(FRPPHUFHLQ5XVVLD 0U(UNNL/LLNDQHQ 63((&+ Member of the European Commission, responsible for Enterprise and the Information Society

Size: px
Start display at page:

Download "(FRPPHUFHLQ5XVVLD 0U(UNNL/LLNDQHQ 63((&+ Member of the European Commission, responsible for Enterprise and the Information Society"

Transcription

1 63((&+ 0U(UNNL/LLNDQHQ Member of the European Commission, responsible for Enterprise and the Information Society (FRPPHUFHLQ5XVVLD Conference organised by Russian Association of Networks and Services (RANS), by video-link 0RVFRZ'HFHPEHU

2 H(8523( Ladies and Gentlemen, At the Lisbon Summit the EU leaders endorsed a new strategic goal for the European Union for the next decade: WREHFRPHWKHPRVWFRPSHWLWLYHDQGG\QDPLF NQRZOHGJHEDVHGHFRQRP\LQWKHZRUOG. The related eeurope 2002 Action Plan identifies concrete objectives and deadlines. Effective monitoring of the implementation of the Action Plan will be ensured by "benchmarking". We have been in touch on this subject before. Therefore I will not develop this further now. Further details are available from our website. Increasingly we are working with our partners in Europe to develop similar plans. Candidate countries have developed their eeurope+ Action Plans along the same lines as eeurope. 1RUWKHUQH'LPHQVLRQ$FWLRQ3ODQ The Council of Baltic Sea States assisted by the European Commission took the initiative to develop the so-called Northern edimension Action Plan. This plan was recently approved at a ministerial meeting in Riga to which both Mr Reiman and I participated. The overall approach of the Northern edimension Action Plan is to build on national plans in the countries of the region, such as erussia together with eeurope and eeurope+. We are especially pleased to see that erussia is now well developed. The objective is to develop the Information Society in the region as a whole, taking into account the very considerable strengths in the region. The penetration of Information Society services is amongst the highest in the world in Scandinavia; the Baltics are catching up fast and North-West Russia has much to offer in terms of well qualified ICT specialists. 3ULQFLSOHVRIHFRPPHUFHOHJLVODWLRQLQWKH(8 Let me now first say something about the approach adopted by the EU in legislating e-commerce and about our collaboration to develop e-commerce legislation in Russia. The European e-commerce framework is a light one. Legislation is limited to what is strictly necessary in order to avoid over-regulation, which would act as a deterrent. It sets rules and principles that are valid throughout the EU only in essential areas, such as personal data, privacy, copyright, legal responsibility, taxation, etc. It is a technology-neutral framework. This is made necessary by the fact that e- commerce and new Internet services are based on technology in constant evolution. It must be up to industry to choose and implement the most appropriate technological solutions to uphold EU legislation. E-commerce legislation is complemented by self-regulation, which can be an efficient and flexible alternative to address certain issues: for instance codes of conduct or alternative dispute resolution mechanisms. This, of course, implies some real co-operation between government, industry, and consumers, leading to a kind of co-regulation. 2

3 In the event of any disputes, the Commission is in favour of out-of-court settlements, using on-line mediation and arbitration mechanisms. These methods are quick and inexpensive. Even with EU-wide legal guarantees, many Internet users won t feel safe. A growing number of them experience security and privacy problems. In a year, spamming has tripled and virus attacks more then doubled. The Commission has made proposals to mitigate the effect of these activities. &RRSHUDWLRQRQWKHGHYHORSPHQWRIH&RPPHUFHOHJLVODWLRQEHWZHHQ (8DQG5XVVLD Experts from the EU and Russia have worked closely together on the development of e-commerce legislation in Russia, which is now in its second reading in the State Duma. This collaboration was based on the experience the EU has gained in the Directives on this subject which have already been passed. There is a high degree of compatibility between the EU Directives and the Russian draft laws but there are also some important differences: - Both the EU and UNCITRAL have adopted a technologically neutral approach to authentication based on electronic signature rather than the digital signature approach currently adopted by Russia. Although Russia s choice may be founded on security considerations, we would recommend that further consideration be given to the electronic signature approach which has a wider applicability and potentially a longer validity because of its technological neutrality, - The EU Directive on electronic commerce covers all information society services whereas the draft Russian law is limited to the conclusion of contracts. Additionally, only persons involved in a transaction benefit from the legal framework of the draft Russian law whereas the EU Directive brings protection to any person using any Information Society service. These matters were discussed in great detail between our experts, in the presence of a representative of the State Duma. A detailed article by article comparison is available in both English and Russian. According to our experience, law making is a complex and lengthy process. We recommend that due consideration be given to the differences between the EU Directives and the draft Russian laws described above. (FRPPHUFHLQWKH1RUWKHUQH'LPHQVLRQ$FWLRQ3ODQ I would now like to return to the subject of the Northern edimension Action Plan. The plan consists of action lines addressing topics from high speed research networks to e-environment. I am pleased that Russia has agreed to take the lead on the e-commerce action line for which already an initial programme has been defined. Specific topics to be addressed are legal aspects, consumer protection and mutual recognition of digital signature certificates. The e-commerce Working Group will work with academic institutions in the region to develop a business training capacity for ICT specialists. Current experience to promote the take up of ICT in small and medium size enterprises in the EU will be expanded to Russia and the Baltics. 3

