A!Team!Cymru!EIS!Report:!Growing!Exploitation!of!Small! OfCice!Routers!Creating!Serious!Risks!

Save this PDF as:

Size: px
Start display at page:

Download "A!Team!Cymru!EIS!Report:!Growing!Exploitation!of!Small! OfCice!Routers!Creating!Serious!Risks!"


1 ATeamCymruEISReport:GrowingExploitationofSmall OfCiceRoutersCreatingSeriousRisks PoweredbyTeamCymru sthreatintelligencegroup Page 1of 14www.team-cymru.com

2 Threat'Intelligence'Group EXECUTIVE SUMMARY Page2of14www.team-cymru.com

3 Summary' Thisreportdetailsourrecentanalysisofawidespreadcompromiseofconsumer-grade smallofcice/homeofcice(soho)routers.attackersarealteringthednsconcigurationon thesedevicesinordertoredirectvictimsdnsrequestsandsubsequentlyreplacethe intendedanswerswithipaddressesanddomainscontrolledbytheattackers,effectively conductingaman-in-the-middleattack. Asthebarisincreasinglyraisedforcompromisingendpointworkstations,cybercriminals areturningtonewmethodstoachievetheirdesiredgoals,withoutgainingaccessto victims machinesdirectly.thecampaigndetailedinthisreportisthelatestinagrowing trendteamcymruhasobservedofcybercriminalstargetingsohorouters. InJanuary2014,TeamCymru senterpriseintelligenceservicesbeganinvestigating asohopharmingcampaignthathadoverwrittenrouterdnssettingsincentral Europe.Todate,wehaveidentiCiedover300,000devices,predominantlyinEurope andasia,whichwebelievehavebeencompromisedaspartofthiscampaign,one whichdatesbacktoatleastmid-decemberof2013. AffecteddeviceshadtheirDNSsettingschangedtousetheIPaddresses and ouranalysisindicatedthatalargemajorityofaffectedrouters residedinvietnam.othertopcountriesaffectedincludedindia,italyandthailand. Analysisofthevictimdevicesaffectedrevealedthatthecompromiseisnotlimitedto asinglemanufacturer.arangeofroutermodelsfromseveralmanufacturersappears tobecompromised.aswiththednschangermalware,unwittingvictimsare vulnerabletoalossofserviceifthemaliciousserversaretakendown,asboth primaryandsecondarydnsipaddressesareoverwritten,complicatingmitigation. Theaffecteddevicesweobservedwerevulnerabletomultipleexploittechniques, includingarecentlydisclosedauthenticationbypassvulnerabilityinzyxel CirmwareandCross-SiteRequestForgery(CSRF)techniquessimilartothose reportedinlate Thislarge-scaleattackhassimilaritieswitharecent,highlytargetedattackagainst Polishconsumerbankcustomers,thoughsubtledifferencesintradecraftpointto thesebeingseparatecampaigns. 2Wealsobelievethatthisactivityisseparatefrom thelinksysmoonwormrecentlyreportedbythesansinstitute. 3 WeassessthatconsumerunfamiliaritywithconCiguringthesedevices,aswellas frequentlyinsecuredefaultsettings,backdoorsincirmware,andcommodity-level 1 Seehttp://www.jakoblell.com/blog/2013/10/30/real-world-csrf-attack-hijacks-dns-server-configuration-of-tplink-routers-2/ and https://isc.sans.edu/diary/linksys+worm+%22themoon%22+summary%3a+what+we+know+so+far/17633 Page 3of 14www.team-cymru.com

4 engineeringstandardsmakesoho-typewirelessroutersaveryattractivetargetfor cybercriminals.' Manycybercrimeparticipantshavebecomeusedtopurchasingbots,exploit servers,andotherinfrastructureasmanagedservicesfromothercriminals.we expectthatthesemarketforceswilldriveadvancesintheexploitationofembedded systemsastheyhavedonefortheexploitationofpcs. WehaveintegratedvictimIPaddressesandotherdatarelatedtoSOHOpharming attacksintoourno-costcommunitytoolsfornetworkproviders,aswellasour commercialthreatintelligencefeeds.formoredetails,visithttps://www.teamcymru.org/services/ Affected'router'distribution'heatmap'visualization Page 4of 14www.team-cymru.com

5 Threat'Intelligence'Group ANALYSIS Page5of14www.team-cymru.com

6 Analysis Observed'in'the'Wild' InJanuary2014,theEnterpriseIntelligenceServicesteamatTeamCymrubecameawareof severaltp-linkwi-firoutersthathadtheirdnssettingsmaliciouslyalteredtosenddns requeststotwonewipaddresses: TherouterswerebothsmallofCice/homeofCice(SOHO)classdevicesthatprovidedWi-Fi connectivity,localdns,anddhcpservicestocustomers,andwerenotusingdefault passwords. Figure'1.'Three'phases'of'SOHO'router'DNS'exploitation'via'CSRF'vulnerability.' However,thesedeviceswererunningaCirmwareversionvulnerabletotheCross-Site RequestForgery(CSRF)techniqueillustratedinFigure1.Additionally,atleastoneofthese Page 6of 14www.team-cymru.com

