPGSRGAFTDLTIVYNSTWHWTGCNKKAAAKLLEKLLCINA YQFAFKDLCVKMVMLMLVRFKNAALQDKILDHYKAAFLLCFCVLLNSVYGTTLERNA AVTTRYPLLRNATLQEIVLHVNYYITETGIWKVVFIYIPLFNQTEPDTSNYGAAELD PVDLLCYKAAALTDVSIACVYNAARTEVYQFAFRNPYLHSRLVVFNISFAGIVTKKV MDDSEIAYNAFYSRIRELRFKAAAFIYIPLFVIKAVFTFPHAFPFNAFYSKVSEFRW KSLVFLLCFSVNASTAAALYWYRKATLYAHIQCLNAAHYTNWKFIFNAANTELYNLL INASYFGMSFIHFKLTNKGICDLNSVYGETLEKNVYVCAFAWLLNVYGTTLEKLKLS QMVQWAYKAAAYVVWDSIYYINGTGCNGWFYGAAAVMCRHYKRNFLLCFSVCLNAVY QFAFKDLKAAKVSEFRWYRYKYTNWKFIYLNAALSSALEIPYKAAFLFTDLTIVNAA TTPIIHLKNAAARQMNMSQWIKNTGILTVTYNVFTFPNPFPFKAAAEIVLHLEPQNE LDPVGPGPGIRILQELLMGSFGIVGPGPGTGRCIACWRRPRTETGPGPGWKHIRLEC VLMYKARGPGPGLCIVYRDCIAYAACHGPGPGPEWIERQTVLQHSFNGPGPGPINIS KSKAHKAIELGPGPGLRTLQQLFLSTLSFVGPGPGFHSIAGQYRGQCNTCGPGPGTT PIIHLKGDANILKGPGPGDWVMAIFGVNPTVAEGFGPGPGPRKLHELSSALEIPYGP GPGFKTLIKPATLYAHIQGPGPGTIPNSVQISVGYMTIGPGPGNGWFYVEAVIDRQT GGPGPGVLDFAFTDLTIVYRDGPGPGAKFVAAWTLKAAA (SEQ ID NO 123) B. ICCG6137 DNA sequence ATGGGCATGCAGGTGCAGATCCAGAGCCTGTTCCTGCTGCTGCTGTGGGTGCCCGGC AGCAGGGGCGCTTTCACCGACCTGACCATCGTGTACAACAGCACCTGGCACTGGACC GGCTGCAACAAGAAAGCCGCTGCCAAGCTGCTGGAAAAGCTGCTGTGCATCAACGCC TATCAGTTTGCCTTCAAGGACCTGTGCGTGAAGATGGTGATGCTGATGCTGGTGCGG TTCAAGAATGCCGCTCTCCAGGACAAGATCCTGGACCACTACAAGGCCGCCTTTCTG CTGTGCTTCTGCGTGCTGCTGAACAGCGTGTACGGCACCACCCTGGAACGGAACGCC GCCGTGACCACCAGATACCCCCTGCTGCGGAATGCCACCCTCCAGGAAATCGTCCTG CACGTCAATTACTACATCACCGAGACCGGCATCTGGAAGGTGGTGTTCATCTACATC CCCCTGTTCAACCAGACCGAGCCCGACACCAGCAACTACGGAGCCGCCGAACTCGAT CCCGTGGACCTGCTGTGCTACAAAGCCGCTGCCCTGACCGACGTGAGCATCGCCTGC GTGTACAACGCCGCCAGGACCGAGGTGTACCAGTTTGCCTTTCGGAACCCCTACCTG CACAGCAGACTGGTGGTGTTTAACATCAGCTTCGCCGGCATCGTGACCAAGAAAGTG ATGGACGACAGCGAGATCGCCTACAACGCCTTCTACAGCCGGATCAGAGAGCTGAGG TTCAAAGCCGCTGCCTTTATCTACATTCCTCTGTTCGTGATCAAGGCCGTGTTCACC TTCCCCCACGCCTTCCCTTTCAATGCCTTCTACTCCAAGGTGTCCGAGTTCCGGTGG AAGAGCCTGGTGTTCCTGCTGTGTTTCAGCGTGAACGCCAGCACCGCCGCTGCCCTG TACTGGTACAGGAAGGCCACCCTGTACGCCCATATCCAGTGCCTGAATGCCGCCCAC TACACCAACTGGAAGTTCATCTTCAATGCCGCCAACACCGAGCTGTACAACCTGCTG ATCAACGCCAGCTACTTCGGCATGAGCTTCATCCACTTCAAGCTGACCAACAAGGGC ATCTGCGACCTGAACTCCGTGTACGGCGAGACACTGGAAAAGAACGTGTACGTGTGC GCCTTCGCCTGGCTGCTGAACGTGTATGGCACAACACTGGAAAAACTGAAGCTGTCC CAGATGGTGCAGTGGGCCTATAAAGCCGCCGCCTACGTGGTGTGGGACAGCATCTAC TATATCAACGGCACCGGCTGTAACGGCTGGTTTTACGGCGCCGCTGCCGTGATGTGC CGGCACTACAAGCGGAATTTTCTGCTGTGTTTTTCCGTGTGCCTGAACGCCGTGTAT

7 Patent Application Publication Oct. 28, 2010 Sheet 6 of 17 US 2010/ Al CAGTTCGCCTTTAAGGATCTGAAGGCTGCCAAAGTGTCTGAGTTCAGATGGTACAGG TACAAGTACACAAATTGGAAGTTTATCTATCTGAACGCCGCCCTGAGCAGCGCCCTG GAAATCCCCTATAAGGCTGCCTTCCTGTTCACCGATCTGACTATTGTGAACGCCGCC ACCACCCCCATCATCCACCTGAAAAACGCCGCTGCCAGGCAGATGAACATGAGCCAG TGGATCAAGAACACCGGCATCCTGACCGTGACCTACAACGTGTTTACCTTTCCCAAC CCTTTCCCCTTTAAAGCCGCTGCCGAGATCGTGCTGCACCTGGAACCCCAGAACGAG CTGGACCCTGTGGGCCCTGGCCCTGGCATCAGAATCCTCCAGGAACTGCTGATGGGC AGCTTCGGCATCGTGGGCCCAGGCCCCGGAACCGGCCGGTGCATCGCCTGTTGGCGG AGGCCCCGGACCGAGACAGGCCCTGGACCCGGCTGGAAGCACATCCGGCTGGAATGC GTGCTGATGTACAAGGCCAGGGGACCCGGCCCTGGCCTCTGTATCGTGTACCGCGAC TGCATCGCCTACGCCGCCTGCCACGGCCCAGGACCTGGCCCCGAGTGGATCGAGCGG CAGACCGTGCTCCAGCATAGCTTCAACGGACCCGGACCAGGCCCCATCAACATCAGC AAGAGCAAGGCCCACAAGGCCATCGAGCTGGGCCCTGGGCCCGGACTGCGGACCCTC CAGCAGCTGTTCCTGAGCACCCTGAGCTTCGTGGGACCTGGGCCAGGCTTCCACAGC ATCGCCGGCCAGTACCGGGGCCAGTGCAACACCTGCGGCCCAGGGCCAGGCACCACA CCTATTATTCACCTGAAGGGCGACGCCAACATCCTGAAGGGGCCAGGACCCGGCGAC TGGGTGATGGCCATCTTCGGCGTGAACCCCACCGTGGCCGAGGGCTTCGGACCTGGA CCTGGGCCTAGGAAGCTGCACGAGCTGTCCTCTGCCCTGGAAATTCCTTACGGCCCT GGCCCAGGCTTCAAGACCCTGATCAAGCCCGCCACACTGTATGCCCACATTCAGGGC CCTGGACCAGGCACCATCCCCAACAGCGTGCAGATCAGCGTGGGCTACATGACCATC GGACCAGGGCCTGGCAATGGCTGGTTCTACGTGGAGGCCGTGATCGACAGGCAGACC GGCGGACCTGGCCCAGGGGTGCTGGACTTCGCCTTTACAGACCTGACAATTGTGTAC CGGGACGGCCCTGGGCCTGGCGCCAAGTTCGTGGCCGCCTGGACCCTGAAGGCCGCT GCCTGA (SEQ ID NO 124) C. AFTDLTIVYNSTWHWTGCNKKAAAKLLEKLLCINAYQFAFKDLCVKMVMLMLVRFKN AALQDKILDHYKAAFLLCFCVLLNSVYGTTLERNAAVTTRYPLLRNATLQEIVLHVN YYITETGIWKVVFIYIPLFNQTEPDTSNYGAAELDPVDLLCYKAAALTDVSIACVYN AARTEVYQFAFRNPYLHSRLVVFNISFAGIVTKKVMDDSEIAYNAFYSRIRELRFKA AAFIYIPLFVIKAVFTFPHAFPFNAFYSKVSEFRWKSLVFLLCFSVNASTAAALYWY RKATLYAHIQCLNAAHYTNWKFIFNAANTELYNLLINASYFGMSFIHFKLTNKGICD LNSVYGETLEKNVYVCAFAWLLNVYGTTLEKLKLSQMVQWAYKAAAYVVWDSIYYIN GTGCNGWFYGAAAVMCRHYKRNFLLCFSVCLNAVYQFAFKDLKAAKVSEFRWYRYKY TNWKFIYLNAALSSALEIPYKAAFLFTDLTIVNAATTPIIHLKNAAARQMNMSQWIK NTGILTVTYNVFTFPNPFPFKAAAEIVLHLEPQNELDPVGPGPGIRILQELLMGSFG IVGPGPGTGRCIACWRRPRTETGPGPGWKHIRLECVLMYKARGPGPGLCIVYRDCIA YAACHGPGPGPEWIERQTVLQHSFNGPGPGPINISKSKAHKAIELGPGPGLRTLQQL FLSTLSFVGPGPGFHSIAGQYRGQCNTCGPGPGTTPIIHLKGDANILKGPGPGDWVM AI FGVNPTVAEGFGPGPGPRKLHELSSALEIPYGPGPGFKTLIKPATLYAHIQGPGP GTIPNSVQISVGYMTIGPGPGNGWFYVEAVIDRQTGGPGPGVLDFAFTDLTIVYRDG PGPGAKFVAAWTLKAAA (SEQ ID NO 156) FIGURE 5 cont.1

8 Patent Application Publication Oct. 28, 2010 Sheet 7 of 17 US 2010/ Al a GCTTTCACCGACCTGACCATCGTGTACAACAGCACCTGGCACTGGACCGGCTGCAAC AAGAAAGCCGCTGCCAAGCTGCTGGAAAAGCTGCTGTGCATCAACGCCTATCAGTTT GCCTTCAAGGACCTGTGCGTGAAGATGGTGATGCTGATGCTGGTGCGGTTCAAGAAT GCCGCTCTCCAGGACAAGATCCTGGACCACTACAAGGCCGCCTTTCTGCTGTGCTTC TGCGTGCTGCTGAACAGCGTGTACGGCACCACCCTGGAACGGAACGCCGCCGTGACC ACCAGATACCCCCTGCTGCGGAATGCCACCCTCCAGGAAATCGTCCTGCACGTCAAT TACTACATCACCGAGACCGGCATCTGGAAGGTGGTGTTCATCTACATCCCCCTGTTC AACCAGACCGAGCCCGACACCAGCAACTACGGAGCCGCCGAACTCGATCCCGTGGAC CTGCTGTGCTACAAAGCCGCTGCCCTGACCGACGTGAGCATCGCCTGCGTGTACAAC GCCGCCAGGACCGAGGTGTACCAGTTTGCCTTTCGGAACCCCTACCTGCACAGCAGA CTGGTGGTGTTTAACATCAGCTTCGCCGGCATCGTGACCAAGAAAGTGATGGACGAC AGCGAGATCGCCTACAACGCCTTCTACAGCCGGATCAGAGAGCTGAGGTTCAAAGCC GCTGCCTTTATCTACATTCCTCTGTTCGTGATCAAGGCCGTGTTCACCTTCCCCCAC GCCTTCCCTTTCAATGCCTTCTACTCCAAGGTGTCCGAGTTCCGGTGGAAGAGCCTG GTGTTCCTGCTGTGTTTCAGCGTGAACGCCAGCACCGCCGCTGCCCTGTACTGGTAC AGGAAGGCCACCCTGTACGCCCATATCCAGTGCCTGAATGCCGCCCACTACACCAAC TGGAAGTTCATCTTCAATGCCGCCAACACCGAGCTGTACAACCTGCTGATCAACGCC AGCTACTTCGGCATGAGCTTCATCCACTTCAAGCTGACCAACAAGGGCATCTGCGAC CTGAACTCCGTGTACGGCGAGACACTGGAAAAGAACGTGTACGTGTGCGCCTTCGCC TGGCTGCTGAACGTGTATGGCACAACACTGGAAAAACTGAAGCTGTCCCAGATGGTG CAGTGGGCCTATAAAGCCGCCGCCTACGTGGTGTGGGACAGCATCTACTATATCAAC GGCACCGGCTGTAACGGCTGGTTTTACGGCGCCGCTGCCGTGATGTGCCGGCACTAC AAGCGGAATTTTCTGCTGTGTTTTTCCGTGTGCCTGAACGCCGTGTATCAGTTCGCC TTTAAGGATCTGAAGGCTGCCAAAGTGTCTGAGTTCAGATGGTACAGGTACAAGTAC ACAAATTGGAAGTTTATCTATCTGAACGCCGCCCTGAGCAGCGCCCTGGAAATCCCC TATAAGGCTGCCTTCCTGTTCACCGATCTGACTATTGTGAACGCCGCCACCACCCCC ATCATCCACCTGAAAAACGCCGCTGCCAGGCAGATGAACATGAGCCAGTGGATCAAG AACACCGGCATCCTGACCGTGACCTACAACGTGTTTACCTTTCCCAACCCTTTCCCC TTTAAAGCCGCTGCCGAGATCGTGCTGCACCTGGAACCCCAGAACGAGCTGGACCCT GTGGGCCCTGGCCCTGGCATCAGAATCCTCCAGGAACTGCTGATGGGCAGCTTCGGC ATCGTGGGCCCAGGCCCCGGAACCGGCCGGTGCATCGCCTGTTGGCGGAGGCCCCGG ACCGAGACAGGCCCTGGACCCGGCTGGAAGCACATCCGGCTGGAATGCGTGCTGATG TACAAGGCCAGGGGACCCGGCCCTGGCCTCTGTATCGTGTACCGCGACTGCATCGCC TACGCCGCCTGCCACGGCCCAGGACCTGGCCCCGAGTGGATCGAGCGGCAGACCGTG CTCCAGCATAGCTTCAACGGACCCGGACCAGGCCCCATCAACATCAGCAAGAGCAAG GCCCACAAGGCCATCGAGCTGGGCCCTGGGCCCGGACTGCGGACCCTCCAGCAGCTG TTCCTGAGCACCCTGAGCTTCGTGGGACCTGGGCCAGGCTTCCACAGCATCGCCGGC CAGTACCGGGGCCAGTGCAACACCTGCGGCCCAGGGCCAGGCACCACACCTATTATT CACCTGAAGGGCGACGCCAACATCCTGAAGGGGCCAGGACCCGGCGACTGGGTGATG GCCATCTTCGGCGTGAACCCCACCGTGGCCGAGGGCTTCGGACCTGGACCTGGGCCT AGGAAGCTGCACGAGCTGTCCTCTGCCCTGGAAATTCCTTACGGCCCTGGCCCAGGC TTCAAGACCCTGATCAAGCCCGCCACACTGTATGCCCACATTCAGGGCCCTGGACCA GGCACCATCCCCAACAGCGTGCAGATCAGCGTGGGCTACATGACCATCGGACCAGGG CCTGGCAATGGCTGGTTCTACGTGGAGGCCGTGATCGACAGGCAGACCGGCGGACCT GGCCCAGGGGTGCTGGACTTCGCCTTTACAGACCTGACAATTGTGTACCGGGACGGC CCTGGGCCTGGCGCCAAGTTCGTGGCCGCCTGGACCCTGAAGGCCGCTGCC (SEQ ID NO 157) FIGURE 5 cont