4 More detailed information will be posted on the Northern edimension website. We would encourage the Russian business community to take an active part in this Working Group. The European Commission has proposed a substantial budget to support these activities. This proposal has passed the first stage of approval by Member States. We are currently in discussion with international financing institutions to make venture capital funds available for improving the efficiency and business potential of small companies. We should also not forget the possibilities available through the EU Framework Programme for RTD in which we are looking for a significant increase in Russian participation. Thus, for people or companies with ideas and drive, there will be considerable opportunities. Finally, in this context, I would like to make reference to the erussia programme, which is expected to receive substantial financial support over the next decade. There is clearly a commonality of goals between the Northern edimension Action Plan and erussia in this region and we would like to enter into discussion with our Russian colleagues to develop joint projects. 7KH7HOHFRPPXQLFDWLRQV5HJXODWRU\)UDPHZRUN No Information Society can flourish without a cost effective telecommunications infrastructure. This means the provision of the services which the user wants, whether being private individual or a business enterprise, at a price he can afford. In the EU we liberalised the telecommunications sector in 1998, with some country exceptions. We have seen a growth of some 9% in the communications markets annually. This is three times as much as GDP growth. Clearly the communications sector is an important contributor to the GDP. In addition, we have seen considerable diversification of services available to the user, along with choice of service provider and reduced costs. We have also been working on a revision of telecommunications legislation in the EU. The larger part of the new package has just been approved by the European Parliament. With this we will have a clear and transparent regulatory framework which is enforced by independent national regulatory authorities and, if necessary and within certain limits, by the European Commission. Such a regulatory framework is critical to attracting investment, especially Foreign Direct Investment. The Russian telecommunications sector is developing very quickly with the restructuring of Sviazinvest. New legislation has been submitted to the State Duma. I would encourage a similar approach to that adopted in the EU in terms of the regulatory framework and the independent regulator. &RQFOXVLRQ Ladies and gentlemen, If I may sum up, co-operation between the EU and Russia is developing very rapidly. Considerable opportunities are on the horizon and I would encourage participants in the conference to take advantage of these in the Northern Dimension context. 4

5 I cannot end my speech without making a brief reference to the wider implications of this work. Russia and the EU have agreed to enter into discussion about the socalled Common European Economic Space. This future economic space will depend on efficient and interoperable e-commerce services between the our regions. This conference is just one event which should help to make this possible. I must also express my heartfelt wish that Russia will take the difficult but necessary decisions to become a full member of WTO in the very near future. I wish you an enjoyable and productive conference today. 5

EUROPEAN ECONOMIC AREA JOINT PARLIAMENTARY COMMITTEE. REPORT on E-Commerce and EEA legislation

EUROPEAN ECONOMIC AREA JOINT PARLIAMENTARY COMMITTEE. REPORT on E-Commerce and EEA legislation EUROPEAN ECONOMIC AREA 30 November 2000 Brussels JOINT PARLIAMENTARY COMMITTEE REPORT on E-Commerce and EEA legislation Co-rapporteurs: Ms. Marjo Matikainen-Kallstöm (EPP-ED, Finland) Mr. Vilhjálmur Egilsson

More information

Tentative Action Plan

Tentative Action Plan Republic of Serbia Ministry of Science and Environmental Protection Serbia and Montenegro Tentative Action Plan Draft 1 Belgrade, September 2005 Tentative Action Plan - Draft 1 Section 1 and 2 Information

More information

Draft WGIG Issues Paper on E-Commerce

Draft WGIG Issues Paper on E-Commerce Draft WGIG Issues Paper on E-Commerce This paper is a 'draft working paper' reflecting the preliminary findings of the drafting team. It has been subject to review by all WGIG members, but it does not

More information

Honourable members of the National Parliaments of the EU member states and candidate countries,

Honourable members of the National Parliaments of the EU member states and candidate countries, Speech by Mr Rudolf Peter ROY, Head of division for Security Policy and Sanctions of the European External Action Service, at the L COSAC Meeting 29 October 2013, Vilnius Honourable members of the National

More information

COMMISSION OF THE EUROPEAN COMMUNITIES

COMMISSION OF THE EUROPEAN COMMUNITIES COMMISSION OF THE EUROPEAN COMMUNITIES Brussels, 18.4.2007 COM(2007) 183 final COMMUNICATION FROM THE COMMISSION TO THE EUROPEAN PARLIAMENT, THE COUNCIL, THE EUROPEAN ECONOMIC AND SOCIAL COMMITTEE AND

More information

Dr. Vangelis OUZOUNIS Senior Expert Security Policies ENISA. evangelos.ouzounis@enisa.europa.eu

Dr. Vangelis OUZOUNIS Senior Expert Security Policies ENISA. evangelos.ouzounis@enisa.europa.eu Dr. Vangelis OUZOUNIS Senior Expert Security Policies ENISA evangelos.ouzounis@enisa.europa.eu 5 th German Anti-Spam Summit Koeln, 5 th of Sept. 2007 www.enisa.europa.eu 1 Agenda NIS a Challenge for the

More information

The contribution of UNCITRAL texts to paperless trade

The contribution of UNCITRAL texts to paperless trade The contribution of UNCITRAL texts to paperless trade Luca Castellani UNCITRAL Secretariat The mandate of UNCITRAL The core legal body of the United Nations system in the field of commercial law. A legal

More information

Mutual legal recognition of electronic communications and electronic signatures and paperless trade facilitation: challenges and opportunities

Mutual legal recognition of electronic communications and electronic signatures and paperless trade facilitation: challenges and opportunities Mutual legal recognition of electronic communications and electronic signatures and paperless trade facilitation: challenges and opportunities Luca Castellani Secretary, Working Group IV (Electronic Commerce)

More information

BSBMKG606B Manage international marketing programs

BSBMKG606B Manage international marketing programs BSBMKG606B Manage international marketing programs Revision Number: 1 BSBMKG606B Manage international marketing programs Modification History Not applicable. Unit Descriptor Unit descriptor This unit describes

More information

COUNCIL OF THE EUROPEAN UNION. Brussels, 7 October 2003 (OR. en) 12858/03 RECH 152 OC 589

COUNCIL OF THE EUROPEAN UNION. Brussels, 7 October 2003 (OR. en) 12858/03 RECH 152 OC 589 COUNCIL OF THE EUROPEAN UNION Brussels, 7 October 2003 (OR. en) 12858/03 RECH 152 OC 589 LEGISLATIVE ACTS AND OTHER INSTRUMENTS Subject : Council Decision on the signing of the Framework Agreement between

More information

Legal issues relevant for paperless trade facilitation and electronic single window facilities