7 modelswasrunningaversionofzyxelzynoscirmwarerecentlyexposedashavinga seriousclawthatallowsattackerstodownloadthesavedconcigurationcile,andthusthe administrativecredentials,fromanunauthenticatedurlinthewebinterface. 4 AnalysisofthesemaliciousDNSserversrevealedawiderangeofcompromiseddevices, includingmodelsfromd-link,micronet,tenda,tp-link,andothers.wehavemadeefforts tocontactthesemanufacturers,andwelookforwardtocooperatingwiththemgoing forward.victimrouterswereobservedglobally,withthelargestinfectionsinvietnam,italy, Thailand,Indonesia,Colombia,Turkey,Ukraine,BosniaandHerzegovina,andSerbia. Thescaleofthiscampaignisquitelarge.Figure2showsthedistributionofvictimsby countryoveraone-weekperiod.over300,000uniqueipaddressesattempteddns requeststothetwoservers.thetwoserversinvolvedrespondedtoanyexternaldns requestandactedasopenresolvers. Figure'2.'Victims'are'spread'globally,'likely'in'proportion'to'quantities'of'vulnerable'devices' supplied'by'isps' Inourtests,theSOHOpharmingDNSserversappearedtoforwardourDNSrequestsonto legitimateauthoritativeservers.attemptstologintolocalbankingwebsitesinaffected countries,andtodownloadsoftwareupdatesfromadobeandothersallappearedto functionnormally,thoughmanyrequestsresolvednoticeablyslowlyorfailedtocomplete. WebsiteswetestedalsoappearedtodisplaynormaladvertisingusingtheseDNSservers. 4 Page 7of 14www.team-cymru.com

8 OuranalysisdidreveallinksbetweenthetwoSOHOpharmingDNSserversandvarietyof othersuspiciousdevices.whilethismaysimplyresultfrommalware-relateddnsactivity onvictimhostcomputers,orquestionablebrowsingactivitiesbyusersbehindvictimsoho devices,wecontinuetoinvestigatethebehaviorof and wehavealso informedlawenforcementaboutthecompromisedroutersbeingsettousetheseservers andreachedouttotheproviderinvolved,thoughnoresponsehasbeenreceivedthusfar. Figure'3.'A'sample'of'compromised'routers'linked'to'the'malicious'DNS'servers' mbank:'malicious'dns'redirection'coupled'with'social'engineering'attacks'' WhatkindsofattacksarepossibleonceaSOHOdevice sdnssettingshavebeenchanged? TheresearchersatNiebezpiecznik.plandCERTPolandrecentlyexposedahighlytargeted attack,usingdnsserversat: Page 8of 14www.team-cymru.com

9 Inthiscase,themaliciousDNSserverswereusedinasophisticatedtwo-stageattack againstcustomersofthepolishmbankandotherpolishretailbanks. 5TheCirststage involvedusingdnsredirectiontostealcredentialstoindividualaccounts.theattackers thenusedthesetologintovictimaccountsandusedsocially-engineeredsmsmessagesto thevictimtoinducethevictimtounknowinglyapproveatransferoffundsintothe attacker saccount. BetweenDecember2013andFebruary2014,weobservedapproximately80compromised routers.overhalfthevictimswereinpolandandmostothersinrussia,withsmall numbersinbelgium,china,italy,theuk,andtheu.s.whilewebelievetheactualnumberof compromisedroutersisverylikelyhigher,thesenumbersonlyreclectthedeviceswe identiciedascompromised. Figure'4.'The'DNS'servers'used'in'the'mBank'fraud'had'a'small'number'of'victims,' concentrated'in'poland'and'russia.' Same'Techniques,'Different'Tradecraft' WhiletheseattacksbothalteredtheDNSserverIPaddressesusedbyvictimrouters,subtle differencesinthetradecraftemployedmakesitlikelythatweareobservingeitherseparate campaignsbythesamegroup,ormultipleactorsutilizingthesametechniquefordifferent purposes. 5 podatnych-na-ten-atak/ Page 9of 14www.team-cymru.com

10 InthecaseoftheattacksagainstPolishbankingcustomers,theattackerswhoused maliciousdnsservers and appearedtotargetasmallpoolof usersinamoreconcentratedgeographicareaandspecicicallyfocusonconnectionsto Polishbankingwebsites.ResearchbyCERTPolandshowedthatcustomersofCivePolish retailbankswerelikelytargeted. 6 TheseattackersappearedtohaveconCiguredtheirmaliciousDNSserverstopassnonbankingDNSrequestssolelytoOpenDNS sserversforlegitimateresolution. Incontrast,theattackerssettingdevicestotheIPs and had compromisedaverylargepoolofdevices,andcontrolledlargeblocksofdeviceswithin specicicisps,wherethehomogeneityofsohoroutermodels,concigurations,andcirmware versionslikelyallowedtheattacktoscaleeasily.thescaleofthisattacksuggestsamore traditionalcriminalintent,suchassearchresultredirection,replacingadvertisements,or installingdrive-bydownloads;allactivitiesthatneedtobedoneonalargescalefor procitability.themoremanually-intensivebankaccounttransfersseeninpolandwouldbe difciculttoconductagainstsuchalargeandgeographically-disparatevictimgroup. The and serversalsobehaveddifferentlyinthewaytheyresolved DNSqueries.WhilethemaliciousserversusedinthePolishbankingattackfunneledtrafCic toopendnsforresolution,theseserverssentrequestsouttotheauthoritativeserversfor thedomainsqueriedandthuscommunicatedwithafarlargernumberofnameservers. Atleastoneinstancehasbeenreportedwherecrossoveroccurredbetweenthesetwo groupsofipaddresses,withonedevicelistingprimaryandsecondaryresolversas and ,andsomehavesuggestedthatthisindicatestheworkofa singleactor. 7Wewereunabletodeterminewhetherthiswasactualevidenceofoverlap betweendifferentcampaigns,whetheroneactorisbehindallciveips,orwhetherone campaignmayhaveaddedanewdnsiptoarouterpreviouslycompromisedbyanother campaign.however,giventhedifferencesoutlinedabove,webelievethattheseareseparate campaigns. UnlikeearlierDNS-changingSOHOcampaigns,theattacksweobservedchangedboth primaryandsecondarydnsaddressestothe and addresses mentionedearlier. 8ThisrisksalossofservicetoISPcustomersshouldthisDNS infrastructurebeshutdowninthefuture.duringouranalysiswealsoidenticiedthatthese DNSserversonlyrespondedintermittently,likelycausingproblemstoaffectedusers Seehttp://security.stackexchange.com/questions/46966/dsl-modem-compromised,hxxp://in.answers.yahoo.com/ question/index?qid= aajri7v, and hxxp://sokosensei.wordpress.com/2014/02/06/massive-attack-onpolish-wi-fi-routers-pharming/#more routers-2/ Page 10of 14www.team-cymru.com