9 Patent Application Publication Oct. 28, 2010 Sheet 8 of 17 US 2010/ Al FIGURE 6 A. ICCG6138 Amino acid sequence MGMQVQIQSLFLLLLWVPGSRGFYSKVSEFRWKAARTEVYQFAFRNAAVTTRYPLLR NVFTFPNPFPFNYTNWKFIYLNASVYGETLEKGAAVMCRHYKRNAVYGTTLEKLKVV FIYIPLFGAAKLLEKLLCINGTGCNGWFYNQTEPDTSNYNAAAPYLHSRLVVFGAAA LTDVSIACVYNAHYTNWKFIFGAAFIYIPLFVIKAAAMVMLMLVRFKNAANTELYNL LINFLFTDLTIVNFLLCFCVLLNAATTPIIHLKGAAKLTNKGICDLNALQDKILDHY KNTGILTVTYGAAAVMDDSEIAYNSTWHWTGCNKKAASYFGMSFIHFKLSSALEIPY KLSQMVQWAYNSLVFLLCFSVNATLYAHIQCLNVFTFPHAFPFNAAARQMNMSQWIK NATLQEIVLHVNAAFTDLTIVYNISFAGIVTKKYVVWDSIYYINYYITETGIWKAAA FYSRIRELRFKVYQFAFKDLKAFLLCFSVCLNAAYQFAFKDLCVKSVYGTTLERNKV SEFRWYRYKAAELDPVDLLCYKSTAAALYWYRKAAAVYVCAFAWLLEIVLHLEPQNE LDPVGPGPGIRILQELLMGSFGIVGPGPGTGRCIACWRRPRTETGPGPGWKHIRLEC VLMYKARGPGPGLCIVYRDCIAYAACHGPGPGPEWIERQTVLQHSFNGPGPGPINIS KSKAHKAIELGPGPGLRTLQQLFLSTLSFVGPGPGFHSIAGQYRGQCNTCGPGPGTT PIIHLKGDANILKGPGPGDWVMAIFGVNPTVAEGFGPGPGPRKLHELSSALEIPYGP GPGFKTLIKPATLYAHIQGPGPGTIPNSVQISVGYMTIGPGPGNGWFYVEAVIDRQT GGPGPGVLDFAFTDLTIVYRDGPGPGAKFVAAWTLKAAA (SEQ ID NO 125) B. ICCG6138 DNA sequence ATGGGCATGCAGGTGCAGATCCAGAGCCTGTTCCTGCTGCTGCTGTGGGTGCCCGGC AGCCGGGGCTTCTACAGCAAGGTGTCCGAGTTCCGGTGGAAGGCCGCCAGGACCGAG GTGTACCAGTTCGCCTTCCGGAACGCCGCCGTGACCACCAGATACCCCCTGCTGCGG AACGTGTTCACCTTCCCCAACCCCTTCCCTTTCAACTACACCAACTGGAAGTTCATC TACCTGAACGCCAGCGTGTACGGCGAGACCCTGGAAAAGGGAGCAGCCGTGATGTGC CGGCACTACAAGCGGAACGCCGTGTACGGCACCACACTGGAAAAGCTGAAGGTGGTG TTCATCTACATCCCCCTGTTCGGAGCCGCCAAGCTGCTGGAAAAACTGCTGTGCATC AACGGCACCGGCTGCAACGGCTGGTTCTACAACCAGACCGAGCCCGACACCAGCAAC TACAATGCTGCCGCCCCCTACCTGCACAGCAGACTGGTGGTGTTTGGGGCTGCCGCC CTGACCGACGTGAGCATCGCCTGCGTGTACAACGCCCACTACACAAATTGGAAATTC ATTTTTGGAGCCGCCTTCATCTATATTCCTCTGTTCGTGATCAAAGCCGCCGCTATG GTGATGCTGATGCTGGTGCGGTTCAAGAACGCCGCCAACACCGAGCTGTACAACCTG CTGATCAACTTCCTGTTCACCGACCTGACCATCGTGAACTTTCTCCTGTGTTTCTGC GTGCTCCTGAATGCCGCCACAACCCCCATCATCCACCTGAAGGGAGCCGCCAAACTG ACCAACAAGGGCATCTGCGACCTGAATGCCCTCCAGGACAAGATCCTGGACCACTAC AAGAACACCGGCATCCTGACCGTGACCTATGGAGCCGCTGCCGTGATGGACGACAGC GAGATCGCCTACAACAGCACCTGGCACTGGACCGGCTGTAACAAGAAGGCCGCCTCC TACTTCGGCATGAGCTTCATCCACTTCAAGCTGTCCAGCGCCCTGGAAATCCCCTAC AAGCTGTCCCAGATGGTGCAGTGGGCCTACAACTCCCTGGTGTTCCTGCTGTGTTTC AGCGTGAACGCAACCCTCTATGCCCACATCCAGTGCCTGAATGTGTTTACCTTCCCT CACGCCTTTCCCTTCAATGCCGCCGCCAGACAGATGAACATGAGCCAGTGGATCAAG AATGCCACCCTCCAGGAGATTGTCCTGCACGTCAATGCCGCCTTTACTGATCTGACT ATCGTGTACAACATCAGCTTCGCCGGCATCGTGACCAAGAAATACGTGGTGTGGGAC AGCATCTACTACATCAATTACTACATCACCGAGACCGGCATCTGGAAAGCTGCCGCC

10 Patent Application Publication Oct. 28, 2010 Sheet 9 of 17 US 2010/ Al TTCTACAGCCGGATCAGGGAGCTGAGGTTCAAAGTGTATCAGTTTGCTTTCAAAGAC CTGAAAGCCTTCCTGCTGTGCTTTTCCGTGTGCCTGAACGCCGCCTACCAGTTTGCC TTTAAGGATCTGTGCGTGAAGAGCGTGTATGGCACAACCCTGGAACGGAACAAAGTG TCTGAGTTCCGCTGGTACAGGTATAAGGCCGCCGAACTCGATCCCGTGGATCTGCTG TGTTACAAGAGCACTGCCGCCGCACTGTACTGGTATAGGAAGGCTGCCGCCGTGTAC GTGTGCGCCTTCGCCTGGCTGCTGGAGATCGTGCTGCACCTGGAACCCCAGAACGAG CTGGACCCTGTGGGCCCTGGCCCTGGCATCAGAATCCTCCAGGAACTGCTGATGGGC AGCTTCGGCATCGTGGGCCCAGGCCCCGGAACCGGCCGGTGCATCGCCTGTTGGCGG AGGCCCCGGACCGAGACAGGCCCTGGACCCGGCTGGAAGCACATCCGGCTGGAATGC GTGCTGATGTACAAGGCCAGGGGACCCGGCCCTGGCCTCTGTATCGTGTACCGCGAC TGCATCGCCTACGCCGCCTGCCACGGCCCAGGACCTGGCCCCGAGTGGATCGAGCGG CAGACCGTGCTCCAGCATAGCTTCAACGGACCCGGACCAGGCCCCATCAACATCAGC AAGAGCAAGGCCCACAAGGCCATCGAGCTGGGCCCTGGGCCCGGACTGCGGACCCTC CAGCAGCTGTTCCTGAGCACCCTGAGCTTCGTGGGACCTGGGCCAGGCTTCCACAGC ATCGCCGGCCAGTACCGGGGCCAGTGCAACACCTGCGGCCCAGGGCCAGGCACCACA CCTATTATTCACCTGAAGGGCGACGCCAACATCCTGAAGGGGCCAGGACCCGGCGAC TGGGTGATGGCCATCTTCGGCGTGAACCCCACCGTGGCCGAGGGCTTCGGACCTGGA CCTGGGCCTAGGAAGCTGCACGAGCTGTCCTCTGCCCTGGAAATTCCTTACGGCCCT GGCCCAGGCTTCAAGACCCTGATCAAGCCCGCCACACTGTATGCCCACATTCAGGGC CCTGGACCAGGCACCATCCCCAACAGCGTGCAGATCAGCGTGGGCTACATGACCATC GGACCAGGGCCTGGCAATGGCTGGTTCTACGTGGAGGCCGTGATCGACAGGCAGACC GGCGGACCTGGCCCAGGGGTGCTGGACTTCGCCTTTACAGACCTGACAATTGTGTAC CGGGACGGCCCTGGGCCTGGCGCCAAGTTCGTGGCCGCCTGGACCCTGAAGGCCGCT GCCTGA (SEQ ID NO 126) 102 FYSKVSEFRWKAARTEVYQFAFRNAAVTTRYPLLRNVFTFPNPFPFNYTNWKFIYLN ASVYGETLEKGAAVMCRHYKRNAVYGTTLEKLKVVFIYIPLFGAAKLLEKLLCINGT GCNGWFYNQTEPDTSNYNAAAPYLHSRLVVFGAAALTDVSIACVYNAHYTNWKFIFG AAFIYIPLFVIKAAAMVMLMLVRFKNAANTELYNLLINFLFTDLTIVNFLLCFCVLL NAATTPIIHLKGAAKLTNKGICDLNALQDKILDHYKNTGILTVTYGAAAVMDDSEIA YNSTWHWTGCNKKAASYFGMSFIHFKLSSALEIPYKLSQMVQWAYNSLVFLLCFSVN ATLYAHIQCLNVFTFPHAFPFNAAARQMNMSQWIKNATLQEIVLHVNAAFTDLTIVY NISFAGIVTKKYVVWDSIYYINYYITETGIWKAAAFYSRIRELRFKVYQFAFKDLKA FLLCFSVCLNAAYQFAFKDLCVKSVYGTTLERNKVSEFRWYRYKAAELDPVDLLCYK STAAALYWYRKAAAVYVCAFAWLLEIVLHLEPQNELDPVGPGPGIRILQELLMGSFG IVGPGPGTGRCIACWRRPRTETGPGPGWKHIRLECVLMYKARGPGPGLCIVYRDCIA YAACHGPGPGPEWIERQTVLQHSFNGPGPGPINISKSKAHKAIELGPGPGLRTLQQL FLSTLSFVGPGPGFHSIAGQYRGQCNTCGPGPGTTPIIHLKGDANILKGPGPGDWVM Al FGVNPTVAEGFGPGPGPRKLHELSSALEIPYGPGPGFKTLIKPATLYAHIQGPGP GTIPNSVQISVGYMTIGPGPGNGWFYVEAVIDRQTGGPGPGVLDFAFTDLTIVYRDG PGPGAKFVAAWTLKAAA (SEQ ID NO 158) FIGURE 6 cont.1

11 Patent Application Publication Oct. 28, 2010 Sheet 10 of 17 US 2010/ Al ij TTCTACAGCAAGGTGTCCGAGTTCCGGTGGAAGGCCGCCAGGACCGAGGTGTACCAG TTCGCCTTCCGGAACGCCGCCGTGACCACCAGATACCCCCTGCTGCGGAACGTGTTC ACCTTCCCCAACCCCTTCCCTTTCAACTACACCAACTGGAAGTTCATCTACCTGAAC GCCAGCGTGTACGGCGAGACCCTGGAAAAGGGAGCAGCCGTGATGTGCCGGCACTAC AAGCGGAACGCCGTGTACGGCACCACACTGGAAAAGCTGAAGGTGGTGTTCATCTAC ATCCCCCTGTTCGGAGCCGCCAAGCTGCTGGAAAAACTGCTGTGCATCAACGGCACC GGCTGCAACGGCTGGTTCTACAACCAGACCGAGCCCGACACCAGCAACTACAATGCT GCCGCCCCCTACCTGCACAGCAGACTGGTGGTGTTTGGGGCTGCCGCCCTGACCGAC GTGAGCATCGCCTGCGTGTACAACGCCCACTACACAAATTGGAAATTCATTTTTGGA GCCGCCTTCATCTATATTCCTCTGTTCGTGATCAAAGCCGCCGCTATGGTGATGCTG ATGCTGGTGCGGTTCAAGAACGCCGCCAACACCGAGCTGTACAACCTGCTGATCAAC TTCCTGTTCACCGACCTGACCATCGTGAACTTTCTCCTGTGTTTCTGCGTGCTCCTG AATGCCGCCACAACCCCCATCATCCACCTGAAGGGAGCCGCCAAACTGACCAACAAG GGCATCTGCGACCTGAATGCCCTCCAGGACAAGATCCTGGACCACTACAAGAACACC GGCATCCTGACCGTGACCTATGGAGCCGCTGCCGTGATGGACGACAGCGAGATCGCC TACAACAGCACCTGGCACTGGACCGGCTGTAACAAGAAGGCCGCCTCCTACTTCGGC ATGAGCTTCATCCACTTCAAGCTGTCCAGCGCCCTGGAAATCCCCTACAAGCTGTCC CAGATGGTGCAGTGGGCCTACAACTCCCTGGTGTTCCTGCTGTGTTTCAGCGTGAAC GCAACCCTCTATGCCCACATCCAGTGCCTGAATGTGTTTACCTTCCCTCACGCCTTT CCCTTCAATGCCGCCGCCAGACAGATGAACATGAGCCAGTGGATCAAGAATGCCACC CTCCAGGAGATTGTCCTGCACGTCAATGCCGCCTTTACTGATCTGACTATCGTGTAC AACATCAGCTTCGCCGGCATCGTGACCAAGAAATACGTGGTGTGGGACAGCATCTAC TACATCAATTACTACATCACCGAGACCGGCATCTGGAAAGCTGCCGCCTTCTACAGC CGGATCAGGGAGCTGAGGTTCAAAGTGTATCAGTTTGCTTTCAAAGACCTGAAAGCC TTCCTGCTGTGCTTTTCCGTGTGCCTGAACGCCGCCTACCAGTTTGCCTTTAAGGAT CTGTGCGTGAAGAGCGTGTATGGCACAACCCTGGAACGGAACAAAGTGTCTGAGTTC CGCTGGTACAGGTATAAGGCCGCCGAACTCGATCCCGTGGATCTGCTGTGTTACAAG AGCACTGCCGCCGCACTGTACTGGTATAGGAAGGCTGCCGCCGTGTACGTGTGCGCC TTCGCCTGGCTGCTGGAGATCGTGCTGCACCTGGAACCCCAGAACGAGCTGGACCCT GTGGGCCCTGGCCCTGGCATCAGAATCCTCCAGGAACTGCTGATGGGCAGCTTCGGC ATCGTGGGCCCAGGCCCCGGAACCGGCCGGTGCATCGCCTGTTGGCGGAGGCCCCGG ACCGAGACAGGCCCTGGACCCGGCTGGAAGCACATCCGGCTGGAATGCGTGCTGATG TACAAGGCCAGGGGACCCGGCCCTGGCCTCTGTATCGTGTACCGCGACTGCATCGCC TACGCCGCCTGCCACGGCCCAGGACCTGGCCCCGAGTGGATCGAGCGGCAGACCGTG CTCCAGCATAGCTTCAACGGACCCGGACCAGGCCCCATCAACATCAGCAAGAGCAAG GCCCACAAGGCCATCGAGCTGGGCCCTGGGCCCGGACTGCGGACCCTCCAGCAGCTG TTCCTGAGCACCCTGAGCTTCGTGGGACCTGGGCCAGGCTTCCACAGCATCGCCGGC CAGTACCGGGGCCAGTGCAACACCTGCGGCCCAGGGCCAGGCACCACACCTATTATT CACCTGAAGGGCGACGCCAACATCCTGAAGGGGCCAGGACCCGGCGACTGGGTGATG GCCATCTTCGGCGTGAACCCCACCGTGGCCGAGGGCTTCGGACCTGGACCTGGGCCT AGGAAGCTGCACGAGCTGTCCTCTGCCCTGGAAATTCCTTACGGCCCTGGCCCAGGC TTCAAGACCCTGATCAAGCCCGCCACACTGTATGCCCACATTCAGGGCCCTGGACCA GGCACCATCCCCAACAGCGTGCAGATCAGCGTGGGCTACATGACCATCGGACCAGGG CCTGGCAATGGCTGGTTCTACGTGGAGGCCGTGATCGACAGGCAGACCGGCGGACCT GGCCCAGGGGTGCTGGACTTCGCCTTTACAGACCTGACAATTGTGTACCGGGACGGC CCTGGGCCTGGCGCCAAGTTCGTGGCCGCCTGGACCCTGAAGGCCGCTGCC (SEQ ID NO 159) FIGURE 6 cont.2