Legal issues relevant for paperless trade facilitation and electronic single window facilities Legal issues relevant for paperless trade facilitation and electronic single window facilities Luca Castellani UNCITRAL Secretariat subtitle Trade facilitation and paperless trade Trade facilitation aims

More information

H(XURSH7KH:D\)RUZDUG

H(XURSH7KH:D\)RUZDUG 63((&+ (UNNL/,,.$1(1 Member of the European Commission responsible for Enterprise and the Information Society H(XURSH7KH:D\)RUZDUG Ministerial Meeting /LVERQ$SULO H(8523($)7(5/,6%21 Ladies and gentlemen,

More information

Northern Dimension Policy Framework Document (effective as 1 January 2007)

Northern Dimension Policy Framework Document (effective as 1 January 2007) Northern Dimension Policy Framework Document (effective as 1 January 2007) 1. Introduction 1. The Northern Dimension covers a broad geographic area from the European Arctic and Sub- Arctic areas to the

More information

THE ROLE OF ICT REGULATION IN PROMOTING SMES IN DEVELOPING COUNTRIES. Egidius MBARARA, Rwanda Utilities Regulatory Agency (RURA)

THE ROLE OF ICT REGULATION IN PROMOTING SMES IN DEVELOPING COUNTRIES. Egidius MBARARA, Rwanda Utilities Regulatory Agency (RURA) THE ROLE OF ICT REGULATION IN PROMOTING SMES IN DEVELOPING COUNTRIES Egidius MBARARA, Rwanda Utilities Regulatory Agency (RURA) Introduction e-commerce has increasingly become a necessary component of

More information

Position Paper e-regulation

Position Paper e-regulation Position Paper e-regulation Ecommerce Europe s Proposal for Sustainable Growth of E-commerce in Europe www.ecommerce-europe.eu POSITION PAPER 3 Table of contents 1 Introduction 4 5.1.4 Harmonisation and

More information

Presentation by Mr. Richard Bruton, Minister of Jobs, Enterprise and Innovation to the IMCO Committee of the European Parliament, Brussels

Presentation by Mr. Richard Bruton, Minister of Jobs, Enterprise and Innovation to the IMCO Committee of the European Parliament, Brussels Presentation by Mr. Richard Bruton, Minister of Jobs, Enterprise and Innovation to the IMCO Committee of the European Parliament, Brussels Wednesday 23 rd January 2013 Check against delivery Honourable

More information

Harmonizing cyberlaws and regulations: the experience of the East African Community CTO Cybersecurity Forum 2013 26 April 2013 Yaoundé, Cameroon

Harmonizing cyberlaws and regulations: the experience of the East African Community CTO Cybersecurity Forum 2013 26 April 2013 Yaoundé, Cameroon Harmonizing cyberlaws and regulations: the experience of the East African Community CTO Cybersecurity Forum 2013 26 April 2013 Yaoundé, Cameroon Cécile Barayre Programme Manager, E-Commerce and Law Reform,

More information

ACHIEVING BEST PRACTICE IN YOUR BUSINESS. Information Security: Guide to the Electronic Communications Act 2000

ACHIEVING BEST PRACTICE IN YOUR BUSINESS. Information Security: Guide to the Electronic Communications Act 2000 ACHIEVING BEST PRACTICE IN YOUR BUSINESS Information Security: Guide to the Electronic Communications Act 2000 The DTI drives our ambition of prosperity for all by working to create the best environment

More information

(DRAFT)( 2 ) MOTION FOR A RESOLUTION

(DRAFT)( 2 ) MOTION FOR A RESOLUTION 05 Motions for resolutions, and other B8 documents 05_09. Motions to wind up debate on statements by other institutions: Rule 123(2) Cover page EUROPEAN PARLIAMENT 2014 2019 Plenary sitting [.2014] B[8-/2014](

More information

OUTCOME OF THE COUNCIL MEETING. 3375th Council meeting. Economic and Financial Affairs. Brussels, 10 March 2015. Minister for Finance of Latvia

OUTCOME OF THE COUNCIL MEETING. 3375th Council meeting. Economic and Financial Affairs. Brussels, 10 March 2015. Minister for Finance of Latvia Council of the European Union 7004/15 (OR. en) PROVISIONAL VERSION PRESSE 20 PR CO 12 OUTCOME OF THE COUNCIL MEETING 3375th Council meeting Economic and Financial Affairs Brussels, 10 March 2015 President

More information

This document is addressed to all policy makers working on proposals that affect or have the potential to affect the Internet and e-commerce.

This document is addressed to all policy makers working on proposals that affect or have the potential to affect the Internet and e-commerce. E-Policy Principles A policymakers guide to the Internet What is this for? As part of the UK online strategy the Government is committed to making the UK one of the world's leading knowledge economies.

More information

Position Paper PROVIDING THE LEGAL AND POLICY ENVIRONMENT TO SUPPORT EFFECTIVE INFORMAL WORKOUT REGIMES IN THE ASIA-PACIFIC REGION

Position Paper PROVIDING THE LEGAL AND POLICY ENVIRONMENT TO SUPPORT EFFECTIVE INFORMAL WORKOUT REGIMES IN THE ASIA-PACIFIC REGION Position Paper PROVIDING THE LEGAL AND POLICY ENVIRONMENT TO SUPPORT EFFECTIVE INFORMAL WORKOUT REGIMES IN THE ASIA-PACIFIC REGION 1. The Asian Bankers Association (ABA) considers robust insolvency and

More information

E-commerce and Development Key Trends and Issues

E-commerce and Development Key Trends and Issues E-commerce and Development Key Trends and Issues Torbjörn Fredriksson Chief, ICT Analysis Section UNCTAD, Division on Technology and Logistics (torbjorn.fredriksson@unctad.org) Workshop on E-Commerce,