11 How'is'it'Done?' BecauseoftheubiquityoffactorydefaultsettingsonSOHOdevices,somearevulnerableto simplepasswordguessing.weobservedmanyofthedevicescommunicatingwiththe suspiciousdnsservershadgraphicaluserinterfacesthatwasaccessiblefromtheinternet, andthusvulnerabletosimplebruteforcelog-onattempts.aconsiderablenumberofthe remotelyaccessibledevicesalsoappearedvulnerabletothe ROM-0 vulnerability publishedinearlyjanuary. 9ThisvulnerabilityinZyXEL szynosallowsattackersto downloadtherouter sconcigurationcilefromtheunauthenticatedguiurlhttp://[ip address]/rom-0.whiletheresultingrom-0cilestillhastobedecompressed,thisprocessis trivialwithavailabletools,andautomatedattackscriptsareavailableonlinewhich explicitlycallouttheabilitytochangednssettings. 10 InthecaseoftheTP-Linkdeviceswestartedwith,thesewerenotusingdefaultpasswords, andwhilesomemodelswererunningavulnerableversionofzynos,somevictimswere likelycompromisedbeforetherom-0techniquewaspublished.itiscertainlypossiblethat morethanonepartycouldhavediscoveredtherom-0technique,andwasexploitingthis vulnerabilitybeforeitbecamepublic.anotherpossibilityisthatthesedeviceswere compromisedusingapubliclyknowncross-siterequestforgery(csrf)technique. 11 This techniquewouldenableattackerstoinjectanullpasswordinthedevice swebinterface.in ourexamples,itworkedagainstcirmwareversion3.0.0build120531forthetp-link TD-8840t,oneofourinitialvictimsystems. URLused:http:// /Forms/tools_admin_1 ACSRFattackpublishedonthe30 th ofoctober2013appearedtoleveragestoredtp-link routerlogincredentialsinthebrowsertochangeroutersdnssettings. 12Devices vulnerabletothistechniqueincludedtp-linkwr1043nd,tl-mr3020,andtl-wdr3600. TheTP-LINKCSRFURLreportedinOctober2013showedtheinsertionofnewDNSIPs: dhcpserver=1&ip1=$localip_start_range&ip2= $LOCALIP_END_RANGE&Lease=120&gateway= &domain=&dnsserver= $DNSIP&dnsserver2=$DNSIP2&Save= PreviousSOHOmodelshavebeenvulnerabletoCSRFtechniquesthatallowedwireless WPA/WPA2passwordstobechanged,alongwithothermaliciouschanges.Webelievethat acombinationofthesetechniqueswouldallowanattackertogaincontrolofthedeviceand changethednsconcigurationremotely https://github.com/MrNasro/zynos-attacker 11 See and <img src="http:// /forms/tools_admin_1"/> 12 Page 11of 14www.team-cymru.com

12 Mitigation'Strategies Organizationsconcernedthattheircustomersandexternalpartnerscouldbevictimsof thistypeofattackshouldurgethemtoreviewtheirlocalroutersettingsandsecurity policiesandcontacttheirupstreamserviceproviderforassistanceifnecessary.soho devicesshouldhaveremoteuser-modeadministrationfeaturesandguisdisabledor,ata minimum,restrictedthroughaclstoonlythoseipsrequiredforregularadministration. ManagementinterfacesopentotheInternetcreateaneasilydetectableandexploitable vulnerabilityandshouldbedisabledimmediatelyiffound. CommandlineconCigurationofdevices,wherepossible,ispreferredtowebGUIinterface methods,asmanyofthevulnerabilitiesreportedinvolvecsrfattacksagainstuserslogged intotheconcigurationgui.administratorsshouldalsoensuredevicecirmwareiskeptupto date. Forlargercorporatenetworks,securityprofessionalscouldalsodeployHTMLcodetotheir externallyfacingserverstoattempttodetectremoteusers DNSsettings,andpotentially blockuserswithcompromiseddnssettings,byusingahtmltagwithauniquehostname thatlinksvisitors DNSrequeststotheirpagevisits.Notethatthiscouldaddunwanted overheadforlargeorganizations. Intheexampleabove,theuser sbrowserisforcedtodoadnsqueryforaunique hostname,linkingthednsservertoauniquehostnamelookup.theclientdoesahttpget requestonthis unique_string_detectdns.corporate-domain hostnameandcanthenbe identiciedasusingmaliciousdnssettings.thistypeofdnsdetectiondoeshaveits limitationshowever,asitdoesnotworkwhenmaliciousdnsserversforwardtherequests tothird-partyserviceslikeopendns. Internaltocorporatenetworks,thesecompromisesareagoodreminderthatDNScanbe abusedformalwarecommandandcontrolanddataexciltrationaswellastheman-in-themiddletechniquesobservedhere.dnssettingsshouldbecorporatelycontrolledand potentiallysetatthehostlevelaspartofasecure,baselineconciguration.individualusers shouldnothavetheprivilegestochoosetheirowndnssettings. Finally,werecommendseverelyrestrictingormonitoringthedeploymentofSOHOWi-Fi devicesoncorporatenetworks,andsecurityauditsshouldincludeeffortstocindand removeunauthorizedwi-fiaccesspoints,aswellasscanningcorporatenetworksfor devicesrunningsohoserviceslikehomenetworkadministrationprotocol(hnap). 13 Forendusers,orthosewhouseaSOHOdeviceastheirlocalDNSserver,wesuggest reviewingthednssettingsoflocaldevices,andcheckingthattheipaddresseslisted belongstoyourisp snameservers.whilenotaffectedbythisattack,areviewofhost computerdnssettingsisalsorecommended.wheninquestion,dnssettingscanalwaysbe settousegoogle snameservers( and )orthoseofopendns( and ) Page of