12 Patent Application Publication Oct. 28, 2010 Sheet 11 of 17 US 2010/ Al FIGURE 7 A. ICCG6149 Amino acid sequence MGMQVQIQSLFLLLLWVPGSRGKSLFGMSLMKNSTAAALYWYKKAACYSLYGTTFKA AAVAWDSVYYMKSTDLRDHIDYNISDYRHYCYKAAQVVPAYNISKNGYNTFYIEFKL QDKIIDHYKAACLYLHIQSLNAAAATLQDIVLHGTVYVFCFLLNAILYAHIQCLNAA LYNLLIRCFKAAFVYIPLFLINTVSATQLVKNGTGCNGWFYNAATKYPLLKNVYVFC FLLPMNATLHDIILECVKAAALYGVSFSELKQVDYYGLYYGAYYMTDAGTWNAAPYA VCDKCFKQGAMLAVFKKAAAVVLLLVRYKNAAASYFGMSFIHFKAAKLLSKLLCVNA AAATMCRHYKRNAAASTVSVGTAKNAALSQMVQWAYKLTNTGLYNVNAAATCVSHRG LYNAAKSAIVTLTYKAAADSVYGDTLERNMYVCCHVPLNAARFHNIRGRFKAAFVVY RDSIPKNASLQDIEITCVKAVYDFAFRDLCIKYMLDLQPETVNAAAGTLGIVCPVNS VICFVNSKNATLEKLTNTGLYNAGLYYVHEGIRTYFVQGPGPGFLNTVAIPDSVQIL VGPGPGQRFHNIRGRWTGRCMGPGPGTNTGLYNLLIRCLRCQGPGPGIEFITFLGAL KSFLKGPGPGPEWIQRQTVLQHSFNGPGPGLFVVYRDSIPHAACHKGPGPGIRTLED LLMGTLGIVGPGPGLDLQPETTDLYCYEQGPGPGLQAIELQLTLETIYNGPGPGFQQ LFLNTLSFVCPWGPGPGWKHMRLECAIYYKARGPGPGLCTELQTTI HDI I LEGPGPG FKTLIQPFILYAHIQGPGPGLYWYKTGISNISEVYGPGPGEVFEFAFKDLFVVYRGP GPGHKAIELQMALQGLAQGPGPGAKFVAAWTLKAAA (SEQ ID NO 127) B. ICCG6149 DNA sequence ATGGGCATGCAGGTGCAGATCCAGAGCCTGTTCCTGCTGCTGCTGTGGGTGCCCGGC AGCCGGGGCAAGAGCCTGTTTGGCATGAGCCTGATGAAGAACAGCACCGCCGCTGCC CTCTATTGGTACAAAAAGGCCGCCTGCTACAGCCTGTACGGCACCACCTTCAAGGCT GCTGCCGTGGCCTGGGACAGCGTGTACTACATGAAGAGCACCGACCTGCGGGACCAC ATCGACTACAACATCAGCGACTACCGGCACTACTGCTACAAGGCCGCCCAGGTGGTG CCCGCCTACAACATCTCCAAGAACGGCTACAACACCTTCTACATCGAGTTCAAGCTC CAGGACAAGATCATCGACCACTACAAAGCCGCCTGCCTGTACCTGCACATCCAGAGT CTGAACGCAGCCGCTGCAACCCTCCAGGACATCGTGCTGCACGGCACCGTGTACGTG TTCTGCTTCCTGCTGAACGCCATCCTGTACGCCCACATCCAGTGTCTGAATGCCGCC CTGTACAACCTGCTGATCCGGTGCTTTAAGGCCGCCTTCGTGTACATCCCCCTGTTT CTGATCAACACCGTGAGCGCCACCCAGCTGGTGAAGAATGGCACCGGCTGCAACGGC TGGTTCTACAATGCCGCCACCAAGTACCCCCTGCTGAAGAACGTGTATGTGTTTTGT TTTCTGCTGCCCATGAACGCCACACTGCACGACATTATCCTGGAATGCGTCAAGGCC GCTGCCCTGTATGGCGTGAGCTTCAGCGAGCTGAAGCAGGTGGACTACTACGGCCTG TACTACGGCGCCTACTACATGACCGACGCCGGCACCTGGAATGCCGCCCCTTACGCC GTGTGCGACAAGTGCTTCAAGCAGGGCGCCATGCTGGCCGTGTTCAAGAAAGCCGCT GCCGTGGTGCTGCTGCTGGTGCGGTATAAGAATGCCGCCGCCAGCTACTTCGGCATG AGCTTCATCCACTTTAAAGCCGCCAAGCTGCTGTCTAAGCTGCTGTGCGTGAATGCC GCTGCTGCCACAATGTGCCGGCACTACAAGAGAAATGCCGCTGCCAGCACCGTGAGC GTGGGCACCGCCAAGAACGCCGCCCTGAGCCAGATGGTGCAGTGGGCCTACAAGCTG ACCAACACCGGCCTGTACAACGTGAACGCCGCTGCCACCTGCGTGAGCCACCGGGGC CTGTATAACGCCGCCAAGAGCGCCATCGTGACCCTGACCTATAAGGCCGCTGCCGAC AGCGTGTACGGCGACACCCTGGAACGGAACATGTACGTGTGCTGCCACGTGCCCCTG AATGCCGCCAGGTTCCACAACATCCGGGGCAGGTTCAAAGCCGCCTTTGTGGTGTAC

13 Patent Application Publication Oct. 28, 2010 Sheet 12 of 17 US 2010/ Al CGGGACAGCATCCCCAAGAATGCCAGCCTCCAGGATATTGAGATCACCTGTGTGAAG GCCGTGTACGACTTCGCCTTCCGGGACCTGTGCATCAAGTACATGCTGGACCTCCAG CCCGAGACAGTGAACGCCGCCGCTGGCACACTGGGCATCGTGTGCCCCGTGAACAGC GTGATCTGCTTCGTGAACAGCAAAAACGCCACCCTGGAAAAGCTGACAAATACAGGG CTGTACAATGCCGGCCTGTATTACGTGCACGAGGGCATCCGGACCTACTTCGTGCAG GGCCCAGGGCCAGGCTTCCTGAACACCGTGGCCATCCCCGACTCCGTGCAGATCCTG GTCGGCCCAGGACCAGGGCAGCGGTTCCACAATATCAGAGGCCGGTGGACCGGCAGA TGCATGGGCCCAGGACCTGGCACAAATACCGGACTGTATAATCTGCTGATTCGCTGC CTGCGGTGCCAGGGTCCAGGACCAGGCATCGAGTTTATCACCTTTCTGGGCGCCCTG AAGAGCTTCCTGAAAGGACCTGGACCAGGACCCGAGTGGATTCAGCGGCAGACCGTG CTCCAGCACAGCTTCAACGGACCCGGACCCGGCCTGTTCGTGGTGTACAGAGACTCC ATCCCCCACGCCGCCTGTCACAAGGGACCTGGACCAGGCATCAGGACCCTGGAGGAC CTGCTGATGGGCACCCTGGGCATTGTGGGGCCTGGACCTGGACTGGATCTCCAGCCT GAAACCACCGACCTGTACTGCTACGAGCAGGGGCCAGGACCTGGGCTCCAGGCTATC GAACTCCAGCTGACCCTGGAAACCATCTACAATGGCCCCGGACCAGGCTTCCAGCAG CTGTTCCTGAATACCCTGAGCTTCGTGTGCCCTTGGGGACCAGGGCCCGGATGGAAG CACATGCGGCTGGAATGCGCCATCTACTACAAGGCCAGAGGCCCAGGACCCGGACTG TGCACCGAACTCCAGACCACCATCCACGACATCATTCTGGAAGGACCAGGGCCAGGC TTTAAGACCCTGATCCAGCCCTTCATTCTGTATGCCCACATTCAGGGACCTGGGCCT GGCCTGTATTGGTATAAGACCGGCATCAGCAACATCTCCGAGGTGTACGGGCCTGGA CCAGGCGAGGTGTTCGAGTTCGCCTTCAAGGATCTGTTTGTGGTGTATAGAGGCCCC GGACCTGGCCACAAGGCCATTGAACTCCAGATGGCCCTCCAGGGGCTGGCCCAGGGA CCAGGCCCTGGCGCCAAGTTCGTGGCCGCCTGGACCCTGAAAGCCGCCGCCTGA (SEQ ID NO 128) C. KSLFGMSLMKNSTAAALYWYKKAACYSLYGTTFKAAAVAWDSVYYMKSTDLRDHIDY NISDYRHYCYKAAQVVPAYNISKNGYNTFYIEFKLQDKIIDHYKAACLYLHIQSLNA AAATLQDIVLHGTVYVFCFLLNAILYAHIQCLNAALYNLLIRCFKAAFVYIPLFLIN TVSATQLVKNGTGCNGWFYNAATKYPLLKNVYVFCFLLPMNATLHDIILECVKAAAL YGVSFSELKQVDYYG LYYGAYYMTDAGTWNAAPYAVCDKCFKQGAM LAVFKKAAAVV LLLVRYKNAAASYFGMSFIHFKAAKLLSKLLCVNAAAATMCRHYKRNAAASTVSVGT AKNAALSQMVQWAYKLTNTGLYNVNAAATCVSHRGLYNAAKSAIVTLTYKAAADSVY GDTLERNMYVCCHVPLNAARFHNIRGRFKAAFVVYRDSIPKNASLQDIEITCVKAVY DFAFRDLCIKYMLDLQPETVNAAAGTLGIVCPVNSVICFVNSKNATLEKLTNTGLYN AGLYYVHEGIRTYFVQGPGPGFLNTVAIPDSVQILVGPGPGQRFHNIRGRWTGRCMG PGPGTNTGLYNLLIRCLRCQGPGPGIEFITFLGALKSFLKGPGPGPEWIQRQTVLQH SFNGPGPGLFVVYRDSIPHAACHKGPGPGIRTLEDLLMGTLGIVGPGPGLDLQPETT DLYCYEQGPGPGLQAIELQLTLETIYNGPGPGFQQLFLNTLSFVCPWGPGPGWKHMR LECAIYYKARGPGPGLCTELQTTIHDIILEGPGPGFKTLIQPFILYAHIQGPGPGLY WYKTGISNISEVYGPGPGEVFEFAFKDLFVVYRGPGPGHKAIELQMALQGLAQGPGP GAKFVAAWTLKAAA (SEQ ID NO 160) FIGURE 7 cont.1