More information

CYBER SECURITY LEGISLATION AND POLICY INITIATIVES - UGANDA CASE

CYBER SECURITY LEGISLATION AND POLICY INITIATIVES - UGANDA CASE CYBER SECURITY LEGISLATION AND POLICY INITIATIVES - UGANDA CASE 2009 ITU Regional Cybersecurity Forum for Africa and Arab States Tunis, 4-5 June 2009 Patrick Mwesigwa, Director/Technology & Licensing,

More information

EUROPEAN CHARTER FOR SMALL ENTERPRISES

EUROPEAN CHARTER FOR SMALL ENTERPRISES EUROPEAN CHARTER FOR SMALL ENTERPRISES Small enterprises are the backbone of the European economy. They are a key source of jobs and a breeding ground for business ideas. Europe s efforts to usher in the

More information

CLOUT UNCITRAL. Facts about

CLOUT UNCITRAL. Facts about UNCITRAL UNITED NATIONS COMMISSION ON INTERNATIONAL TRADE LAW Facts about CLOUT Case Law On Uncitral Texts A legal database of worldwide court decisions and arbitral awards on UNCITRAL texts UNCITRAL texts

More information

COMMISSION STAFF WORKING DOCUMENT. Report on the Implementation of the Communication 'Unleashing the Potential of Cloud Computing in Europe'

COMMISSION STAFF WORKING DOCUMENT. Report on the Implementation of the Communication 'Unleashing the Potential of Cloud Computing in Europe' EUROPEAN COMMISSION Brussels, 2.7.2014 SWD(2014) 214 final COMMISSION STAFF WORKING DOCUMENT Report on the Implementation of the Communication 'Unleashing the Potential of Cloud Computing in Europe' Accompanying

More information

COMMITTEE ON STANDARDS AND TECHNICAL REGULATIONS (98/34 COMMITTEE)

COMMITTEE ON STANDARDS AND TECHNICAL REGULATIONS (98/34 COMMITTEE) EUROPEAN COMMISSION ENTERPRISE AND INDUSTRY DIRECTORATE-GENERAL Regulatory Policy Standardisation Brussels, 9 th November 2005 Doc.: 34/2005 Rev. 1 EN COMMITTEE ON STANDARDS AND TECHNICAL REGULATIONS (98/34

More information

Recommendation for a COUNCIL RECOMMENDATION. on the 2015 National Reform Programme of Portugal

Recommendation for a COUNCIL RECOMMENDATION. on the 2015 National Reform Programme of Portugal EUROPEAN COMMISSION Brussels, 13.5.2015 COM(2015) 271 final Recommendation for a COUNCIL RECOMMENDATION on the 2015 National Reform Programme of Portugal and delivering a Council opinion on the 2015 Stability

More information

TTIP Proposal for Chapter: Good Regulatory Practices

TTIP Proposal for Chapter: Good Regulatory Practices TTIP Proposal for Chapter: Good Regulatory Practices Article 1 General Provisions: 1. The parties reaffirm their commitment to good regulatory principles and practices to achieve public policy objectives

More information

Expert Meeting on CYBERLAWS AND REGULATIONS FOR ENHANCING E-COMMERCE: INCLUDING CASE STUDIES AND LESSONS LEARNED. 25-27 March 2015

Expert Meeting on CYBERLAWS AND REGULATIONS FOR ENHANCING E-COMMERCE: INCLUDING CASE STUDIES AND LESSONS LEARNED. 25-27 March 2015 Expert Meeting on CYBERLAWS AND REGULATIONS FOR ENHANCING E-COMMERCE: INCLUDING CASE STUDIES AND LESSONS LEARNED 25-27 March 2015 Global E-commerce and Cyberlaw Developments By Torbjörn Fredriksson UNCTAD

More information

PUBLIC CONSULTATION on the review of the EU regulatory framework for electronic communications. (courtesy translation)

PUBLIC CONSULTATION on the review of the EU regulatory framework for electronic communications. (courtesy translation) PUBLIC CONSULTATION on the review of the EU regulatory framework for electronic communications (courtesy translation) Consultation Paper published on: 3 July 2015 Deadline for the submission of comments:

More information

Powering Up the Network: A Report on Small Business Use of E-business Solutions in Canada

Powering Up the Network: A Report on Small Business Use of E-business Solutions in Canada Powering Up the Network: A Report on Small Business Use of E-business Solutions in Canada February 2010 Overview Canada is a world leader in many areas: energy, natural resources and the financial services

More information

Delegations will find attached the conclusions adopted by the European Council at the above meeting.

Delegations will find attached the conclusions adopted by the European Council at the above meeting. European Council Brussels, 20 March 2015 (OR. en) EUCO 11/15 CO EUR 1 CONCL 1 COVER NOTE From: General Secretariat of the Council To: Delegations Subject: European Council meeting (19 and 20 March 2015)

More information

RECOMMENDATIONS COMMISSION

RECOMMENDATIONS COMMISSION 16.5.2009 Official Journal of the European Union L 122/47 RECOMMENDATIONS COMMISSION COMMISSION RECOMMENDATION of 12 May 2009 on the implementation of privacy and data protection principles in applications

More information

F A C T S H E E T. EU-US Summit (Brussels, 26 March 2014) and EU-US relations

F A C T S H E E T. EU-US Summit (Brussels, 26 March 2014) and EU-US relations Brussels, 24 March 2014 140324/01 F A C T S H E E T EU-US Summit (Brussels, 26 March 2014) and EU-US relations The Leaders of the European Union and the United States of America will meet on 26 March 2014

More information

Towards Effective Internet Governance

Towards Effective Internet Governance Towards Effective Internet Governance Risaburo NEZU Director Science, Technology and Industry OECD APEC e- commerce convention May 15, 2000 Tokyo Japan ISSUES 1. Tax 2. Tariffs 3. Privacy protection 4.