13 Conclusion BycompromisingoneSOHOrouter,anattackercanredirecttrafCicforeverydeviceinthat network.asthecompromiseofmbankuseraccountsdemonstrates,securitydoesnotstop atthehostlevel,butextendstoalldevicesinthenetwork.asembeddedsystemsbeginto proliferateinbothcorporateandconsumernetworks,greaterattentionneedstobegiven towhatvulnerabilitiesthesedevicesintroduce.securityforthesedevicesistypicallya secondaryconcerntocostandusabilityandhastraditionallybeenoverlookedbyboth manufacturersandconsumers.aswesawinthe2012discoveryof4millioncompromised BrazilianSOHOdevices,thisisparticularlyproblematicwhenoutdatedhardwareisleftin placeorlacksongoingsupportorcirmwareupdates. 14 WiththereleaseoftheexploitcodefortheMoonwormavailableonline,andthemBank campaigngainingmoreattentioneveryday,weexpecttoseemoreandmoremalicious activitytargetingsohodevicesandotherembeddedsystems.whiletodatetheattackswe haveobservedhavebeenlimitedtochanginguser-accessiblesettings,moonshowsthatthe nextlikelystepwillbethedevelopmentoftoolstosubvertoroverwritedevicecirmware andgiveattackersbetterstealthandpersistenceonconsumerdevices. Ourresearchintothiscampaigndidnotuncovernew,unknownvulnerabilities. Indeed,someofthetechniquesandvulnerabilitiesweobservedhavebeenpublicfor welloverayear.however,westillreachedouttotheequipmentvendorsaffectedby thiscampaignfortheirfeedbackandadvice.wewillupdatethispaperwithany recommendationsandresponseswereceivefromthesevendors. WehavealsonotiCiedseverallawenforcementagenciesabouttheissuesdescribed inthispaper,andreachedouttotheownersofthe and ip addresses.ourcommunicationstotheownersofthesedevices,perhapsnot surprisingly,wentunanswered. Weareworkingtodevelopnewtechniquestodetectthesetypesofcampaignsinthewild, andwillcontinuetopopulatebothourno-costandcommercialtoolswiththisdata.for moreinformation,pleasevisit: TCConsole-Free:https://www.team-cymru.org/Services/TCConsole/ CSIRTAssistanceProgram-Free:https://www.team-cymru.org/Services/CAP/ ThreatIntelligenceFeeds:https://www.team-cymru.com/Services/Intel/ 14 Page 13of 14www.team-cymru.com

14 Notable SOHO Security Issues Sercomm)backdoor)affecting) multiple)vendors)revealed)by)eloi) Vanderbeken) ActionTec)routers)deployed)for) Verizon s)fios)service)found) vulnerable)to)cve>2013>0126) Code)published)for)ZynOS)ROM>0) exploit.) /DEV/TTYS0)publishes)D>Link) Joel s) Backdoor )user)agent)backdoor) Exploit)code)published)for)0>day) used)in)moon)worm.)sans)reports) that)moon)exploits)hnap)scanning) to)find)vulnerable)devices) 2013 Jan..Feb. Mar. Apr. May Jun. July Aug. Sept. Oct. Nov. Dec. Jan. Feb. Mar. Apr. Team)Cymru)uncovers)SOHO) Pharming)activity)with)over) Rapid7)reports)on)vulnerabilities)in) 300,000)active)victims)) Universal)Plug)and)Play)(UPnP))protocol) that)affects)millions)of)devices) 2014 Carna)botnet)/) Internet)Census)2012 ) reveals)extent)of)insecure)soho)devices) and)potential)for)abuse) CVE>2013>3098)CSRF)vulnerability) reported)to)affect)trendnet)routers)) CERT)Poland)reports)campaign) targeting)banking)customers) Page14of14www.team.cymru.com


HOSPIRA (HSP US) HISTORICAL COMMON STOCK PRICE INFORMATION 30-Apr-2004 28.35 29.00 28.20 28.46 28.55 03-May-2004 28.50 28.70 26.80 27.04 27.21 04-May-2004 26.90 26.99 26.00 26.00 26.38 05-May-2004 26.05 26.69 26.00 26.35 26.34 06-May-2004 26.31 26.35 26.05 26.26

More information

Median and Average Sales Prices of New Homes Sold in United States

Median and Average Sales Prices of New Homes Sold in United States Jan 1963 $17,200 (NA) Feb 1963 $17,700 (NA) Mar 1963 $18,200 (NA) Apr 1963 $18,200 (NA) May 1963 $17,500 (NA) Jun 1963 $18,000 (NA) Jul 1963 $18,400 (NA) Aug 1963 $17,800 (NA) Sep 1963 $17,900 (NA) Oct

More information


THE UNIVERSITY OF BOLTON JANUARY Jan 1 6.44 8.24 12.23 2.17 4.06 5.46 Jan 2 6.44 8.24 12.24 2.20 4.07 5.47 Jan 3 6.44 8.24 12.24 2.21 4.08 5.48 Jan 4 6.44 8.24 12.25 2.22 4.09 5.49 Jan 5 6.43 8.23 12.25 2.24 4.10 5.50 Jan 6 6.43