14 Patent Application Publication Oct. 28, 2010 Sheet 13 of 17 US 2010/ Al D. AAGAGCCTGTTTGGCATGAGCCTGATGAAGAACAGCACCGCCGCTGCCCTCTATTGG TACAAAAAGGCCGCCTGCTACAGCCTGTACGGCACCACCTTCAAGGCTGCTGCCGTG GCCTGGGACAGCGTGTACTACATGAAGAGCACCGACCTGCGGGACCACATCGACTAC AACATCAGCGACTACCGGCACTACTGCTACAAGGCCGCCCAGGTGGTGCCCGCCTAC AACATCTCCAAGAACGGCTACAACACCTTCTACATCGAGTTCAAGCTCCAGGACAAG ATCATCGACCACTACAAAGCCGCCTGCCTGTACCTGCACATCCAGAGTCTGAACGCA GCCGCTGCAACCCTCCAGGACATCGTGCTGCACGGCACCGTGTACGTGTTCTGCTTC CTGCTGAACGCCATCCTGTACGCCCACATCCAGTGTCTGAATGCCGCCCTGTACAAC CTGCTGATCCGGTGCTTTAAGGCCGCCTTCGTGTACATCCCCCTGTTTCTGATCAAC ACCGTGAGCGCCACCCAGCTGGTGAAGAATGGCACCGGCTGCAACGGCTGGTTCTAC AATGCCGCCACCAAGTACCCCCTGCTGAAGAACGTGTATGTGTTTTGTTTTCTGCTG CCCATGAACGCCACACTGCACGACATTATCCTGGAATGCGTCAAGGCCGCTGCCCTG TATGGCGTGAGCTTCAGCGAGCTGAAGCAGGTGGACTACTACGGCCTGTACTACGGC GCCTACTACATGACCGACGCCGGCACCTGGAATGCCGCCCCTTACGCCGTGTGCGAC AAGTGCTTCAAGCAGGGCGCCATGCTGGCCGTGTTCAAGAAAGCCGCTGCCGTGGTG CTGCTGCTGGTGCGGTATAAGAATGCCGCCGCCAGCTACTTCGGCATGAGCTTCATC CACTTTAAAGCCGCCAAGCTGCTGTCTAAGCTGCTGTGCGTGAATGCCGCTGCTGCC ACAATGTGCCGGCACTACAAGAGAAATGCCGCTGCCAGCACCGTGAGCGTGGGCACC GCCAAGAACGCCGCCCTGAGCCAGATGGTGCAGTGGGCCTACAAGCTGACCAACACC GGCCTGTACAACGTGAACGCCGCTGCCACCTGCGTGAGCCACCGGGGCCTGTATAAC GCCGCCAAGAGCGCCATCGTGACCCTGACCTATAAGGCCGCTGCCGACAGCGTGTAC GGCGACACCCTGGAACGGAACATGTACGTGTGCTGCCACGTGCCCCTGAATGCCGCC AGGTTCCACAACATCCGGGGCAGGTTCAAAGCCGCCTTTGTGGTGTACCGGGACAGC ATCCCCAAGAATGCCAGCCTCCAGGATATTGAGATCACCTGTGTGAAGGCCGTGTAC GACTTCGCCTTCCGGGACCTGTGCATCAAGTACATGCTGGACCTCCAGCCCGAGACA GTGAACGCCGCCGCTGGCACACTGGGCATCGTGTGCCCCGTGAACAGCGTGATCTGC TTCGTGAACAGCAAAAACGCCACCCTGGAAAAGCTGACAAATACAGGGCTGTACAAT GCCGGCCTGTATTACGTGCACGAGGGCATCCGGACCTACTTCGTGCAGGGCCCAGGG CCAGGCTTCCTGAACACCGTGGCCATCCCCGACTCCGTGCAGATCCTGGTCGGCCCA GGACCAGGGCAGCGGTTCCACAATATCAGAGGCCGGTGGACCGGCAGATGCATGGGC CCAGGACCTGGCACAAATACCGGACTGTATAATCTGCTGATTCGCTGCCTGCGGTGC CAGGGTCCAGGACCAGGCATCGAGTTTATCACCTTTCTGGGCGCCCTGAAGAGCTTC CTGAAAGGACCTGGACCAGGACCCGAGTGGATTCAGCGGCAGACCGTGCTCCAGCAC AGCTTCAACGGACCCGGACCCGGCCTGTTCGTGGTGTACAGAGACTCCATCCCCCAC GCCGCCTGTCACAAGGGACCTGGACCAGGCATCAGGACCCTGGAGGACCTGCTGATG GGCACCCTGGGCATTGTGGGGCCTGGACCTGGACTGGATCTCCAGCCTGAAACCACC GACCTGTACTGCTACGAGCAGGGGCCAGGACCTGGGCTCCAGGCTATCGAACTCCAG CTGACCCTGGAAACCATCTACAATGGCCCCGGACCAGGCTTCCAGCAGCTGTTCCTG AATACCCTGAGCTTCGTGTGCCCTTGGGGACCAGGGCCCGGATGGAAGCACATGCGG CTGGAATGCGCCATCTACTACAAGGCCAGAGGCCCAGGACCCGGACTGTGCACCGAA CTCCAGACCACCATCCACGACATCATTCTGGAAGGACCAGGGCCAGGCTTTAAGACC CTGATCCAGCCCTTCATTCTGTATGCCCACATTCAGGGACCTGGGCCTGGCCTGTAT TGGTATAAGACCGGCATCAGCAACATCTCCGAGGTGTACGGGCCTGGACCAGGCGAG GTGTTCGAGTTCGCCTTCAAGGATCTGTTTGTGGTGTATAGAGGCCCCGGACCTGGC CACAAGGCCATTGAACTCCAGATGGCCCTCCAGGGGCTGGCCCAGGGACCAGGCCCT GGCGCCAAGTTCGTGGCCGCCTGGACCCTGAAAGCCGCCGCC (SEQ ID NO 161) FIGURE 7 cont.2

15 Patent Application Publication Oct. 28, 2010 Sheet 14 of 17 US 2010/ Al FIGURE 8 A. ICCG6150 Amino acid sequence MGMQVQIQSLFLLLLWVPGSRGATCVSHRGLYNAASTDLRDHIDYNAAAATMCRHYK RNAILYAHIQCLNAAAGTLGIVCPVNAAACYSLYGTTFKAAADSVYGDTLERNQVVP AYNISKNAALYNLLIRCFKAAFVYIPLFLINYYMTDAGTWGAVVLLLVRYKNAAISD YRHYCYKAATVSATQLVKKASTAAALYWYKKAAFVVYRDSIPKNASYFGMSFIHFKA AYMLDLQPETVNAAVYDFAFRDLCIKAALQDKIIDHYKAATLHDIILECVKKLTNTG LYNVGAAASVICFVNSKGAAAMYVCCHVPLNASLQDIEITCVKCLYLHIQSLNAATK YPLLKNVYVFCFLLPMNAKQGAMLAVFKKAALSQMVQWAYKAAPYAVCDKCFKAATV YVFCFLLNAAAATLQDIVLHGAKSLFGMSLMKNGTGCNGWFYNARFHNIRGRFKAAK LLSKLLCVNAAASTVSVGTAKNVAWDSVYYMKAAAGYNTFYIEFKAAALYGVSFSEL KQVDYYGLYYNAAKSAIVTLTYKAAATLEKLTNTGLYNAGLYYVHEGIRTYFVQGPG PGFLNTVAIPDSVQILVGPGPGQRFHNIRGRWTGRCMGPGPGTNTGLYNLLIRCLRC QGPGPGIEFITFLGALKSFLKGPGPGPEWIQRQTVLQHSFNGPGPGLFVVYRDSIPH AACHKGPGPGIRTLEDLLMGTLGIVGPGPGLDLQPETTDLYCYEQGPGPGLQAIELQ LTLETIYNGPGPGFQQLFLNTLSFVCPWGPGPGWKHMRLECAIYYKARGPGPGLCTE LQTTIHDIILEGPGPGFKTLIQPFILYAHIQGPGPGLYWYKTGISNISEVYGPGPGE VFEFAFKDLFVVYRGPGPGHKAIELQMALQGLAQGPGPGAKFVAAWTLKAAA (SEQ ID NO 129) B. ICCG6150 DNA sequence ATGGGCATGCAGGTGCAGATCCAGAGCCTGTTCCTGCTGCTGCTGTGGGTGCCCGGC AGCAGAGGCGCCACCTGCGTGAGCCACAGGGGCCTCTACAACGCCGCCAGCACCGAC CTGCGGGACCACATCGACTACAATGCTGCTGCCGCTACAATGTGCCGGCACTACAAG CGGAACGCCATCCTGTACGCCCACATCCAGTGCCTGAATGCTGCCGCTGGCACACTG GGCATCGTGTGCCCCGTGAATGCCGCCGCCTGCTACAGCCTGTACGGCACCACCTTC AAGGCCGCTGCCGACTCCGTGTACGGCGACACCCTGGAACGGAACCAGGTGGTGCCC GCCTACAACATCTCTAAGAATGCCGCTCTGTACAACCTGCTGATCCGGTGCTTTAAG GCTGCCTTCGTGTACATCCCCCTGTTTCTGATCAACTACTACATGACCGACGCCGGC ACATGGGGAGCCGTGGTGCTGCTGCTGGTGCGGTACAAGAATGCCGCCATCAGCGAC TACCGGCACTACTGCTACAAGGCCGCCACCGTCAGCGCCACCCAGCTGGTGAAGAAG GCCAGCACAGCCGCCGCTCTCTATTGGTATAAAAAAGCCGCCTTTGTGGTGTACCGG GACAGCATCCCCAAGAACGCCAGCTACTTCGGCATGAGCTTCATCCACTTCAAAGCC GCCTACATGCTGGACCTCCAGCCCGAGACCGTGAACGCTGCCGTGTACGACTTCGCC TTCCGGGACCTGTGCATTAAAGCCGCACTCCAGGACAAGATCATCGACCATTATAAA GCAGCCACCCTGCATGATATTATTCTGGAATGCGTGAAGAAGCTGACCAACACCGGC CTCTATAACGTGGGAGCCGCCGCCTCTGTGATCTGCTTCGTGAACAGCAAGGGGGCT GCCGCCATGTATGTGTGCTGCCACGTGCCCCTGAACGCCTCTCTCCAGGATATTGAG ATCACCTGTGTGAAGTGCCTGTACCTGCACATTCAGTCTCTGAATGCCGCCACCAAG TACCCCCTGCTGAAGAACGTGTATGTCTTTTGCTTCCTGCTGCCCATGAACGCCAAG CAGGGCGCCATGCTGGCCGTGTTCAAAAAGGCCGCCCTGAGCCAGATGGTGCAGTGG GCCTACAAAGCCGCCCCTTACGCCGTGTGCGACAAGTGTTTTAAGGCCGCCACAGTG TACGTGTTTTGTTTTCTGCTGAATGCCGCTGCCGCCACCCTCCAGGACATCGTGCTG CACGGCGCCAAGTCCCTGTTCGGCATGTCCCTGATGAAGAATGGCACCGGCTGCAAC GGCTGGTTCTACAACGCCCGGTTCCACAACATCCGGGGCAGGTTTAAAGCCGCCAAG

16 Patent Application Publication Oct. 28, 2010 Sheet 15 of 17 US 2010/ Al CTGCTGTCTAAGCTGCTGTGTGTGAACGCCGCCGCTTCCACCGTGAGCGTGGGCACC GCCAAGAACGTGGCCTGGGACAGCGTGTACTACATGAAAGCAGCAGCCGGGTACAAC ACCTTCTACATCGAGTTTAAAGCTGCCGCCCTGTACGGCGTGAGCTTCAGCGAGCTG AAGCAGGTGGACTACTACGGCCTGTACTATAACGCCGCCAAGAGCGCCATCGTGACC CTGACCTATAAAGCCGCCGCCACACTGGAAAAGCTGACCAATACAGGGCTGTACAAT GCCGGCCTGTATTACGTGCACGAGGGCATCCGGACCTACTTCGTGCAGGGCCCAGGG CCAGGCTTCCTGAACACCGTGGCCATCCCCGACTCCGTGCAGATCCTGGTCGGCCCA GGACCAGGGCAGCGGTTCCACAATATCAGAGGCCGGTGGACCGGCAGATGCATGGGC CCAGGACCTGGCACAAATACCGGACTGTATAATCTGCTGATTCGCTGCCTGCGGTGC CAGGGTCCAGGACCAGGCATCGAGTTTATCACCTTTCTGGGCGCCCTGAAGAGCTTC CTGAAAGGACCTGGACCAGGACCCGAGTGGATTCAGCGGCAGACCGTGCTCCAGCAC AGCTTCAACGGACCCGGACCCGGCCTGTTCGTGGTGTACAGAGACTCCATCCCCCAC GCCGCCTGTCACAAGGGACCTGGACCAGGCATCAGGACCCTGGAGGACCTGCTGATG GGCACCCTGGGCATTGTGGGGCCTGGACCTGGACTGGATCTCCAGCCTGAAACCACC GACCTGTACTGCTACGAGCAGGGGCCAGGACCTGGGCTCCAGGCTATCGAACTCCAG CTGACCCTGGAAACCATCTACAATGGCCCCGGACCAGGCTTCCAGCAGCTGTTCCTG AATACCCTGAGCTTCGTGTGCCCTTGGGGACCAGGGCCCGGATGGAAGCACATGCGG CTGGAATGCGCCATCTACTACAAGGCCAGAGGCCCAGGACCCGGACTGTGCACCGAA CTCCAGACCACCATCCACGACATCATTCTGGAAGGACCAGGGCCAGGCTTTAAGACC CTGATCCAGCCCTTCATTCTGTATGCCCACATTCAGGGACCTGGGCCTGGCCTGTAT TGGTATAAGACCGGCATCAGCAACATCTCCGAGGTGTACGGGCCTGGACCAGGCGAG GTGTTCGAGTTCGCCTTCAAGGATCTGTTTGTGGTGTATAGAGGCCCCGGACCTGGC CACAAGGCCATTGAACTCCAGATGGCCCTCCAGGGGCTGGCCCAGGGACCAGGCCCT GGCGCCAAGTTCGTGGCCGCCTGGACCCTGAAAGCCGCCGCCTGA (SEQ ID NO 130) C. ATCVSHRGLYNAASTDLRDHIDYNAAAATMCRHYKRNAILYAHIQCLNAAAGTLGIV CPVNAAACYSLYGTTFKAAADSVYGDTLERNQVVPAYNISKNAALYNLLIRCFKAAF VYIPLFLINYYMTDAGTWGAVVLLLVRYKNAAISDYRHYCYKAATVSATQLVKKAST AAALYWYKKAAFVVYRDSIPKNASYFGMSFIHFKAAYMLDLQPETVNAAVYDFAFRD LCIKAALQDKIIDHYKAATLHDIILECVKKLTNTGLYNVGAAASVICFVNSKGAAAM YVCCHVPLNASLQDIEITCVKCLYLHIQSLNAATKYPLLKNVYVFCFLLPMNAKQGA MLAVFKKAALSQMVQWAYKAAPYAVCDKCFKAATVYVFCFLLNAAAATLQDIVLHGA KSLFGMSLMKNGTGCNGWFYNARFHNIRGRFKAAKLLSKLLCVNAAASTVSVGTAKN VAWDSVYYMKAAAGYNTFYIEFKAAALYGVSFSELKQVDYYGLYYNAAKSAIVTLTY KAAATLEKLTNTGLYNAGLYYVHEGIRTYFVQGPGPGFLNTVAIPDSVQILVGPGPG QRFHNIRGRWTGRCMGPGPGTNTGLYNLLIRCLRCQGPGPGIEFITFLGALKSFLKG PGPGPEWIQRQTVLQHSFNGPGPGLFVVYRDSIPHAACHKGPGPGIRTLEDLLMGTL GIVGPGPGLDLQPETTDLYCYEQGPGPGLQAIELQLTLETIYNGPGPGFQQLFLNTL SFVCPWGPGPGWKHMRLECAIYYKARGPGPGLCTELQTTIHDIILEGPGPGFKTLIQ PFILYAHIQGPGPGLYWYKTGISNISEVYGPGPGEVFEFAFKDLFVVYRGPGPGHKA IELQMALQGLAQGPGPGAKFVAAWTLKAAA (SEQ ID NO 162) FIGURE 8 cont.1