More information

Wednesday 23/1/2013. Check against Delivery. Madame Chairman, Vice-Chairs and members of the ITRE Parliamentary Committee,

Wednesday 23/1/2013. Check against Delivery. Madame Chairman, Vice-Chairs and members of the ITRE Parliamentary Committee, Presentation by Mr Richard Bruton, Minister of Jobs, Enterprise and Innovation to the Industry Research and Energy Committee of the European Parliament, Brussels Wednesday 23/1/2013 Check against Delivery

More information

Legal Interoperability to Enable Cross-Border Data Exchange through SW Facilities

Legal Interoperability to Enable Cross-Border Data Exchange through SW Facilities Legal Interoperability to Enable Cross-Border Data Exchange through SW Facilities Prof. Dr. HONG XUE Director of BNU Institute for Internet Policy & Law EGM on Integrated Use of Single Windows for TF Bangkok

More information

Cyber Security Recommendations October 29, 2002

Cyber Security Recommendations October 29, 2002 Cyber Security Recommendations October 29, 2002 Leading Co-Chair (Asia/Oceania) Co-Chair (Americas) Co-Chair (Europe/Africa) Dr. Hiroki Arakawa Executive Vice President NTT Data Corporation Richard Brown

More information

Speech. European Wind Energy Conference Athens, 27 February 2005. Please note, it is not an official translation, authorised by European Commission

Speech. European Wind Energy Conference Athens, 27 February 2005. Please note, it is not an official translation, authorised by European Commission Please note, it is not an official translation, authorised by European Commission Speech Dear Excellencies, Dear Ladies and Gentlemen, I am delighted to be here with you today, at a conference that it

More information

COMMISSION OF THE EUROPEAN COMMUNITIES COMMISSION RECOMMENDATION. of 12.5.2009

COMMISSION OF THE EUROPEAN COMMUNITIES COMMISSION RECOMMENDATION. of 12.5.2009 COMMISSION OF THE EUROPEAN COMMUNITIES Brussels, 12.5.2009 C(2009) 3200 final COMMISSION RECOMMENDATION of 12.5.2009 on the implementation of privacy and data protection principles in applications supported

More information

The Development of Consumer Protection Laws in Tanzania for Electronic Consumer Contracts

The Development of Consumer Protection Laws in Tanzania for Electronic Consumer Contracts The Development of Consumer Protection Laws in Tanzania for Electronic Consumer Contracts A thesis submitted in fulfilment of the requirements for the degree of Doctor of Philosophy (PhD) By Theodora Mwenegoha

More information

CHAPTER 14 ELECTRONIC COMMERCE

CHAPTER 14 ELECTRONIC COMMERCE CHAPTER 14 ELECTRONIC COMMERCE Article 14.1: Definitions For the purposes of this Chapter: computing facilities means computer servers and storage devices for processing or storing information for commercial

More information

Plan for Growth: Promoting the UK s Legal Services Sector

Plan for Growth: Promoting the UK s Legal Services Sector Plan for Growth: Promoting the UK s Legal Services Sector Foreword by the Lord Chancellor and Secretary of State for Justice, and the Minister for Trade & Investment As Britain s economy emerges from a

More information

Cybersecurity Governance

Cybersecurity Governance AfriSIG 2014 Cybersecurity Governance Pria.za.africa Encoding Cybersecurity Norms and Principles Issues, Developments and Approaches Cybersecurity Governance Political Will and Leadership Institutional

More information

BEUC s contribution on Cloud Computing for the Public Hearing in the ITRE Committee, European Parliament, 29 May 2013

BEUC s contribution on Cloud Computing for the Public Hearing in the ITRE Committee, European Parliament, 29 May 2013 BEUC s contribution on Cloud Computing for the Public Hearing in the ITRE Committee, European Parliament, 29 May 2013 Contact: Digital and Consumer Contracts Teams digital@beuc.eu - consumercontracts@beuc.eu

More information

Mobile TV: The time to act is now

Mobile TV: The time to act is now SPEECH/07/154 Viviane Reding Member of the European Commission responsible for Information Society and Media Mobile TV: The time to act is now Mobile TV Conference, International CeBIT Summit Hannover,

More information

Erasmus Mundus Programme. For Cooperation and Mobility in Higher Education

Erasmus Mundus Programme. For Cooperation and Mobility in Higher Education For Cooperation and Mobility in Higher Education Background Inspired by the highly successful Erasmus Programme, Erasmus Mundus also offers a framework for valuable exchange and dialogue between cultures.

More information

Council of the European Union Brussels, 4 July 2014 (OR. en) Mr Uwe CORSEPIUS, Secretary-General of the Council of the European Union

Council of the European Union Brussels, 4 July 2014 (OR. en) Mr Uwe CORSEPIUS, Secretary-General of the Council of the European Union Council of the European Union Brussels, 4 July 2014 (OR. en) 11603/14 ADD 1 COVER NOTE From: date of receipt: 2 July 2014 To: No. Cion doc.: Subject: RECH 323 TELECOM 140 MI 521 DATAPROTECT 100 COMPET

More information

Written Contribution of the National Association of Statutory Health Insurance Funds of 16.11.2015

Written Contribution of the National Association of Statutory Health Insurance Funds of 16.11.2015 Written Contribution of the National Association of Statutory Health Insurance Funds of 16.11.2015 to the Public Consultation of the European Commission on Standards in the Digital : setting priorities

More information

BEREC DRAFT REPORT ON OTT SERVICES

BEREC DRAFT REPORT ON OTT SERVICES The Consumer Voice in Europe BEREC DRAFT REPORT ON OTT SERVICES BEUC response to the public consultation Contact: Guillermo Beltrà digital@beuc.eu BUREAU EUROPÉEN DES UNIONS DE CONSOMMATEURS AISBL DER

More information

SPEECH FOR THE PANEL ON BUSINESS CLIMATE AND INVESTMENT OPPORTUNITIES, Support for Ukraine Conference, 28 April 2015

SPEECH FOR THE PANEL ON BUSINESS CLIMATE AND INVESTMENT OPPORTUNITIES, Support for Ukraine Conference, 28 April 2015 SPEECH FOR THE PANEL ON BUSINESS CLIMATE AND INVESTMENT OPPORTUNITIES, Support for Ukraine Conference, 28 April 2015 Ministers, friends, ladies and gentlemen, Ukraine has extraordinary potential. We all