More information

Analysis One Code Desc. Transaction Amount. Fiscal Period

Analysis One Code Desc. Transaction Amount. Fiscal Period Analysis One Code Desc Transaction Amount Fiscal Period 57.63 Oct-12 12.13 Oct-12-38.90 Oct-12-773.00 Oct-12-800.00 Oct-12-187.00 Oct-12-82.00 Oct-12-82.00 Oct-12-110.00 Oct-12-1115.25 Oct-12-71.00 Oct-12-41.00

More information

AT&T Global Network Client for Windows Product Support Matrix January 29, 2015

AT&T Global Network Client for Windows Product Support Matrix January 29, 2015 AT&T Global Network Client for Windows Product Support Matrix January 29, 2015 Product Support Matrix Following is the Product Support Matrix for the AT&T Global Network Client. See the AT&T Global Network

More information


NAV HISTORY OF DBH FIRST MUTUAL FUND (DBH1STMF) NAV HISTORY OF DBH FIRST MUTUAL FUND () Date NAV 11-Aug-16 10.68 8.66 0.38% -0.07% 0.45% 3.81% 04-Aug-16 10.64 8.66-0.19% 0.87% -1.05% 3.76% 28-Jul-16 10.66 8.59 0.00% -0.34% 0.34% 3.89% 21-Jul-16 10.66

More information



More information



More information

Case 2:08-cv-02463-ABC-E Document 1-4 Filed 04/15/2008 Page 1 of 138. Exhibit 8

Case 2:08-cv-02463-ABC-E Document 1-4 Filed 04/15/2008 Page 1 of 138. Exhibit 8 Case 2:08-cv-02463-ABC-E Document 1-4 Filed 04/15/2008 Page 1 of 138 Exhibit 8 Case 2:08-cv-02463-ABC-E Document 1-4 Filed 04/15/2008 Page 2 of 138 Domain Name: CELLULARVERISON.COM Updated Date: 12-dec-2007

More information


ANNEXURE 1 STATUS OF 518 DEMAT REQUESTS PENDING WITH NSDL ANNEXURE 1 STATUS OF 518 DEMAT REQUESTS PENDING WITH NSDL Sr. No. Demat Request No.(DRN) DP ID Client ID Date of Demat Request Received Quantity Requested Date of Demat Request Processed No. of days of

More information

Enhanced Vessel Traffic Management System Booking Slots Available and Vessels Booked per Day From 12-JAN-2016 To 30-JUN-2017

Enhanced Vessel Traffic Management System Booking Slots Available and Vessels Booked per Day From 12-JAN-2016 To 30-JUN-2017 From -JAN- To -JUN- -JAN- VIRP Page Period Period Period -JAN- 8 -JAN- 8 9 -JAN- 8 8 -JAN- -JAN- -JAN- 8-JAN- 9-JAN- -JAN- -JAN- -JAN- -JAN- -JAN- -JAN- -JAN- -JAN- 8-JAN- 9-JAN- -JAN- -JAN- -FEB- : days

More information

COE BIDDING RESULTS 2009 Category B Cars >1600 cc

COE BIDDING RESULTS 2009 Category B Cars >1600 cc Quota System A COE BIDDING RESULTS 2009 B Jan-2009 Quota 1,839 1,839 1,100 1,099 274 268 409 411 767 758 Successful bids 1,784 1,832 1,100 1,097 274 260 401 386 763 748 Bids received 2,541 2,109 1,332

More information

S&P Year Rolling Period Total Returns

S&P Year Rolling Period Total Returns S&P 500 10 Year Rolling Period Total Returns Summary: 1926 June 2013 700% 600% 500% 400% 300% 200% 100% 0% 100% Scatter chart of all 931 ten year periods. There were 931 ten year rolling periods from January

More information


CENTERPOINT ENERGY TEXARKANA SERVICE AREA GAS SUPPLY RATE (GSR) JULY 2015. Small Commercial Service (SCS-1) GSR JULY 2015 Area (RS-1) GSR GSR (LCS-1) Texarkana Incorporated July-15 $0.50690/Ccf $0.45450/Ccf $0.00000/Ccf $2.85090/MMBtu $17.52070/MMBtu Texarkana Unincorporated July-15 $0.56370/Ccf $0.26110/Ccf $1.66900/Ccf

More information

Ashley Institute of Training Schedule of VET Tuition Fees 2015

Ashley Institute of Training Schedule of VET Tuition Fees 2015 Ashley Institute of Training Schedule of VET Fees Year of Study Group ID:DECE15G1 Total Course Fees $ 12,000 29-Aug- 17-Oct- 50 14-Sep- 0.167 blended various $2,000 CHC02 Best practice 24-Oct- 12-Dec-

More information

Consumer ID Theft Total Costs

Consumer ID Theft Total Costs Billions Consumer and Business Identity Theft Statistics Business identity (ID) theft is a growing crime and is a growing concern for state filing offices. Similar to consumer ID theft, after initially

More information


BERACHAH CHURCH MEDIA CATALOG 2016 BERACHAH CHURCH MEDIA CATALOG 2016 MP3 AUDIO Please order by Series and number Limit: 2 discs per month Series #100 INVESTITURE SERVICE 1 1 28 Mar 2004 Series #101 MEMORIAL SERVICES 1 1 Col. Thieme 23

More information



More information

Breen Elementary School

Breen Elementary School Breen Elementary School Day: Monday Time: 1:40 pm to 3:10 pm (90 minutes) Session A Sept 21, Sept28, Oct 5, Oct 19, Oct 26, Nov 2 No class on Oct 12 Session B Nov 30, Dec 7, Dec 14, Jan 4, Jan 11, Jan