17 Patent Application Publication Oct. 28, 2010 Sheet 16 of 17 US 2010/ Al IM GCCACCTGCGTGAGCCACAGGGGCCTCTACAACGCCGCCAGCACCGACCTGCGGGAC CACATCGACTACAATGCTGCTGCCGCTACAATGTGCCGGCACTACAAGCGGAACGCC ATCCTGTACGCCCACATCCAGTGCCTGAATGCTGCCGCTGGCACACTGGGCATCGTG TGCCCCGTGAATGCCGCCGCCTGCTACAGCCTGTACGGCACCACCTTCAAGGCCGCT GCCGACTCCGTGTACGGCGACACCCTGGAACGGAACCAGGTGGTGCCCGCCTACAAC ATCTCTAAGAATGCCGCTCTGTACAACCTGCTGATCCGGTGCTTTAAGGCTGCCTTC GTGTACATCCCCCTGTTTCTGATCAACTACTACATGACCGACGCCGGCACATGGGGA GCCGTGGTGCTGCTGCTGGTGCGGTACAAGAATGCCGCCATCAGCGACTACCGGCAC TACTGCTACAAGGCCGCCACCGTCAGCGCCACCCAGCTGGTGAAGAAGGCCAGCACA GCCGCCGCTCTCTATTGGTATAAAAAAGCCGCCTTTGTGGTGTACCGGGACAGCATC CCCAAGAACGCCAGCTACTTCGGCATGAGCTTCATCCACTTCAAAGCCGCCTACATG CTGGACCTCCAGCCCGAGACCGTGAACGCTGCCGTGTACGACTTCGCCTTCCGGGAC CTGTGCATTAAAGCCGCACTCCAGGACAAGATCATCGACCATTATAAAGCAGCCACC CTGCATGATATTATTCTGGAATGCGTGAAGAAGCTGACCAACACCGGCCTCTATAAC GTGGGAGCCGCCGCCTCTGTGATCTGCTTCGTGAACAGCAAGGGGGCTGCCGCCATG TATGTGTGCTGCCACGTGCCCCTGAACGCCTCTCTCCAGGATATTGAGATCACCTGT GTGAAGTGCCTGTACCTGCACATTCAGTCTCTGAATGCCGCCACCAAGTACCCCCTG CTGAAGAACGTGTATGTCTTTTGCTTCCTGCTGCCCATGAACGCCAAGCAGGGCGCC ATGCTGGCCGTGTTCAAAAAGGCCGCCCTGAGCCAGATGGTGCAGTGGGCCTACAAA GCCGCCCCTTACGCCGTGTGCGACAAGTGTTTTAAGGCCGCCACAGTGTACGTGTTT TGTTTTCTGCTGAATGCCGCTGCCGCCACCCTCCAGGACATCGTGCTGCACGGCGCC AAGTCCCTGTTCGGCATGTCCCTGATGAAGAATGGCACCGGCTGCAACGGCTGGTTC TACAACGCCCGGTTCCACAACATCCGGGGCAGGTTTAAAGCCGCCAAGCTGCTGTCT AAGCTGCTGTGTGTGAACGCCGCCGCTTCCACCGTGAGCGTGGGCACCGCCAAGAAC GTGGCCTGGGACAGCGTGTACTACATGAAAGCAGCAGCCGGGTACAACACCTTCTAC ATCGAGTTTAAAGCTGCCGCCCTGTACGGCGTGAGCTTCAGCGAGCTGAAGCAGGTG GACTACTACGGCCTGTACTATAACGCCGCCAAGAGCGCCATCGTGACCCTGACCTAT AAAGCCGCCGCCACACTGGAAAAGCTGACCAATACAGGGCTGTACAATGCCGGCCTG TATTACGTGCACGAGGGCATCCGGACCTACTTCGTGCAGGGCCCAGGGCCAGGCTTC CTGAACACCGTGGCCATCCCCGACTCCGTGCAGATCCTGGTCGGCCCAGGACCAGGG CAGCGGTTCCACAATATCAGAGGCCGGTGGACCGGCAGATGCATGGGCCCAGGACCT GGCACAAATACCGGACTGTATAATCTGCTGATTCGCTGCCTGCGGTGCCAGGGTCCA GGACCAGGCATCGAGTTTATCACCTTTCTGGGCGCCCTGAAGAGCTTCCTGAAAGGA CCTGGACCAGGACCCGAGTGGATTCAGCGGCAGACCGTGCTCCAGCACAGCTTCAAC GGACCCGGACCCGGCCTGTTCGTGGTGTACAGAGACTCCATCCCCCACGCCGCCTGT CACAAGGGACCTGGACCAGGCATCAGGACCCTGGAGGACCTGCTGATGGGCACCCTG GGCATTGTGGGGCCTGGACCTGGACTGGATCTCCAGCCTGAAACCACCGACCTGTAC TGCTACGAGCAGGGGCCAGGACCTGGGCTCCAGGCTATCGAACTCCAGCTGACCCTG GAAACCATCTACAATGGCCCCGGACCAGGCTTCCAGCAGCTGTTCCTGAATACCCTG AGCTTCGTGTGCCCTTGGGGACCAGGGCCCGGATGGAAGCACATGCGGCTGGAATGC GCCATCTACTACAAGGCCAGAGGCCCAGGACCCGGACTGTGCACCGAACTCCAGACC ACCATCCACGACATCATTCTGGAAGGACCAGGGCCAGGCTTTAAGACCCTGATCCAG CCCTTCATTCTGTATGCCCACATTCAGGGACCTGGGCCTGGCCTGTATTGGTATAAG ACCGGCATCAGCAACATCTCCGAGGTGTACGGGCCTGGACCAGGCGAGGTGTTCGAG TTCGCCTTCAAGGATCTGTTTGTGGTGTATAGAGGCCCCGGACCTGGCCACAAGGCC ATTGAACTCCAGATGGCCCTCCAGGGGCTGGCCCAGGGACCAGGCCCTGGCGCCAAG TTCGTGGCCGCCTGGACCCTGAAAGCCGCCGCC (SEQ ID NO 163) FIGURE 8 cont.2

18 Patent Application Publication Oct. 28, 2010 Sheet 17 of 17 US 2010/ Al FIGURE 9

19 HPV POLYEPITOPE CONSTRUCTS AND USES THEREOF FIELD OF THE INVENTION [0001] The present invention is directed to Human Papillomavirus (HPV) polyepitope constructs and the use thereof for the prevention and/or treatment of HPV infection. BACKGROUND OF THE INVENTION [0002] Cancer of the cervix uteri is the second most common cancer among women worldwide, with an estimated 493,000 new cases and 274,000 deaths in The field of cervical cancer prevention is rapidly evolving as a consequence of the identification of the cause of the disease: a limited number of viral types from the family of the Human Papillomaviruses (HPV). Indeed, HPV has been recognized as a cause of cervical cancer, and 2 of the oncogenic types, 16 and 18, are together responsible for 70% of the world's cervical cancer cases. [0003] Recently the use of 2 prophylactic vaccines was licensed. Nevertheless, it is likely to be decades before the impact of HPV vaccination on the incidence of cervical cancer can be evaluated. Optimally, these vaccines should be administered before sexual debut and HPV infection. As such, they are of no benefit for women with already existing HPV infection. Treatment (surgery) for HPV infection is often unsatisfactory because of persistence of virus after treatment and recurrence of clinically apparent disease is common. The treatment may require frequent visits to clinics and is not directed at elimination of the virus but at clearing warts. Moreover, it is expected that less prevalent, oncogenic HPV genotypes will take over at least in part the place from the currently targeted HPV 16 and 18 genotypes. Women with pre-carcinogenic lesions resulting from the widespread HPV infections today represent a highly unmet need. [0004] Thus, a need exists for an efficacious vaccine to prevent and/or treat persistent HPV infection and to prevent cancer that is associated with HPV infection. Effective HPV vaccines would be a significant advance in the control of sexually transmissible infections and could also protect against clinical disease, particularly cancers such as cervical cancer. (see, e.g., Rowen, P. and Lacey, C., Dermatologic Clinics 16 (4): ,1998). [0005] In the majority of individuals, HPV infections presumably induce strong, local, cell-mediated immunity that results in clearance of the virus and protection against subsequent infection. Virus-specific, human leukocyte antigen (HLA) class I-restricted cytotoxic T lymphocytes (CTL) and HLA class II-restricted helper T lymphocytes (HTL) are known to play a major role in the prevention of chronic infection and in viral clearance in vivo (Houssaint et al., 2001; Graters et al., 2002; Tsai et al., 1997; Murray et al., 1992; Tigges et al., 1992; Bowen and Walker, 2005). [0006] A therapeutic vaccine candidate targeting HPV should elicit strong and multi-specific cellular immune responses. The induction of a strong HPV-specific cellular response-comprising activity of cytotoxic T-cells (CTL) and helper T-cells (HTL) may be achieved using an epitopebased vaccine approach. [0007] The polyepitope approach to vaccine development is to rationally create a multi-specific cellular response, causing the immune system to be specifically stimulated against multiple selected epitopes that meet stringent criteria. These include CTL epitopes that are presented by MHC-I and are recognized by cytotoxic T-cells, and HTL epitopes that bind MHC II and are recognized by helper T-cells. The epitopes are selected in view of their capacity to elicit responses in humans, thereby aiming for a large population coverage (by targeting major HLA class-i alleles as well as major HLA class-ii alleles). [0008] The technology relevant to polyepitope vaccines is developing and a number of different approaches are available which allow simultaneous delivery of multiple epitopes. Several independent studies have established that induction of simultaneous immune responses against multiple and individual peptides can be achieved (Doolan et al (1997), Bertoni and colleagues (1997)). In terms of immunization with polyepitope nucleic acid vaccines, several examples have been reported where multiple T cell responses were induced (Thomson et al., 1995; Woodberry et al., 1999; Mateo et al., 1999; Ishioka et al., 1999; W004/031210, Innogenetics N. V. et al.). [0009] The efforts to develop an effective treatment for HPV-related disease are narrowly focused. Most studies are concentrating on the HPV type 16 E6 and/or E7 protein. Also W005/ (Pharmexa et al.) discloses HPV polyepitope constructs focussing on E6 and E7, and additionally El and E2 proteins. During the papillomavirus life cycle, the HPV proteins (El, E2, E4, E5, E6, E7, Ll and L2) are differentially expressed. Moreover, during progression from CIN1 to CIN3, the extent of expression of the different HPV proteins is changing (Doorbar, 2005). Targeting all 6 early proteins (El, E2, E4, E5, E6 and E7) thus provides a way to induce efficient immune responses directed to all stages of the virus life cycle, irrespective of the CIN grade. [0010] Although E4 and E5 were screened for immunogenic epitopes, WO05/ was unsuccessful in obtaining reactive peptides. It is indeed known that most of the HPV proteins are comparatively small and might therefore not comprise many reactive epitopes. The present inventors however have now determined several immunogenic epitopes in the E4 and E5 proteins of the high risk HPV genotypes HPV16, 18, 31 and 45. Moreover, the present inventors were successful in creating a potent, multi-specific and full-spectrum vaccine addressing the different stages of HPV infection, and thereby broadening the treatment window. Where others, focusing on E6 and/or E7 are mainly targeting CIN2 and CIN3, this vaccine allows to treat earlier stages of disease as well as persistent infection, thereby further reducing the chance of developing cervical cancer. [0011] The polyepitope constructs are designed to induce an immune response to at least 4 distinct CTL and 1-3 HTL epitopes per HPV genotype in the majority of subjects infected with one of the four most prevalent, high risk HPV genotypes (HPV16, 18, 31 and 45) irrespective of their ethnic origin. SUMMARY OF THE INVENTION [0012] The present invention encompasses epitopes derived from the El, E2, E4, E5, E6 and/or E7 protein of the Human Papillomavirus (HPV). Each of the epitopes given in Tables 1 and 2, or any combination of two, more or all of these epitopes, are part of the invention, as well as their application in the treatment and/or prevention of HPV infection or HPVrelated disease. The epitopes are those which elicit a HLA class I- and/or class II-restricted T lymphocyte response in an immunized host.

20 2 [0013] In a particular embodiment, the present invention relates to an isolated CTL inducing peptide derived from a Human Papillomavirus protein, consisting of 8 to 13 amino acids and comprising the sequence represented by SEQ ID NO More specific, the invention encompasses an isolated CTL inducing peptide derived from the Human Papillomavirus protein E4 or E5, consisting of 8 to 13 amino acids and comprising the sequence represented by SEQ ID NO 8, 17, 29, 42, 43, 51, 64, 74, 75, 81 and 86. [0014] The invention also covers an isolated polyepitope construct comprising one or more of the herein described CTL inducing peptides. [0015] The present invention is furthermore directed to a polynucleotide, a polypeptide, a vector or a composition comprising a polyepitope construct encoding or comprising specifically selected epitopes derived of HPV. [0016] In one embodiment, the polyepitope construct encodes or comprises at least the following HPV derived CTL epitopes: SEQ ID NO 1 to 44, and/or the polyepitope construct encodes or comprises at least the following HPV CTL epitopes: SEQ ID NO 1, 23, 39 and 45 to 88. In another embodiment, the current invention relates to a polynucleotide comprising a polyepitope construct comprising nucleic acids encoding all the epitopes given in Table 1 (SEQ ID NO 1-88). Specifically, the construct does not encode a full-length protein from HPV. [0017] In a further embodiment, the polyepitope construct of the invention further encodes or comprises at least one CTL and/or HTL epitope. Preferably, the epitopes are isolated. In a specific embodiment, the at least one CTL and/or HTL epitope is derived from HPV. More specific, the at least one HTL epitope is selected from the group consisting of SEQ ID NO 89 to 121. Preferably, the polyepitope construct furthermore comprises a PADRE epitope. Specifically, the PADRE epitope is characterized by SEQ ID NO 122. [0018] Optionally, the epitopes inthe polyepitope construct are linked to each other by one or more, preferably 1 to 8, spacer amino acids. Ina specific embodiment, the one or more spacer amino acids are selected from the group consisting of: K, R, N, Q, G, A, S, C, G, P, and T. More specifically, the spacer between one or more CTL epitopes is selected from the group consisting of G, K, A or N, and the spacer between one or more HTL epitopes is selected from the group consisting of G, N and P. [0019] In a further embodiment, the CTL and/or HTL epitopes comprised in the polyepitope construct are sorted to minimize the number of CTL and/or HTL junctional epitopes. [0020] Specifically, the HPV CTL epitopes are directly or indirectly linked in the order as shown in FIG. 1A, 2A, 3 or 4. The HPV HTL epitopes can be directly or indirectly linked in the order as shown in FIG. 1B or 2B. [0021] Optionally, the polynucleotide of the present invention further comprises one or more regulatory sequences. Preferably, said regulatory sequence is an internal ribosome binding site (IRES). [0022] In a specific embodiment, the polynucleotide of the present invention further comprises one or more promoters. Preferably, the promoter is a CMV promoter. [0023] In a further embodiment, the polynucleotide of the present invention further comprises one or more signal sequences. Preferably, the signal sequence is a Igkappa signal sequence. [0024] In another embodiment, the polynucleotide of the invention comprises one or more MHC class I and/or MHC class II-targeting sequences. Preferably, the targeting sequence is selected from the group consisting of tissue plasminogen activator signal sequence, insulin signal sequence, endoplasmic reticulum signal sequence, LAMP-1 lysosomal targeting sequence, LAMP-2 lysosomal targeting sequence, HLA-DM lysosomal targeting sequence, HLA-DM-association sequences of HLA-DO, Ig-alpha cytoplasmic domain, Ig-beta cytoplasmic domain, Ii protein, influenza matrix protein, HBV surface antigen, HBV core antigen, and yeast Ty protein. [0025] Ina specific embodiment, the polynucleotide of the present invention comprises a polyepitope construct encoding the amino acid sequence consisting of, comprised in or comprising the sequence represented by SEQ ID NO 123, SEQ ID NO 125, SEQ ID NO 127 or SEQ ID NO 129. In another embodiment the polyepitope construct is characterized by or comprised in the nucleic acid sequence represented by SEQ ID NO 124, SEQIDNO 126, SEQIDNO 128 or SEQ ID NO 130. [0026] In a further embodiment, the polyepitope construct encodes the amino acid sequence consisting of or comprising the sequence represented by SEQ ID NO 156, SEQ ID NO 158, SEQIDNO 160, or SEQ ID NO 162. In another embodiment, polyepitope construct consists of or comprises the nucleic acid sequence represented by SEQ ID NO 157, SEQ ID NO 159, SEQ ID NO 161, or SEQ ID NO 163. [0027] Furthermore, the invention encompasses a vector comprising the polynucleotide as described herein. Preferably, the vector is an expression vector. More preferably, the vector is a plasmid (pdna), a viral, a bacterial or a yeast vector. Ina further embodiment, the viral vector is a pox virus. Preferably, the pox virus is a vaccinia virus. More preferably, the vaccinia virus is MVA. [0028] Moreover, the current invention also relates to an isolated polypeptide encoded by the polynucleotide as described herein. [0029] The current invention also relates to a composition comprising the polynucleotide, the polypeptide, or the vector as described herein, or any combination thereof. [0030] Preferably, the composition further comprises a pharmaceutical acceptable excipient or carrier. In a specific embodiment, the composition is a vaccine. [0031] In another embodiment, the present invention relates to the composition, the polynucleotide, the vector or the polypeptide as described herein, for use as a medicament. [0032] Specifically, the invention includes the use of the composition, the polynucleotide, the vector or the polypeptide for the manufacture of a medicament for treating and/or preventing persistent HPV infection. The invention also encompasses the composition, the polynucleotide, the vector or the polypeptide for use in the treatment and/or prevention of persistent HPV infection. Specifically, the invention is directed to the treatment and/or prevention of HPV-related disease. [0033] Moreover, the present invention includes a cell comprising the polynucleotide, the polypeptide, or the vector as described herein. [0034] In a further embodiment, the invention relates to a method of inducing an immune response against HPV in an individual, comprising administering the polynucleotide, the polypeptide, the vector, the composition, or the cell as described herein, or a combination thereof, to said individual.