More information

Privacy in the Cloud: Data Protection and Security in Cloud Computing

Privacy in the Cloud: Data Protection and Security in Cloud Computing SPEECH/11/859 Viviane REDING Vice-President of the European Commission, EU Justice Commissioner Privacy in the Cloud: Data Protection and Security in Cloud Computing Round-table High Level conference on

More information

Capacity Building in the New Member States and Accession Countries on Further Climate Change Action Post-2012

Capacity Building in the New Member States and Accession Countries on Further Climate Change Action Post-2012 Capacity Building in the New Member States and Accession Countries on Further Climate Change Action Post-2012 (Service Contract N o 070402/2004/395810/MAR/C2) 29 November 2007 Almost all New Members States

More information

COMMISSION OF THE EUROPEAN COMMUNITIES

COMMISSION OF THE EUROPEAN COMMUNITIES EN EN EN COMMISSION OF THE EUROPEAN COMMUNITIES Brussels, 28.11.2008 COM(2008) 798 final COMMUNICATION FROM THE COMMISSION TO THE COUNCIL, THE EUROPEAN PARLIAMENT, THE EUROPEAN ECONOMIC AND SOCIAL COMMITTEE

More information

The United Nations Convention on the Use of Electronic Communications in International Contracts: policy goals

The United Nations Convention on the Use of Electronic Communications in International Contracts: policy goals The United Nations Convention on the Use of Electronic Communications in International Contracts: policy goals Luca Castellani Legal Officer UNCITRAL Secretariat Vienna, Austria Why a new international

More information

ICTLECOMM 2010 Introduction to the E-commerce Law Course Maryke Silalahi Nuth Norwegian Research Centre for Computers & Law 2 February 2010

ICTLECOMM 2010 Introduction to the E-commerce Law Course Maryke Silalahi Nuth Norwegian Research Centre for Computers & Law 2 February 2010 ICTLECOMM 2010 Introduction to the E-commerce Law Course Maryke Silalahi Nuth Norwegian Research Centre for Computers & Law 2 February 2010 NRCCL (University of Oslo, Faculty of Law) Topics Overview of

More information

COMESA Guidelines on Free and Open Source Software (FOSS)

COMESA Guidelines on Free and Open Source Software (FOSS) COMESA Guidelines on Free and Open Source Software (FOSS) Introduction The COMESA Guidelines on Free and Open Source Software are a follow-up to the COMESA Regional FOSS Framework of 2009 whose main objective

More information

CURRICULUM VITAE. 8. Language skills: Indicate competence on a scale of 1 to 5 (1 - excellent; 5 - basic)

CURRICULUM VITAE. 8. Language skills: Indicate competence on a scale of 1 to 5 (1 - excellent; 5 - basic) CURRICULUM VITAE 1. Family name: SHAKHBAZIAN 2. First names: Karyna 3. Date of birth: 1977 4. Nationality: Ukrainian 5. Civil status: Single 6. Contact info: Address: ap.29, 7, Ostrovskogo street., Kyiv,

More information

Screening report Turkey

Screening report Turkey 13 February 2006 Screening report Turkey Chapter 26 Education and Culture Date of screening meetings: Explanatory meeting: 26 October 2005 Bilateral meeting: 16 November 2005 1 I. CHAPTER CONTENT The areas

More information

EDRi s. January 2015. European Digital Rights Rue Belliard 20, 1040 Brussels www.edri.org @EDRi tel. +32 (0) 2 274 25 70

EDRi s. January 2015. European Digital Rights Rue Belliard 20, 1040 Brussels www.edri.org @EDRi tel. +32 (0) 2 274 25 70 EDRi s Red lines on TTIP January 2015 European Digital Rights Rue Belliard 20, 1040 Brussels www.edri.org @EDRi tel. +32 (0) 2 274 25 70 ABOUT EDRI European Digital Rights is a network of 34 privacy and

More information

COMMISSION OF THE EUROPEAN COMMUNITIES

COMMISSION OF THE EUROPEAN COMMUNITIES EN EN EN COMMISSION OF THE EUROPEAN COMMUNITIES Brussels, [ ] COM(2006) 251 COMMUNICATION FROM THE COMMISSION TO THE COUNCIL, THE EUROPEAN PARLIAMENT, THE EUROPEAN ECONOMIC AND SOCIAL COMMITTEE AND THE

More information

EU Cybersecurity Policy & Legislation ENISA s Contribution

EU Cybersecurity Policy & Legislation ENISA s Contribution EU Cybersecurity Policy & Legislation ENISA s Contribution Steve Purser Head of Core Operations Oslo 26 May 2015 European Union Agency for Network and Information Security Agenda 01 Introduction to ENISA

More information

Trade Debates - Liberal Voices Needed

Trade Debates - Liberal Voices Needed European Commission Speech [Check against delivery] Trade Debates - Liberal Voices Needed 3 December 2015 Cecilia Malmström, Commissioner for Trade Berlin Event at Friedrich Naumann Stiftung Ladies and

More information

Summary of replies to the public consultation on crossborder inheritance tax obstacles within the EU and possible solutions

Summary of replies to the public consultation on crossborder inheritance tax obstacles within the EU and possible solutions EUROPEAN COMMISSION DIRECTORATE-GENERAL TAXATION AND CUSTOMS UNION ANALYSES AND TAX POLICIES Direct tax policy & co-operation Brussels, Summary of replies to the public consultation on crossborder inheritance

More information

Official Journal of the European Communities. (Acts whose publication is obligatory)

Official Journal of the European Communities. (Acts whose publication is obligatory) L 113/1 I (Acts whose publication is obligatory) REGULATION (EC) No 733/2002 OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL of 22 April 2002 on the implementation of the.eu Top Level Domain (Text witheea

More information

NATIONAL REPORT. European Conference of Ministers of Higher Education. Berlin, September 2003 GENERAL DIRECTORATE OF UNIVERSITIES