More information


CAFIS REPORT 2015.10 CAFIS REPORT 2015.10 INDEX Message CAFIS Inbound 03-06 07-08 CAFIS Arch 09-10 CAFIS Brain 11-12 CAFIS Global 13-14 What We Do 15-16 About CAFIS 17-18 Services for Member Stores 19-34 Services for Card

More information


ROYAL REHAB COLLEGE AND THE ENTOURAGE EDUCATION GROUP. UPDATED SCHEDULE OF VET UNITS OF STUDY AND VET TUITION FEES Course Aug 1/2015 UPDATED SCHEDULE OF UNITS OF STUDY AND TUITION FEES Course Aug 1/2015 Course Name: Delivery Mode: BSB50215 Diploma of Business Online DBTEU01 01/08/2015 19/08/2015 31/10/2015 0.25 $4245 $3265 DBTEU02 01/11/2015

More information

Choosing a Cell Phone Plan-Verizon

Choosing a Cell Phone Plan-Verizon Choosing a Cell Phone Plan-Verizon Investigating Linear Equations I n 2008, Verizon offered the following cell phone plans to consumers. (Source: www.verizon.com) Verizon: Nationwide Basic Monthly Anytime

More information

NTREIS MLS Area Housing Activity Report Compiled for North Texas Real Estate Information System. Current Month Summary for: July 2016

NTREIS MLS Area Housing Activity Report Compiled for North Texas Real Estate Information System. Current Month Summary for: July 2016 Use PDF Bookmarks for direct link to report tables. NTREIS MLS Area Housing Activity Report Compiled for North Texas Real Estate Information System Current Month Summary for: July 2016 Property Type Sales

More information

Computing & Telecommunications Services Monthly Report March 2015

Computing & Telecommunications Services Monthly Report March 2015 March 215 Monthly Report Computing & Telecommunications Services Monthly Report March 215 CaTS Help Desk (937) 775-4827 1-888-775-4827 25 Library Annex helpdesk@wright.edu www.wright.edu/cats/ Last Modified

More information

Deep Security/Intrusion Defense Firewall - IDS/IPS Coverage Statistics and Comparison

Deep Security/Intrusion Defense Firewall - IDS/IPS Coverage Statistics and Comparison Deep Security/Intrusion Defense Firewall - IDS/IPS Trend Micro, Incorporated A technical brief summarizing vulnerability coverage provided by Deep Security and Intrusion Defense Firewall. The document

More information

2015-16 BCOE Payroll Calendar. Monday Tuesday Wednesday Thursday Friday Jun 29 30 Jul 1 2 3. Full Force Calc

2015-16 BCOE Payroll Calendar. Monday Tuesday Wednesday Thursday Friday Jun 29 30 Jul 1 2 3. Full Force Calc July 2015 CM Period 1501075 July 2015 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 August 2015 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26

More information

Deep Security Intrusion Detection & Prevention (IDS/IPS) Coverage Statistics and Comparison

Deep Security Intrusion Detection & Prevention (IDS/IPS) Coverage Statistics and Comparison Deep Security Intrusion Detection & Prevention (IDS/IPS) Trend Micro, Incorporated A technical brief summarizing vulnerability coverage provided by Deep Security. The document also outlines a comparison

More information

US Inflation Rate Consumer Price Index

US Inflation Rate Consumer Price Index 1960 1962 1964 1966 1968 1970 1972 1974 1976 1978 1980 1982 1984 1986 1988 1990 1992 1994 1996 1998 2000 2002 2004 2006 2008 2010 2012 2014 US Inflation Rate Consumer Price Index 14.0% 13.0% 12.0% 11.0%

More information

Detailed guidance for employers

Detailed guidance for employers April 2015 3 Detailed guidance for employers Appendix A: Pay reference periods This document accompanies: Detailed guidance no. 3 Assessing the workforce Pay reference period calendars where the definition

More information

Academic Calendar 2015-2018 Arkansas State University - Jonesboro

Academic Calendar 2015-2018 Arkansas State University - Jonesboro Shared Governance Proposal Any constituent (individual or group) may submit a proposal into the shared governance process. In order to be considered, each proposal must contain the following and be directed

More information



More information

P/T 2B: 2 nd Half of Term (8 weeks) Start: 25-AUG-2014 End: 19-OCT-2014 Start: 20-OCT-2014 End: 14-DEC-2014

P/T 2B: 2 nd Half of Term (8 weeks) Start: 25-AUG-2014 End: 19-OCT-2014 Start: 20-OCT-2014 End: 14-DEC-2014 2014-2015 SPECIAL TERM ACADEMIC CALENDAR FOR SCRANTON EDUCATION ONLINE (SEOL), MBA ONLINE, HUMAN RESOURCES ONLINE, NURSE ANESTHESIA and ERP PROGRAMS SPECIAL FALL 2014 TERM Key: P/T = Part of Term P/T Description

More information

P/T 2B: 2 nd Half of Term (8 weeks) Start: 26-AUG-2013 End: 20-OCT-2013 Start: 21-OCT-2013 End: 15-DEC-2013

P/T 2B: 2 nd Half of Term (8 weeks) Start: 26-AUG-2013 End: 20-OCT-2013 Start: 21-OCT-2013 End: 15-DEC-2013 2013-2014 SPECIAL TERM ACADEMIC CALENDAR FOR SCRANTON EDUCATION ONLINE (SEOL), MBA ONLINE, HUMAN RESOURCES ONLINE, NURSE ANESTHESIA and ERP PROGRAMS SPECIAL FALL 2013 TERM Key: P/T = Part of Term P/T Description

More information

P/T 2B: 2 nd Half of Term (8 weeks) Start: 24-AUG-2015 End: 18-OCT-2015 Start: 19-OCT-2015 End: 13-DEC-2015