21 Specifically, the method is directed to the treatment and/or prevention of HPV infection and/or HPV-related disease. [0035] Furthermore, the invention covers a method of making the polynucleotide, the polypeptide, the vector, the composition, or the cell as described herein. FIGURE LEGENDS [0036] FIG. 1: A. Specific order of CTL epitopes in construct ICCG6150 [0037] B. Specific order of HTL epitopes in construct ICCG6150 or ICCG6149 [0038] FIG. 2: A. Specific order of CTL epitopes in construct ICCG6138 [0039] B. Specific order of HTL epitopes in construct ICCG6138 or ICCG6137 [0040] FIG. 3: Specific order of CTL epitopes in construct ICCG6137 [0041] FIG. 4: Specific order of CTL epitopes in construct ICCG6149 [0042] FIG. 5: Construct ICCG6137 [0043] A. Amino acid sequence of the signal sequence (in italics) and the polyepitope; [0044] B. DNA sequence: The start and stop codons are underlined. The signal sequence is shown in italics, and the epitope-coding sequence is bolded. [0045] C. Amino acid sequence of the polyepitope; [0046] D. DNA sequence of the polyepitope. [0047] FIG. 6: Construct ICCG6138 [0048] A. Amino acid sequence of the signal sequence (in italics) and the polyepitope; [0049] B. DNA sequence: The start and stop codons are underlined. The signal sequence is shown in italics, and the epitope-coding sequence is bolded. [0050] C. Amino acid sequence of the polyepitope; [0051] D. DNA sequence of the polyepitope. [0052] FIG. 7: Construct ICCG6149 [0053] A. Amino acid sequence of the signal sequence (in italics) and the polyepitope; [0054] B. DNA sequence: The start and stop codons are underlined. The signal sequence is shown in italics, and the epitope-coding sequence is bolded. [0055] C. Amino acid sequence of the polyepitope; [0056] D. DNA sequence of the polyepitope. [0057] FIG. 8: Construct ICCG6150 [0058] A. Amino acid sequence of the signal sequence (in italics) and the polyepitope; [0059] B. DNA sequence: The start and stop codons are underlined. The signal sequence is shown in italics, and the epitope-coding sequence is bolded. [0060] C. Amino acid sequence of the polyepitope; [0061] D. DNA sequence of the polyepitope. DETAILED DESCRIPTION OF THE INVENTION [0062] The present invention is directed to a polynucleotide or polypeptide comprising a polyepitope construct encoding or comprising epitopes derived from the El, E2, E4, E5, E6 and/or E7 protein of the Human Papillomavirus (HPV). The epitopes are those which elicit a HLA class I- and/or class II-restricted T-lymphocyte response in an immunized host. More specifically, the present invention describes highly optimized and effective polyepitope constructs characterized by efficient processing and comprising highly immunogenic epitopes allowing efficient treatment of patients at different stages of HPV-related disease. Identification of the Epitopes [0063] CTL binding epitopes were evaluated for their immunogenicity in different HLA transgenic mice. To this, a single immunization with CTL peptide pools together with a common HTL epitope emulsified in IFA was performed and up to 14 days later, CD8+ spleen cells were isolated and evaluated for epitope specificity using a direct ex vivo IFNy ELISPOT assay. The majority of high affinity binding CTL epitopes proved to be immunogenic. HTL binding epitopes were evaluated for their induction of (ex vivo) recall T cell responses using PBMC from HPV patients. To this, PBMC from subjects were cultured in vitro for 1-2 weeks in the presence of test peptide plus antigen-presenting cells (APC to allow activation of "memory" T cells, as compared to "naive" T cells). At the end of the culture period, T cell activity was detected using assays such as s 1Cr release involving peptideloaded target cells, T cell proliferation, or cytokine release. [0064] The CTL epitopes of the present invention are given in Table 1. Each individual epitope is part of the invention as well as combinations of two, more, or all of said epitopes. In a specific aspect of the invention, epitopes have been identified in the E4 and E5 proteins of the high risk HPV genotypes HPV 16, 18, 31 and 45, whereby said epitopes are being characterized by SEQ ID NO 8, 17, 29, 42, 43, 51, 52, 64, 74, 75, 81 and 86. As such, the present invention also relates to a combination comprising 2,3,4,5,6,7,8,9, 10, 11 or all of the epitopes characterized by SEQ ID NO 8, 17, 29, 42, 43, 51, 52, 64, 74, 75, 81 and 86, optionally linked to each other in a polyepitope construct. [0065] Starting from said pool of CTL epitopes, the present inventors were successful in creating a potent, multi-specific and full-spectrum vaccine addressing the different stages of HPV infection, and broadening the treatment window. [0066] The polyepitope construct ofthe present invention is particularly useful to prevent and/or treat HPV infection, more specific HPV-related disease, and even more specific the precancerous stages of HPV infection, i.e. CIN 1-3. HPVrelated disease includes neoplasia and HPV related cancers such as but not limited to cervical cancer and head and neck carcinoma. The neoplasia to be treated with the methods and medicaments according to the current invention may be any HPV induced neoplasia, preferably in an epithelial tissue, in the ano-genital area and/or ano-genital tract, comprising the vulva, vagina, cervix, penis, scrotum, anus and rectum. The neoplastic disorders to be treated comprise Cervial Intraepithelial Neoplasia of various grades (CIN 1, 2 and 3), Vulvar intraepithelial neoplasias of various grades (VIN 1, 2 and 3) and Vaginal intraepithelial neoplasias (VAIN) and anal intraepithelial neoplasia (AIN). Also male subjects suffering from virally induced neoplasias in the ano-genital area and/or tract, such as but not limited to, Penile intraepithelial neoplasia (PIN) and Anal intraepithelial neoplasia (AIN), may be treated according to this invention. Although most HPV infections do not progress to cervical cancer, infections that persist for many years are more likely to do so. Most cervical cancers develop slowly through a series of abnormal changes in the cells of the cervix. Regular Pap tests can detect these changes and the abnormal tissue can be removed, preventing it from ever developing into cancer. Various terms have been

Supplementary Information

Supplementary Information Name 001 [15] 002 [15] 004 [15] 006 [15] Subject Characteristics N = 140 (Monovalent HPV-11 Vaccine and Placebo) N = 109 (Monovalent HPV-16 Vaccine and Placebo) N = 480 (Monovalent HPV-16 Vaccine and Placebo)

More information

GLOBAL CONCERNS ABOUT HPV VACCINES FACT SHEET

GLOBAL CONCERNS ABOUT HPV VACCINES FACT SHEET GLOBAL CONCERNS ABOUT HPV VACCINES FACT SHEET When detected, HPV infection is easily managed and rarely proceeds to cancer Very few women with HPV develop cervical cancer HPV infections are only one of

More information

Media Contacts: Annick Robinson Investor Contacts: Justin Holko (438) 837-2550 (908) 740-1879 annick.robinson@merck.com

Media Contacts: Annick Robinson Investor Contacts: Justin Holko (438) 837-2550 (908) 740-1879 annick.robinson@merck.com News Release FOR IMMEDIATE RELEASE Media Contacts: Annick Robinson Investor Contacts: Justin Holko (438) 837-2550 (908) 740-1879 annick.robinson@merck.com Merck's HPV Vaccine, GARDASIL 9, now available

More information

Summary of Key Points WHO Position Paper on Vaccines against Human Papillomavirus (HPV) October 2014

Summary of Key Points WHO Position Paper on Vaccines against Human Papillomavirus (HPV) October 2014 Summary of Key Points WHO Position Paper on Vaccines against Human Papillomavirus (HPV) October 2014 1 Background l Selected types of HPV cause cervical cancer, anogenital warts, and other anogenital and

More information

HPV & CERVICAL CANCER POLICY & LEGISLATIVE TOOLKIT, 3 RD EDITION

HPV & CERVICAL CANCER POLICY & LEGISLATIVE TOOLKIT, 3 RD EDITION What is HPV? 1 Frequently Asked Questions HPVs, or human papillomaviruses, are common viruses that cause warts and cancers and the most common viral sexually transmitted infection (STI). There are over

More information

III III a IIOI DID IIO 1101 ID III DII IDI DID IID IID IIID II DI IIi

III III a IIOI DID IIO 1101 ID III DII IDI DID IID IID IIID II DI IIi 19) United States III III a IIOI DID IIO 1101 ID III DII IDI DID IID IID IIID II DI IIi US 20090162400A1 (12) Patent Application Publication Al Powell et al. (43) Pub. Date: Jun. 25, (54) COMPOSITIONS

More information

HUMAN PAPILLOMAVIRUS (HPV) FACT SHEET

HUMAN PAPILLOMAVIRUS (HPV) FACT SHEET HUMAN PAPILLOMAVIRUS (HPV) FACT SHEET Background Information - Human Papillomavirus HPV is the name of a group of viruses that include more than 80 different types associated with a variety of epidermal

More information

HPV, Warts and All...

HPV, Warts and All... ... Philip Dawe, BEng and John Embil, MD, FRCPC Human papillomavirus (HPV) infection has been implicated in a number of disease processes in humans, ranging from common skin warts to cervical dysplasia.

More information

Information on: HPV vaccine. jostrust.org.uk

Information on: HPV vaccine. jostrust.org.uk Information on: HPV vaccine jostrust.org.uk HPV vaccine This booklet covers: What is the HPV vaccine? Where can girls get the vaccine? Will being vaccinated prevent all cases of cervical cancer? How effective

More information

Chapter 22: The Lymphatic System and Immunity

Chapter 22: The Lymphatic System and Immunity Chapter 22: The Lymphatic System and Immunity Introduction Immune system the body s defenses against pathogens that produce disease 2 types of immunity Nonspecific immune mechanisms (Innate immunity) Provide

More information

The role of IBV proteins in protection: cellular immune responses. COST meeting WG2 + WG3 Budapest, Hungary, 2015

The role of IBV proteins in protection: cellular immune responses. COST meeting WG2 + WG3 Budapest, Hungary, 2015 The role of IBV proteins in protection: cellular immune responses COST meeting WG2 + WG3 Budapest, Hungary, 2015 1 Presentation include: Laboratory results Literature summary Role of T cells in response

More information

2) Macrophages function to engulf and present antigen to other immune cells.

2) Macrophages function to engulf and present antigen to other immune cells. Immunology The immune system has specificity and memory. It specifically recognizes different antigens and has memory for these same antigens the next time they are encountered. The Cellular Components

More information

Leaflet 6: HPV, anal warts & anal dysplasia

Leaflet 6: HPV, anal warts & anal dysplasia Leaflet 6: HPV, anal warts & anal dysplasia Incorporating hospital and community health services, teaching and research 1 The Homerton Anal Neoplasia Service is a referral centre that provides a screening

More information

Name (print) Name (signature) Period. (Total 30 points)

Name (print) Name (signature) Period. (Total 30 points) AP Biology Worksheet Chapter 43 The Immune System Lambdin April 4, 2011 Due Date: Thurs. April 7, 2011 You may use the following: Text Notes Power point Internet One other person in class "On my honor,

More information

T cell Epitope Prediction

T cell Epitope Prediction Institute for Immunology and Informatics T cell Epitope Prediction EpiMatrix Eric Gustafson January 6, 2011 Overview Gathering raw data Popular sources Data Management Conservation Analysis Multiple Alignments

More information

Chapter 17A: Adaptive Immunity Part I

Chapter 17A: Adaptive Immunity Part I Chapter 17A: Adaptive Immunity Part I 1. Overview of Adaptive Immunity 2. T and B Cell Production 3. Antigens & Antigen Presentation 4. Helper T cells 1. Overview of Adaptive Immunity The Nature of Adaptive

More information

Cervical cancer is the second most common cancer among South African women

Cervical cancer is the second most common cancer among South African women Cervical cancer is the second most common cancer among South African women *SA Statistics as per National Cancer Registry (NCR) 2007 What is cervical cancer? Cervical cancer is a type of cancer that occurs

More information

Hapten - a small molecule that is antigenic but not (by itself) immunogenic.

Hapten - a small molecule that is antigenic but not (by itself) immunogenic. Chapter 3. Antigens Terminology: Antigen: Substances that can be recognized by the surface antibody (B cells) or by the TCR (T cells) when associated with MHC molecules Immunogenicity VS Antigenicity:

More information

Cervical Screening and HPV Vaccine Guidelines In Saudi Arabia. Prof. Mohammed Addar Chairmen Gyneoncology section KKUH, King Saud University

Cervical Screening and HPV Vaccine Guidelines In Saudi Arabia. Prof. Mohammed Addar Chairmen Gyneoncology section KKUH, King Saud University Cervical Screening and HPV Vaccine Guidelines In Saudi Arabia Prof. Mohammed Addar Chairmen Gyneoncology section KKUH, King Saud University Burden of HPV related cancers l l Cervical Cancer of the cervix

More information

Identification of T-cell epitopes of SARS-coronavirus for development of peptide-based vaccines and cellular immunity assessment methods

Identification of T-cell epitopes of SARS-coronavirus for development of peptide-based vaccines and cellular immunity assessment methods RESEARCH FUND FOR THE CONTROL OF INFECTIOUS DISEASES PKS Chan 陳 基 湘 S Ma 文 子 光 SM Ngai 倪 世 明 Key Messages 1. Subjects recovered from SARS-CoV infection retain memory of cellular immune response to epitopes

More information

Modelling and analysis of T-cell epitope screening data.