NATIONAL REPORT. European Conference of Ministers of Higher Education. Berlin, September 2003 GENERAL DIRECTORATE OF UNIVERSITIES NATIONAL REPORT European Conference of Ministers of Higher Education Berlin, September 2003 GENERAL DIRECTORATE OF UNIVERSITIES Madrid, July 2003 CONTENTS 1.- Introduction... page 3 2.- Degree recognition

More information

protection rights are limited. protection rights are limited.

protection rights are limited. protection rights are limited. Score: 44.09 Rank: 22 / 24 Brazil is a fast-growing economy that recognizes the importance of ICT and the digital economy. However, some gaps in law and regulation have acted as barriers to ICT innovation

More information

H*RYHUQPHQW3URYLGLQJEHWWHUSXEOLF VHUYLFH DQG ZLGHU SDUWLFLSDWLRQ IRU FLWL]HQV

H*RYHUQPHQW3URYLGLQJEHWWHUSXEOLF VHUYLFH DQG ZLGHU SDUWLFLSDWLRQ IRU FLWL]HQV 63((&+ (UNNL/,,.$1(1 Member of the European Commission responsible for Enterprise and the Information Society H*RYHUQPHQW3URYLGLQJEHWWHUSXEOLF VHUYLFH DQG ZLGHU SDUWLFLSDWLRQ IRU FLWL]HQV IDEA (International

More information

Okinawa Charter on Global Information Society

Okinawa Charter on Global Information Society Okinawa Charter on Global Information Society 1. Information and Communications Technology (IT) is one of the most potent forces in shaping the twenty-first century. Its revolutionary impact affects the

More information

e-justice in Hungary Ferenc Zombor Deputy State Secretary Responsible for EU and International Justice Cooperation

e-justice in Hungary Ferenc Zombor Deputy State Secretary Responsible for EU and International Justice Cooperation e-justice in Hungary Ferenc Zombor Deputy State Secretary Responsible for EU and International Justice Cooperation PRESENTATION OUTLINE I. Historic and Legal Background II. The Act on e-signatures III.Electronic

More information

Privacy and Transparency for Consumer Trust and Consumer Centrality

Privacy and Transparency for Consumer Trust and Consumer Centrality 1 1 2 2 Ecommerce Europe is the association representing around 5000+ companies selling products and/or services online to consumers in Europe. Ecommerce Europe is a major stakeholder in policy issues

More information

Facilitating a competitive environment for SMEs to develop future Internet business models

Facilitating a competitive environment for SMEs to develop future Internet business models SPEECH/10/388 Neelie Kroes European Commission Vice-President for the Digital Agenda Facilitating a competitive environment for SMEs to develop future Internet business models Telecom Conference of the

More information

TO: Advisory Committee commentators on electronic commerce projects at International organizations

TO: Advisory Committee commentators on electronic commerce projects at International organizations TO: Advisory Committee commentators on electronic commerce projects at International organizations Review of possible future ECom projects We are undertaking a review of private law developments in electronic

More information

It is with great pleasure that I address you here today. I would like to. thank Luis for providing this opportunity. The subject that I will discuss

It is with great pleasure that I address you here today. I would like to. thank Luis for providing this opportunity. The subject that I will discuss Ladies and gentlemen, It is with great pleasure that I address you here today. I would like to thank Luis for providing this opportunity. The subject that I will discuss today, is recovery and reform.

More information

www.bonddickinson.com Cyber Risks October 2014 2

www.bonddickinson.com Cyber Risks October 2014 2 www.bonddickinson.com Cyber Risks October 2014 2 Why this emerging sector matters Justin Tivey Legal Director T: +44(0)845 415 8128 E: justin.tivey The government estimates that the current cost of cyber-crime

More information

Germany: Report on Developments in the Field of Information and Telecommunications in the Context of International Security (RES 69/28),

Germany: Report on Developments in the Field of Information and Telecommunications in the Context of International Security (RES 69/28), Germany: Report on Developments in the Field of Information and Telecommunications in the Context of International Security (RES 69/28), General appreciation of the issues of information security Information

More information

DSTI/ICCP/REG(98)10/FINAL Or. Eng.

DSTI/ICCP/REG(98)10/FINAL Or. Eng. Unclassified DSTI/ICCP/REG(98)10/FINAL DSTI/ICCP/REG(98)10/FINAL Or. Eng. Unclassified Organisation de Coopération et de Développement Economiques OLIS : 18-Dec-1998 Organisation for Economic Co-operation

More information

AmCham EU position on Industrial Policy for the Security Industry

AmCham EU position on Industrial Policy for the Security Industry AmCham EU position on Industrial Policy for the Security Industry Page 1 of 5 13 February 2012 AmCham EU position on Industrial Policy for the Security Industry The American Chamber of Commerce to the

More information

Dialogue between the Government and stakeholders a crucial factor for improving Business Environment

Dialogue between the Government and stakeholders a crucial factor for improving Business Environment Dialogue between the Government and stakeholders a crucial factor for improving Business Environment Anrijs Matīss Deputy State Secretary Ministry of Economics of the Republic of Latvia Brivibas street

More information

OFFSHORE E-COMMERCE STRATEGIES CONFERENCE. TORONTO, CANADA 19th & 20th February 2001

OFFSHORE E-COMMERCE STRATEGIES CONFERENCE. TORONTO, CANADA 19th & 20th February 2001 OFFSHORE E-COMMERCE STRATEGIES CONFERENCE TORONTO, CANADA 19th & 20th February 2001 THE KEY ADVANTAGES OF THE ISLE OF MAN FOR OFFSHORE E-COMMERCE TIM CRAINE Director of e-commerce, Isle of Man Government

More information

collection and use of personal data in Italy. Principles.

collection and use of personal data in Italy. Principles. Country Report: Italy Italy has strong cybercrime laws and strict privacy laws in place. Like many EU countries, Italy s privacy law includes onerous registration requirements that appear unnecessary.