P/T 2B: 2 nd Half of Term (8 weeks) Start: 24-AUG-2015 End: 18-OCT-2015 Start: 19-OCT-2015 End: 13-DEC-2015 2015-2016 SPECIAL TERM ACADEMIC CALENDAR For Scranton Education Online (SEOL), Masters of Business Administration Online, Masters of Accountancy Online, Health Administration Online, Health Informatics

More information

2016 Examina on dates

2016 Examina on dates Please note the following informa on: The following exams are available throughout the year: Please click on the exam for which you wish to see the dates. When you have finished, you can select to return

More information

2015 Examination dates

2015 Examination dates Please note the following information: The following exams are available throughout the year: BULATS Paper-based: Please click on the exam for which you wish to see the dates. When you have finished, you

More information

Accident & Emergency Department Clinical Quality Indicators

Accident & Emergency Department Clinical Quality Indicators Overview This dashboard presents our performance in the new A&E clinical quality indicators. These 8 indicators will allow you to see the quality of care being delivered by our A&E department, and reflect

More information

Academic Calendars. Term I (20081) Term II (20082) Term III (20083) Weekend College. International Student Admission Deadlines

Academic Calendars. Term I (20081) Term II (20082) Term III (20083) Weekend College. International Student Admission Deadlines Academic Calendars Term I (20081) Term II (20082) Academic Calendars Term III (20083) Weekend College International Student Admission Deadlines Final Examination Schedule Broward Community College Catalog

More information

Supervisor Instructions for Approving Web Time Entry

Supervisor Instructions for Approving Web Time Entry Supervisor Instructions for Approving Web Time Entry Time Approval Deadlines by Category Local 2110 Members members submit time by NOON on Monday of the pay week. Time should be approved no later than

More information

Dragonfly: Energy Companies Under Sabotage Threat Symantec Security Response

Dragonfly: Energy Companies Under Sabotage Threat Symantec Security Response Dragonfly: Energy Companies Under Sabotage Threat Symantec Security Response Dragonfly: Western Energy Companies Under Sabotage Threat 1 What is Dragonfly? Ongoing cyberespionage campaign Targeting the

More information

Computer Software Bugs and Other IT Threats to Critical Infrastructure: A Preliminary Set of Considerations for IT Governance

Computer Software Bugs and Other IT Threats to Critical Infrastructure: A Preliminary Set of Considerations for IT Governance Computer Software Bugs and Other IT Threats to Critical Infrastructure: A Preliminary Set of Considerations for IT Governance Presentation for the Seventh European Academic Conference on Internal Audit

More information


Legislative Brief: PAY OR PLAY PENALTIES LOOK BACK MEASUREMENT METHOD EXAMPLES. EmPowerHR EmPowerHR Legislative Brief: PAY OR PLAY PENALTIES LOOK BACK MEASUREMENT METHOD EXAMPLES The Affordable Care Act (ACA) imposes a penalty on applicable large employers (ALEs) that do not offer health insurance

More information

Trimble Navigation Limited (NasdaqGS:TRMB) > Public Ownership > Officials' Trading

Trimble Navigation Limited (NasdaqGS:TRMB) > Public Ownership > Officials' Trading Trimble Navigation Limited (NasdaqGS:TRMB) > Public Ownership > Officials' Trading Individual Trades Holder Name Trade Date Range Transacted Shares Transaction Value (USD) Transaction Type Price Range

More information

NASDAQ DUBAI TRADING AND SETTLEMENT CALENDAR 2015. 1. On US Federal Reserve Holidays, no settlements will take place for USD.

NASDAQ DUBAI TRADING AND SETTLEMENT CALENDAR 2015. 1. On US Federal Reserve Holidays, no settlements will take place for USD. NASDAQ Dubai Circular No. : 65/14 Date of Issue : December 22 nd 2014 Date of Expiry : Upon issue of replacement Circular NASDAQ DUBAI TRADING AND SETTLEMENT CALENDAR 2015 Issued pursuant to the NASDAQ

More information

Important Dates Calendar 2014-2015 FALL

Important Dates Calendar 2014-2015 FALL Important Dates Calendar 204-205 FALL Rev. 6-8-4 st 8 H st 0 2nd 0 st 5 2nd 5 3rd 5 LSC Advanced Registration Begins May 27 May 27 May 27 May 27 May 27 May 27 May 27 May 27 May 27 Returning Students Advanced

More information

2013-2014. oct 03 / 2013 nov 12 / 2013. oct 05 / 2013. oct 07 / 2013. oct 21 / 2013. oct 24 / 2013. nov 07 / 2013 nov 14 / 2013.

2013-2014. oct 03 / 2013 nov 12 / 2013. oct 05 / 2013. oct 07 / 2013. oct 21 / 2013. oct 24 / 2013. nov 07 / 2013 nov 14 / 2013. 2013- ACADEMIC CALENDARS SOUTH UNIVERSITY 2013- ACADEMIC CALENDAR Fall 2013 Winter Spring Summer New Student Orientation Session II (Mid ) oct 03 / 2013 nov 12 / 2013 jan 09 / feb 18 / apr 03 / may 13

More information

Employers Compliance with the Health Insurance Act Annual Report 2015

Employers Compliance with the Health Insurance Act Annual Report 2015 Employers Compliance with the Health Insurance Act Annual Report 2015 ea Health Council Health Council: Employers Compliance with the Health Insurance Act 1970 Annual Report 2015 Contact us: If you would

More information

Proposal to Reduce Opening Hours at the Revenues & Benefits Coventry Call Centre

Proposal to Reduce Opening Hours at the Revenues & Benefits Coventry Call Centre Proposal to Reduce Opening Hours at the Revenues & Benefits Coventry Call Centre Proposal To change the opening hours of the Revenues & Benefits Call Centre to 9am until 5pm Monday to Friday with effect