Modelling and analysis of T-cell epitope screening data. Modelling and analysis of T-cell epitope screening data. Tim Beißbarth 2, Jason A. Tye-Din 1, Gordon K. Smyth 1, Robert P. Anderson 1 and Terence P. Speed 1 1 WEHI, 1G Royal Parade, Parkville, VIC 3050,

More information

Pap smears, cytology and CCHC lab work and follow up

Pap smears, cytology and CCHC lab work and follow up Pap smears, cytology and CCHC lab work and follow up What is a Pap Smear? A Pap smear (also known as the Pap test) is a medical procedure in which a sample of cells from a woman's cervix (the end of the

More information

IDENTIFICATION OF T-CELL ANTIGENIC DETERMINANTS IN THE PROTEINS OF HUMAN PAPILLOMAVIRUS

IDENTIFICATION OF T-CELL ANTIGENIC DETERMINANTS IN THE PROTEINS OF HUMAN PAPILLOMAVIRUS INTERNATIONAL JOURNAL OF ADVANCED BIOTECHNOLOGY AND BIOINFORMATICS VOL.1, ISSUE.1, November 2012 IDENTIFICATION OF T-CELL ANTIGENIC DETERMINANTS IN THE PROTEINS OF HUMAN PAPILLOMAVIRUS ABSTRACT Dharmendra

More information

A polynucleotide consisting of the nucleotide sequence of SEQ ID NO:2.

A polynucleotide consisting of the nucleotide sequence of SEQ ID NO:2. Case A A polynucleotide consisting of the nucleotide sequence of SEQ ID NO:1 nucleotide sequence of SEQ ID NO:1 is one of the sequences which were analyzed using an automated DNA sequencer The sequences

More information

MICROBIOLOGY - IMMUNOLOGY MODULE Dr Ronnie Russell

MICROBIOLOGY - IMMUNOLOGY MODULE Dr Ronnie Russell The Specific/Adaptive Immune Response The Third Line of Defence Is called specific immunity The body s ability to recognize and defend itself against distinct invaders and their products Is a smart system

More information

One infected partner may be all it takes to get HPV.

One infected partner may be all it takes to get HPV. One infected partner may be all it takes to get HPV. HPV can cause cervical cancer in females and genital warts in males and females. Look inside to find out more. HPV=human papillomavirus HPV: What you

More information

BioMmune Technologies Inc. Corporate Presentation 2015

BioMmune Technologies Inc. Corporate Presentation 2015 BioMmune Technologies Inc Corporate Presentation 2015 * Harnessing the body s own immune system to fight cancer & other autoimmune diseases BioMmune Technologies Inc. (IMU) ABOUT A public biopharmaceutical

More information

Human papillomavirus infection. Epidemiology Natural History Transmission. BASSH HPV Special Interest Group

Human papillomavirus infection. Epidemiology Natural History Transmission. BASSH HPV Special Interest Group Human papillomavirus infection Epidemiology Natural History Transmission Human papillomavirus infection Epidemiology Human papillomaviruses Over 100 HPV types described 1 40 can infect the genital tract

More information

Prospects for Vaccines against Hepatitis C Viruses. T. Jake Liang. M.D. Liver Diseases Branch NIDDK, NIH, HHS

Prospects for Vaccines against Hepatitis C Viruses. T. Jake Liang. M.D. Liver Diseases Branch NIDDK, NIH, HHS Prospects for Vaccines against Hepatitis C Viruses T. Jake Liang. M.D. Liver Diseases Branch NIDDK, NIH, HHS HCV Vaccine Prevention strategies Protective immunity Barriers and solutions Vaccine candidates

More information

Identification of Tick-Borne Encephalitis Virus CD4+ and CD8+ T-Cell Epitopes in Vaccinated or Naturally Infected Humans

Identification of Tick-Borne Encephalitis Virus CD4+ and CD8+ T-Cell Epitopes in Vaccinated or Naturally Infected Humans Identification of Tick-Borne Encephalitis Virus CD4+ and CD8+ T-Cell Epitopes in Vaccinated or Naturally Infected Humans Schwaiger Julia Clinical Institute of Virology 29.06.2009 1 Thank you! Franz X.

More information

Article 53(c) EPC - therapy

Article 53(c) EPC - therapy Article 53(c) EPC - therapy Compound X is not new, but no medical use (a) (b) (c) (d) (e) (f) (g) (h) (i) (j) (k) compound X for use as a medicament compound X for use in treating disease Y composition

More information

Title: Mapping T cell epitopes in PCV2 capsid protein - NPB #08-159. Date Submitted: 12-11-09

Title: Mapping T cell epitopes in PCV2 capsid protein - NPB #08-159. Date Submitted: 12-11-09 Title: Mapping T cell epitopes in PCV2 capsid protein - NPB #08-159 Investigator: Institution: Carol Wyatt Kansas State University Date Submitted: 12-11-09 Industry summary: Effective circovirus vaccines

More information

Detection of T-cell T and their application to vaccine design

Detection of T-cell T and their application to vaccine design QuickTime and a TIFF (Uncompressed) decompressor are needed to see this picture Detection of T-cell T epitopes and their application to vaccine design EpiVax Inc. 16 Bassett Street Providence Rhode Island

More information

CONTENT. Chapter 1 Review of Literature. List of figures. List of tables

CONTENT. Chapter 1 Review of Literature. List of figures. List of tables Abstract Abbreviations List of figures CONTENT I-VI VII-VIII IX-XII List of tables XIII Chapter 1 Review of Literature 1. Vaccination against intracellular pathogens 1-34 1.1 Role of different immune responses

More information

Preventing Cervical Cancer with Gardasil Jana Ogden RN, MSN, MBA-HCA, IHCC Nursing Faculty. Upon Completion of the Lesson the student will be able to:

Preventing Cervical Cancer with Gardasil Jana Ogden RN, MSN, MBA-HCA, IHCC Nursing Faculty. Upon Completion of the Lesson the student will be able to: Preventing Cervical Cancer with Gardasil Jana Ogden RN, MSN, MBA-HCA, IHCC Nursing Faculty Upon Completion of the Lesson the student will be able to: Review statistics related to cervical cancer and HPV

More information

Cancer- Warts n All. Lewis Marshall Sexual Health Physician Fremantle Hospital

Cancer- Warts n All. Lewis Marshall Sexual Health Physician Fremantle Hospital Cancer- Warts n All Lewis Marshall Sexual Health Physician Fremantle Hospital What is Human Papillomavirus Human Papillomavirus (HPV) is a Double Stranded DNA virus Up to four out of five sexually active

More information

Cervical Cancer Screening in HIV

Cervical Cancer Screening in HIV NORTHWEST AIDS EDUCATION AND TRAINING CENTER Cervical Cancer Screening in HIV Hillary Liss, MD Harborview Medical Center, Madison and Adult Medicine Clinics NW AETC, Medical Program Director Presentation

More information

P r o t e c t Y o u r s e l f + P r o t e c T Y o u r P a r t n e r. genital HPV. T h e F a c t s

P r o t e c t Y o u r s e l f + P r o t e c T Y o u r P a r t n e r. genital HPV. T h e F a c t s P r o t e c t Y o u r s e l f + P r o t e c T Y o u r P a r t n e r genital HPV T h e F a c t s P r o t e c t Y o u r s e l f + P r o t e c T Y o u r P a r t n e r The facts Genital human papillomavirus

More information

Protect Yourself + Protect Your Partner. genital HP. T H e

Protect Yourself + Protect Your Partner. genital HP. T H e Protect Yourself + Protect Your Partner genital HP T H e V Fa ct s Protect Yourself + Protect Your Partner The facts Genital human papillomavirus (/pap pil LO ma VY rus/) (HPV) is the most common sexually

More information

Why is FTO important?

Why is FTO important? Antibodies, Patents and Freedom to Operate: The Monoclonal Maze Timothy J. Shea, Jr. Director Tracy Muller Associate Sterne, Kessler, Goldstein & Fox P.L.L.C. 4 th Annual Antibody Therapeutics Conference

More information

What is HPV? Low-risk HPV types. High-risk HPV types

What is HPV? Low-risk HPV types. High-risk HPV types HPV and Cancer What is HPV? HPV is short for human papilloma (PAP-uh-LO-muh) virus. HPVs are a large group of related viruses. Each HPV virus in the group is given a number, which is called an HPV type.

More information

HPV Vaccines. What is HPV? Can a vaccine help prevent HPV?

HPV Vaccines. What is HPV? Can a vaccine help prevent HPV? What is HPV? HPV Vaccines HPV is short for human papilloma virus. HPVs are a group of more than 150 related viruses. Each HPV virus in the group is given a number, which is called an HPV type. HPVs are

More information

CHAPTER 14 CELL SURFACE MARKERS OF T-CELLS, B-CELLS AND MACROPHAGES

CHAPTER 14 CELL SURFACE MARKERS OF T-CELLS, B-CELLS AND MACROPHAGES CHAPTER 14 CELL SURFACE MARKERS OF T-CELLS, B-CELLS AND MACROPHAGES An understanding of the distinct families of molecules present on different cells of the immune system provides the tools for distinguishing

More information

Natalia Taborda Vanegas. Doc. Sci. Student Immunovirology Group Universidad de Antioquia

Natalia Taborda Vanegas. Doc. Sci. Student Immunovirology Group Universidad de Antioquia Pathogenesis of Dengue Natalia Taborda Vanegas Doc. Sci. Student Immunovirology Group Universidad de Antioquia Infection process Epidermis keratinocytes Dermis Archives of Medical Research 36 (2005) 425

More information

VIRUSES AND CANCER. Michael Lea

VIRUSES AND CANCER. Michael Lea VIRUSES AND CANCER 2012 Michael Lea VIRAL ONCOLOGY - LECTURE OUTLINE 1. Historical Review 2. Viruses Associated with Cancer 3. RNA Tumor Viruses 4. DNA Tumor Viruses HISTORICAL REVIEW Historical Review

More information

Human Papillomavirus (HPV) and Cervical Cancer Fact Sheet. Almost all cervical cancers more than 99 percent are caused by HPV. 2

Human Papillomavirus (HPV) and Cervical Cancer Fact Sheet. Almost all cervical cancers more than 99 percent are caused by HPV. 2 Fast Facts Human Papillomavirus (HPV) and Cervical Cancer Fact Sheet Human papillomavirus (HPV) is a common infection transmitted during sexual contact and those affected often do not show symptoms. 1

More information

Frequently Asked Questions

Frequently Asked Questions PPFA HPV FAQ.qxd /11 2:15 PM Page 1 Frequently Asked Questions PPFA HPV FAQ.qxd /11 2:15 PM Page 2 PPFA HPV FAQ.qxd /11 2:15 PM Page 3 General Questions About HPV PPFA HPV FAQ.qxd /11 2:15 PM Page 4 PPFA

More information

specific B cells Humoral immunity lymphocytes antibodies B cells bone marrow Cell-mediated immunity: T cells antibodies proteins

specific B cells Humoral immunity lymphocytes antibodies B cells bone marrow Cell-mediated immunity: T cells antibodies proteins Adaptive Immunity Chapter 17: Adaptive (specific) Immunity Bio 139 Dr. Amy Rogers Host defenses that are specific to a particular infectious agent Can be innate or genetic for humans as a group: most microbes

More information

Examples of good screening tests include: mammography for breast cancer screening and Pap smears for cervical cancer screening.

Examples of good screening tests include: mammography for breast cancer screening and Pap smears for cervical cancer screening. CANCER SCREENING Dr. Tracy Sexton (updated July 2010) What is screening? Screening is the identification of asymptomatic disease or risk factors by history taking, physical examination, laboratory tests

More information

Cervical Cancer The Importance of Cervical Screening and Vaccination

Cervical Cancer The Importance of Cervical Screening and Vaccination Cervical Cancer The Importance of Cervical Screening and Vaccination Cancer Cells Cancer begins in cells, the building blocks that make up tissues. Tissues make up the organs of the body. Sometimes, this

More information

and Antigen Presentation

and Antigen Presentation 1 Innate Immunity and Antigen Presentation Andrew Lichtman, MD PhD Brigham and Women's Hospital Harvard Medical School 2 Lecture outline Innate immunity Receptors and mechanisms Roles in disease Antigen

More information

Optimizing the clinical value of HPV test

Optimizing the clinical value of HPV test Optimizing the clinical value of HPV test 10 th Asia pacific Congress of Medical Virology 15 18 Oct 2015 Taipei Paul KS Chan Department of Microbiology Estimated contribution of HPV Cervical cancer: ~

More information

A Genetic Analysis of Rheumatoid Arthritis

A Genetic Analysis of Rheumatoid Arthritis A Genetic Analysis of Rheumatoid Arthritis Introduction to Rheumatoid Arthritis: Classification and Diagnosis Rheumatoid arthritis is a chronic inflammatory disorder that affects mainly synovial joints.

More information

Identification of CD4+ T cell epitopes specific for the breast cancer associated antigen NY-BR-1

Identification of CD4+ T cell epitopes specific for the breast cancer associated antigen NY-BR-1 9/8/2015 Identification of CD4+ T cell epitopes specific for the breast cancer associated antigen NY-BR-1 Stefan Eichmüller, PhD GMP & T Cell Therapy Unit, German Cancer Research Center, Heidelberg, Germany

More information

Immuno-Oncology Therapies to Treat Lung Cancer

Immuno-Oncology Therapies to Treat Lung Cancer Immuno-Oncology Therapies to Treat Lung Cancer What you need to know ONCHQ14NP07519 Introduction: Immuno-oncology represents an innovative approach to cancer research that seeks to harness the body s own

More information

Accent on Health Obgyn, PC HPV Frequently Asked Questions

Accent on Health Obgyn, PC HPV Frequently Asked Questions 1. What is HPV? 2. How do you get HPV? 3. How common is HPV? 4. What are the symptoms of HPV? 5. Can HPV be treated? 6. What is the HPV test and how is it different from a PAP test? 7. Can the HPV test

More information

HPV IMMUNIZATION GUIDELINES AND TIPS FOR PROVIDERS

HPV IMMUNIZATION GUIDELINES AND TIPS FOR PROVIDERS HPV IMMUNIZATION GUIDELINES AND TIPS FOR PROVIDERS HPV Most types of HPV that infect humans are asymptomatic and transient There are certain oncogenic types that may persist and cause cancers of the cervix,

More information

Antigens have specific regions where antibodies bind to them Antigens are usually molecules on the surface of viruses or foreign cells Antigenic

Antigens have specific regions where antibodies bind to them Antigens are usually molecules on the surface of viruses or foreign cells Antigenic Bio 100 Guide 22 Antigens have specific regions where antibodies bind to them Antigens are usually molecules on the surface of viruses or foreign cells Antigenic determinants are the specific regions on

More information

The immune system. Bone marrow. Thymus. Spleen. Bone marrow. NK cell. B-cell. T-cell. Basophil Neutrophil. Eosinophil. Myeloid progenitor

The immune system. Bone marrow. Thymus. Spleen. Bone marrow. NK cell. B-cell. T-cell. Basophil Neutrophil. Eosinophil. Myeloid progenitor The immune system Basophil Neutrophil Bone marrow Eosinophil Myeloid progenitor Dendritic cell Pluripotent Stem cell Lymphoid progenitor Platelets Bone marrow Thymus NK cell T-cell B-cell Spleen Cancer

More information

Quality and Safety Evaluation of Gene Therapy Products in Japan

Quality and Safety Evaluation of Gene Therapy Products in Japan Quality and Safety Evaluation of Gene Therapy Products in Japan Review Mechanism for Gene Therapy in Japan The review mechanism for gene therapy in Japan was partially amended to simplify the necessary

More information

Cervical cancer screening with the HPV test and the Pap test in women ages 30 and older

Cervical cancer screening with the HPV test and the Pap test in women ages 30 and older Cervical cancer screening with the HPV test and the Pap test in women ages 30 and older When to get tested and how to make sense of your test results If you are 30 years or older and your Pap test is normal

More information

New developments in antigen-specific immunotherapies Novel therapeutic vaccines offer hope in the fight against chronic infectious disease and cancer

New developments in antigen-specific immunotherapies Novel therapeutic vaccines offer hope in the fight against chronic infectious disease and cancer New developments in antigen-specific immunotherapies Novel therapeutic vaccines offer hope in the fight against chronic infectious disease and cancer Vaccination has been used effectively for more than

More information

What is HPV and why is it so important?