More information

National Strategy for Information Security in the Slovak Republic

National Strategy for Information Security in the Slovak Republic National Strategy for Information Security in the Slovak Republic Table of Contents 1. Introduction 3 2. Importance of the document 3 2.1 Importance of information security 3 2.2 Information security from

More information

EU Cybersecurity: Ensuring Trust in the European Digital Economy

EU Cybersecurity: Ensuring Trust in the European Digital Economy EU Cybersecurity: Ensuring Trust in the European Digital Economy Synthesis of the FIC Breakfast-Debate 15 October 2013, Brussels With the participation of Tunne Kelam Member of the European Parliament'

More information

Enhancing Life Insurance Regulatory Regimes in ASIA

Enhancing Life Insurance Regulatory Regimes in ASIA International Symposium Enhancing Life Insurance Regulatory Regimes in ASIA Multilateral agencies and regulatory changes in life insurance and pension systems Mr H.Y.Mok, Assistant Commissioner of Insurance,

More information

COMMISSION OF THE EUROPEAN COMMUNITIES REPORT FROM THE COMMISSION ON MONITORING THE APPLICATION OF COMMUNITY LAW (2003) OVERALL POSITION

COMMISSION OF THE EUROPEAN COMMUNITIES REPORT FROM THE COMMISSION ON MONITORING THE APPLICATION OF COMMUNITY LAW (2003) OVERALL POSITION COMMISSION OF THE EUROPEAN COMMUNITIES Brussels, 30.12.2004 COM(2004) 839 final REPORT FROM THE COMMISSION ON MONITORING THE APPLICATION OF COMMUNITY LAW (2003) OVERALL POSITION 21st ANNUAL REPORT {SEC(2004)

More information

National. icr Policy

National. icr Policy National icr Policy TABLE OF CONTENTS Forward Acknowledgements 1. Principles...1 1.0 Introduction...1 1.1 Vision...2 1.2 Mission...2 1.3 Policy Context...2 2. Policy Objectives...4 2.1 ICT Infrastructure...4

More information

2011-2014. Deliverable 3 Supervision of sports agents and transfers of players, notably young players. Expert Group "Good Governance

2011-2014. Deliverable 3 Supervision of sports agents and transfers of players, notably young players. Expert Group Good Governance EU Work Plan for Sport 2011-2014 Expert Group "Good Governance Deliverable 3 Supervision of sports agents and transfers of players, notably young players D e c e m b e r 2 0 1 3 2 1. INTRODUCTION The EU

More information

Suspend the negotiations for a free trade agreement with the USA no agreement at the expense of workers, consumers or the environment

Suspend the negotiations for a free trade agreement with the USA no agreement at the expense of workers, consumers or the environment German Trade Union Confederation (DGB) Executive Board DGB Position Suspend the negotiations for a free trade agreement with the USA no agreement at the expense of workers, consumers or the environment

More information

Proposal for a DIRECTIVE OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL. on electronic invoicing in public procurement. (Text with EEA relevance)

Proposal for a DIRECTIVE OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL. on electronic invoicing in public procurement. (Text with EEA relevance) EUROPEAN COMMISSION Brussels, 26.6.2013 COM(2013) 449 final 2013/0213 (COD) Proposal for a DIRECTIVE OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL on electronic invoicing in public procurement (Text with

More information

E-commerce. A promising future. Anacom conference

E-commerce. A promising future. Anacom conference E-commerce A promising future Anacom conference Joost Vantomme Lisbon, 6 October 2011 Agenda 1. The context 2. What does the consumer say? 3. What does the regulatory community undertake? 4. The bpost

More information

Application of Data Protection Concepts to Cloud Computing

Application of Data Protection Concepts to Cloud Computing Application of Data Protection Concepts to Cloud Computing By Denitza Toptchiyska Abstract: The fast technological development and growing use of cloud computing services require implementation of effective

More information

Supplementary Appendix Table A DESCRIPTION OF THE DIRECTIVES OF THE FINACIAL SERVICES ACTION PLAN (FSAP)

Supplementary Appendix Table A DESCRIPTION OF THE DIRECTIVES OF THE FINACIAL SERVICES ACTION PLAN (FSAP) Supplementary Appendix Table A DESCRIPTION OF THE DIRECTIVES OF THE FINACIAL SERVICES ACTION PLAN (FSAP) Directive Name Directive No. Deadline Implementation of the Settlement Finality Directive 1998/26/EC

More information

Datacenter Business Opportunities in Finland. Toni Mattila

Datacenter Business Opportunities in Finland. Toni Mattila Datacenter Business Opportunities in Finland Toni Mattila Senior Advisor, Investment Consulting September 2015 Finpro / Invest in Finland Finpro helps Finnish SMEs go international, encourages foreign

More information

Digital signature and e-government: legal framework and opportunities. Raúl Rubio Baker & McKenzie

Digital signature and e-government: legal framework and opportunities. Raúl Rubio Baker & McKenzie Digital signature and e-government: legal framework and opportunities Raúl Rubio Baker & McKenzie e-government concept Utilization of Information and Communication Technologies (ICTs) to improve and/or

More information

Some laws and standards in India are not technology neutral (e.g., electronic signatures), and these may be a barrier to interoperability.

Some laws and standards in India are not technology neutral (e.g., electronic signatures), and these may be a barrier to interoperability. Country Report: India India is an important regional economy, with a strong interest in ICT services development. The law in India has not entirely kept pace with developments in cloud computing, and some

More information

eeurope 2002 An Information Society For All

eeurope 2002 An Information Society For All COMMISSION OF THE EUROPEAN COMMUNITIES Brussels, 24.5.2000 COM (2000) 330 final eeurope 2002 An Information Society For All Draft Action Plan prepared by the for the Council in Feira 19-20 June 2000 The

More information

BCS, The Chartered Institute for IT Consultation Response to:

BCS, The Chartered Institute for IT Consultation Response to: BCS, The Chartered Institute for IT Consultation Response to: A Comprehensive Approach to Personal Data Protection in the European Union Dated: 15 January 2011 BCS The Chartered Institute for IT First

More information