What is HPV and why is it so important? Understanding HPV For many years, Pap smears have been the most effective way to tell if a woman is at risk of developing cervical cancer. The Pap smear may also identify a common viral infection called

More information

Immunization Healthcare Branch. Human Papillomavirus Vaccination Program Questions and Answers. Prepared by

Immunization Healthcare Branch. Human Papillomavirus Vaccination Program Questions and Answers. Prepared by Immunization Healthcare Branch Human Papillomavirus Vaccination Program Questions and Answers Prepared by Immunization Healthcare Branch (IHB), Defense Health Agency Last Updated: 02 Jan 14 www.vaccines.mil

More information

Pathogens and the immune system

Pathogens and the immune system Review of lecture 7 Pathogens and the immune system Veronica Leautaud, Ph.D. vl2@ rice.edu BRC 511 / 530-lab Lecture 8 BIOE 301-Bioengineering and World Health Science Science is the human activity of

More information

The Adaptive Immune Response. B-cells

The Adaptive Immune Response. B-cells The Adaptive Immune Response B-cells FUNCTIONS OF THE IMMUNE SYSTEM: Recognize, destroy and clear a diversity of pathogens. Initiate tissue and wound healing processes. Recognize and clear damaged self

More information

What is CIN (cervical intra-epithelial) and what causes it?

What is CIN (cervical intra-epithelial) and what causes it? What is CIN (cervical intra-epithelial) and what causes it? This information is an extract from the booklet Understanding CIN (cervical intra-epithelial neoplasia). You may find the full booklet helpful.

More information

Topic I DNA Vaccines

Topic I DNA Vaccines Seminar Molecular Mechanisms in Health and Disease Topic I DNA Vaccines King CA, Spellerberg MB, Zhu D, Rice J, Sahota SS, Thompsett AR, Hamblin TJ, Radl J, Stevenson FK DNA vaccines with single chain

More information

HPV Vaccines. What is HPV? Can a vaccine help prevent HPV?

HPV Vaccines. What is HPV? Can a vaccine help prevent HPV? What is HPV? HPV Vaccines HPV stands for human papilloma virus. HPVs are a group of more than 150 related viruses. Each HPV virus in the group is given a number, and is called an HPV type (for instance,

More information

Chapter 18: Applications of Immunology

Chapter 18: Applications of Immunology Chapter 18: Applications of Immunology 1. Vaccinations 2. Monoclonal vs Polyclonal Ab 3. Diagnostic Immunology 1. Vaccinations What is Vaccination? A method of inducing artificial immunity by exposing

More information

Cervical Cancer. Shannon Bartley Liliya

Cervical Cancer. Shannon Bartley Liliya Cervical Cancer Shannon Bartley Liliya The quality of life turned to be better than before. Nowadays people live in better conditions. They eat high quality food and receive all vitamins needed for health.

More information

THE MAIN ADVANTAGES OF THE HPV TEST DO HPV TESTS ATTRACT A MEDICARE

THE MAIN ADVANTAGES OF THE HPV TEST DO HPV TESTS ATTRACT A MEDICARE Understanding HPV For many years, Pap smears have been the most effective way to tell if a woman is at risk of developing cervical cancer. The Pap smear may also identify a common viral infection called

More information

HPV vaccination. Béatrice Swennen, MD, MPH PROVAC Ecole de Santé Publique ULB. Diagnostic et surveillance maladies infectieuses, 19 mai 2016

HPV vaccination. Béatrice Swennen, MD, MPH PROVAC Ecole de Santé Publique ULB. Diagnostic et surveillance maladies infectieuses, 19 mai 2016 HPV vaccination Béatrice Swennen, MD, MPH PROVAC Ecole de Santé Publique ULB Diagnostic et surveillance maladies infectieuses, 19 mai 2016 HPV L1 Virus Like Particle Malik H; 2014 Arch Virol Antigen Host

More information

Questions and Answers about Human Papillomavirus (HPV) Vaccine

Questions and Answers about Human Papillomavirus (HPV) Vaccine Page 1 of 5 Questions and Answers about Human Papillomavirus (HPV) Vaccine A. Information for Providers What is HPV? Human Papillomavirus, (HPV) is one of the most common sexually transmitted infections

More information

11/20/2011. Outline. Immune System Function. Terminology. Two Types of Immune Defense. Innate Immunity = Non Specific

11/20/2011. Outline. Immune System Function. Terminology. Two Types of Immune Defense. Innate Immunity = Non Specific Chapter 43 Immune System Outline I. Nonspecific Defenses A. Barrier B. Protective proteins C. Phagocytes D. Natural killer cells E. Inflammatory reaction II. Specific Defenses A. B cells Antibody mediated

More information

B cell activation and Humoral Immunity

B cell activation and Humoral Immunity B cell activation and Humoral Immunity Humoral immunity is mediated by secreted antibodies and its physiological function is defense against extracellular microbes (including viruses) and microbial exotoxins.

More information

Brought to you by. [ your information / logo here ]

Brought to you by. [ your information / logo here ] Brought to you by [ your information / logo here ] 1 1 2 2 3 3 HPV can infect anyone Human papillomavirus (HPV) is a widespread virus that can infect most males and females in their lifetime. For most,

More information

Brought to you by [ your information / logo here ]

Brought to you by [ your information / logo here ] Brought to you by [ your information / logo here ] 1 1 2 2 3 3 HPV can infect anyone Human papillomavirus (HPV) is a widespread virus that can infect most males and females in their lifetime. For most,

More information

TRANSGENE SA, FRANCE 2. INSTITUT PASTEUR, FRANCE On behalf. AFEF 2013, Lille 02 nd October 2013

TRANSGENE SA, FRANCE 2. INSTITUT PASTEUR, FRANCE On behalf. AFEF 2013, Lille 02 nd October 2013 A MULTIVALENT ADENOVIRUS-BASED IMMUNOTHERAPEUTIC FOR TREATMENT OF CHRONIC HEPATITIS B INDUCES BROAD, ROBUST AND POLYFUNCTIONAL T CELLS IN NAIVE MICE AND EXERT AN EARLY ANTIVIRAL EFFECT IN HBV TOLERANT

More information

Chapter 43: The Immune System

Chapter 43: The Immune System Name Period Our students consider this chapter to be a particularly challenging and important one. Expect to work your way slowly through the first three concepts. Take particular care with Concepts 43.2

More information

PEPVAC: a web server for multi-epitope vaccine development based on the prediction of supertypic MHC ligands

PEPVAC: a web server for multi-epitope vaccine development based on the prediction of supertypic MHC ligands W138 W142 doi:10.1093/nar/gki357 PEPVAC: a web server for multi-epitope vaccine development based on the prediction of supertypic MHC ligands Pedro A. Reche 1,2, * and Ellis L. Reinherz 1,2 1 Laboratory

More information

ADMEDUS ANNOUNCES FURTHER DATA FROM HERPES SIMPLEX VACCINE TRIAL

ADMEDUS ANNOUNCES FURTHER DATA FROM HERPES SIMPLEX VACCINE TRIAL ADMEDUS Ltd ABN 35 088 221 078 REGISTERED OFFICE: Level 1, 197 Adelaide Terrace Perth Western Australia 6000 PO Box 6879 East Perth Western Australia 6892 ASX ANNOUNCEMENT T +61 (0)8 9266 0100 F +61 (0)8

More information

Activation and effector functions of HMI

Activation and effector functions of HMI Activation and effector functions of HMI Hathairat Thananchai, DPhil Department of Microbiology Faculty of Medicine Chiang Mai University 25 August 2015 ว ตถ ประสงค หล งจากช วโมงบรรยายน แล วน กศ กษาสามารถ

More information

Human papillomavirus Vaccine introduced 2010 (girls only) NOTIFIABLE

Human papillomavirus Vaccine introduced 2010 (girls only) NOTIFIABLE Chapter 10 10 Vaccine introduced 2010 (girls only) NOTIFIABLE In some circumstances, advice in these guidelines may differ from that in the Summary of Product Characteristics of the vaccines. When this

More information

Dr. Valerie Jaeger Acting President Providing Leadership in Public Health Management

Dr. Valerie Jaeger Acting President Providing Leadership in Public Health Management 2 Carlton Street, Suite 1306 Toronto, Ontario M5B 1J3 Tel: (416) 595-0006 Fax: (416) 595-0030 E-mail: info@alphaweb.org alpha s members are the public health units in Ontario. alpha Sections: Boards of

More information

Why use passive immunity?

Why use passive immunity? Vaccines Active vs Passive Immunization Active is longer acting and makes memory and effector cells Passive is shorter acting, no memory and no effector cells Both can be obtained through natural processes:

More information

Oncos Therapeutics: ONCOS THERAPEUTICS Personalized Cancer Immunotherapy. March 2015. Antti Vuolanto, COO and co-founder

Oncos Therapeutics: ONCOS THERAPEUTICS Personalized Cancer Immunotherapy. March 2015. Antti Vuolanto, COO and co-founder Oncos Therapeutics: Personalized Cancer Immunotherapy ONCOS THERAPEUTICS Personalized Cancer Immunotherapy March 2015 Antti Vuolanto, COO and co-founder 1 History of Oncos Therapeutics 2002 2007 2009 Research

More information

Test 4 Immune System (Chapters 20 & 21)

Test 4 Immune System (Chapters 20 & 21) Test 4 Immune System (Chapters 20 & 21) Name: Date: 1) The is the largest lymphoid organ. 1) A. lymph node B. spleen C. thymus D. tonsil 2) Tonsils promote memory of pathogens by. 2) A. secreting antibodies

More information

Making the switch to a safer CAR-T cell therapy

Making the switch to a safer CAR-T cell therapy Making the switch to a safer CAR-T cell therapy HaemaLogiX 2015 Technical Journal Club May 24 th 2016 Christina Müller - chimeric antigen receptor = CAR - CAR T cells are generated by lentiviral transduction

More information

Assays to evaluate cell-mediated immunity. Guus Rimmelzwaan Department of Virology Erasmus Medical Center Rotterdam The Netherlands

Assays to evaluate cell-mediated immunity. Guus Rimmelzwaan Department of Virology Erasmus Medical Center Rotterdam The Netherlands Assays to evaluate cell-mediated immunity Guus Rimmelzwaan Department of Virology Erasmus Medical Center Rotterdam The Netherlands CBER/NIAID/WHO, Bethesda MD, December 11 2007 A working model of an antiviral

More information

AP BIOLOGY 2007 SCORING GUIDELINES (Form B)

AP BIOLOGY 2007 SCORING GUIDELINES (Form B) AP BIOLOGY 2007 SCORING GUIDELINES (Form B) Question 2 The defenses of the human body to the entry and establishment of a pathogen (disease-causing organism) can be divided into nonspecific responses and

More information

Understanding. Cervical Changes A Health Guide for Women. National Cancer Institute U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES

Understanding. Cervical Changes A Health Guide for Women. National Cancer Institute U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES National Cancer Institute Understanding Cervical Changes A Health Guide for Women U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health This guide helped me talk with my doctor after

More information

Information on: HPV testing. jostrust.org.uk

Information on: HPV testing. jostrust.org.uk Information on: HPV testing jostrust.org.uk HPV testing This booklet covers: What is HPV? How do you get HPV? HPV testing Results of HPV testing Jo s Cervical Cancer Trust 2 What is HPV testing? Human

More information

Genital Warts Genital warts are very common. They are caused by a virus, the human papillomavirus (HPV).

Genital Warts Genital warts are very common. They are caused by a virus, the human papillomavirus (HPV). Genital Warts Genital warts are very common. They are caused by a virus, the human papillomavirus (HPV). There are at least 100 different types of HPV; at least 40 can infect the genital area. At least

More information

HPV OncoTect E6, E7 mrna Kit A highly specific molecular test for early detection of cervical cancer

HPV OncoTect E6, E7 mrna Kit A highly specific molecular test for early detection of cervical cancer Revolutionizing healthcare one cell at a time HPV OncoTect E6, E7 mrna Kit A highly specific molecular test for early detection of cervical cancer Numerous studies confirm that the presence of HR HPV DNA

More information

The society for lower genital tract disorders since 1964.

The society for lower genital tract disorders since 1964. The society for lower genital tract disorders since 1964. Updated Consensus Guidelines for Managing Abnormal Cervical Cancer Screening Tests and Cancer Precursors American Society for and Cervical Pathology

More information

Explanation of your PAP smear

Explanation of your PAP smear Explanation of your PAP smear Approximately 5-10% of PAP smears in the United States are judged to be abnormal. Too often, the woman who receives this news worries that she already has, or will develop,

More information

NATIONAL GUIDELINE FOR CERVICAL CANCER SCREENING PROGRAMME

NATIONAL GUIDELINE FOR CERVICAL CANCER SCREENING PROGRAMME NATIONAL GUIDELINE FOR CERVICAL CANCER SCREENING PROGRAMME CERVICAL CANCER Introduction Cancer of the cervix is the second most common form of cancer amongst South African women. Approximately one in every

More information

Human Papilloma Virus (HPV), Cancer, and HPV Vaccines -- Frequently Asked Questions

Human Papilloma Virus (HPV), Cancer, and HPV Vaccines -- Frequently Asked Questions Human Papilloma Virus (HPV), Cancer, and HPV Vaccines -- Frequently Asked Questions What are viruses? Viruses are very small -- most cannot even be seen with a regular microscope -- organisms. They cannot

More information

Human Papillomavirus Human Papillomavirus Human Papillomavirus Pathogenesis 139

Human Papillomavirus Human Papillomavirus Human Papillomavirus Pathogenesis 139 Human Papillomavirus Human papillomavirus (HPV) is the most common sexually transmitted infection in the United States. The relationship of cervical cancer and sexual behavior was suspected for more than

More information