More information

Multilateral and Regional Insitutions Risk Classifications of the Participants to the Arrangement on Officially Supported Export Credits

Multilateral and Regional Insitutions Risk Classifications of the Participants to the Arrangement on Officially Supported Export Credits 1 2 3 4 5 6 7 Name of 01-Jan-99 29-Jan-99 22-Jan-99 19-Mar-99 17-Jun-99 14-Oct-99 26-Mar-99 24-Jun-99 21-Oct-99 31-Jan-00 24-Jan-00 09-May-00 02-May-00 20-Jul-00 1 AfDB African Development Tunis, Tunisia

More information

1. Introduction. 2. User Instructions. 2.1 Set-up

1. Introduction. 2. User Instructions. 2.1 Set-up 1. Introduction The Lead Generation Plan & Budget Template allows the user to quickly generate a Lead Generation Plan and Budget. Up to 10 Lead Generation Categories, typically email, telemarketing, advertising,

More information

8 Jan : "

8 Jan : GRAPHIC EPHEMERIS (Data Sheets) for 12 months from January 2013 until December 2013 planets: H aspects: ASTRODIENST ZÜRICH Dammstr. 23, CH-8702 Zollikon Phone +41-1-392 1818 Fax 391 7574 Order 0.0-0 Page

More information


ACADEMIC CALENDAR 2016/2017 ACADEMIC CALENDAR 2016/2017 TRADITIONAL CALENDAR The academic calendar at Woodbury University includes three academic terms: Fall Semester, Spring Semester and Summer Session. 2016 2017 2017 Semester classes

More information

Department of Public Welfare (DPW)

Department of Public Welfare (DPW) Department of Public Welfare (DPW) Office of Income Maintenance Electronic Benefits Transfer Card Risk Management Report Out-of-State Residency Review FISCAL YEAR 2012-2013 June 2013 (March, April and

More information

There e really is No Place Like Rome to experience great Opera! Tel: 01213 573 866 to discuss your break to the Eternal City!

There e really is No Place Like Rome to experience great Opera! Tel: 01213 573 866 to discuss your break to the Eternal City! There e really is No Place Like Rome to experience great Opera! Tel: 01213 573 866 to discuss your break to the Eternal City! Date Fri Location 11 Sep 2015 Teatro dell'opera di Roma Opera Sat 12 Sep 2015

More information

Newfoundland and Labrador Hydro Electricity Rates

Newfoundland and Labrador Hydro Electricity Rates Newfoundland and Hydro Electricity Rates The following charts and descriptions outline: 1) residential rates by area 2) general service rates information including basic customer charges, energy charges,

More information

GRAPHIC EPHEMERIS (Data Sheets) for 12 months from January 2004 until December 2004

GRAPHIC EPHEMERIS (Data Sheets) for 12 months from January 2004 until December 2004 GRAPHIC EPHEMERIS (Data Sheets) for 12 months from January 2004 until December 2004 planets: H aspects: ASTRODIENST ZÜRICH Dammstr. 23, CH-8702 Zollikon Phone +41-1-392 1818 Fax 391 7574 Order 0.0-0 Page

More information

9 Jan : " 9 Jan : " 9 Jan : " 9 Jan : "

9 Jan :  9 Jan :  9 Jan :  9 Jan : GRAPHIC EPHEMERIS (Data Sheets) for 12 months from January 2008 until December 2008 planets: H aspects: ASTRODIENST ZÜRICH Dammstr. 23, CH-8702 Zollikon Phone +41-1-392 1818 Fax 391 7574 Order 0.0-0 Page

More information

ACCESS Nursing Programs Session 1 Center Valley Campus Only 8 Weeks Academic Calendar 8 Weeks

ACCESS Nursing Programs Session 1 Center Valley Campus Only 8 Weeks Academic Calendar 8 Weeks Session 1 Academic Calendar August 24, 2015 to October 17, 2015 Tuesday / Thursday, 5:30 pm to 8:30 pm M/W T/TH T/W TH S Saturday lab as scheduled Classes Begin 24-Aug 25-Aug 25-Aug 27-Aug 29-Aug NU205

More information

ACCESS Nursing Programs Session 1 Center Valley Campus Only 8 Weeks Academic Calendar 8 Weeks

ACCESS Nursing Programs Session 1 Center Valley Campus Only 8 Weeks Academic Calendar 8 Weeks Session 1 Academic Calendar August 24, 2015 to October 17, 2015 Tuesday / Thursday, 5:30 pm to 8:30 pm M/W T/TH T/W TH S Saturday lab as scheduled Classes Begin 24-Aug 25-Aug 25-Aug 27-Aug 29-Aug NU205

More information


MONTHLY REMINDERS FOR 2013 MONTHLY REMINDERS FOR 2013 Legend: Red IRS Due Dates Green Department of Revenue Due Dates Blue Parish Finance Due Dates Black Second Collections JANUARY 4 Deposit payroll tax for payments on Jan 1 if

More information


UPCOMING PROGRAMMES/COURSES APRIL, 2014 MARCH, 2015 (MIND KINGSTON & MANDEVILLE CAMPUSES) UPCOMING PROGRAMMES/ IL, CH, 2 UPCOMING PROGRAMMES/ IL, CH, Table of Contents Programme/Course Awards Page(s) Certificates Secretarial Qualifying Examination 5 Minute Writing 5 Public Speaking & Presentation

More information

Daily Readings from the Old & New Testament's

Daily Readings from the Old & New Testament's Feb 1: Ex 27-28; Matt 21:1-22 Feb 2: Ex 29-30; Matt 21:23-46 Feb 3: Ex 31-33; Matt 22: 1-22 Feb 4: Ex 34-35; Matt 22:23-46 Feb 5: Ex 36-38; Matt 23:1-22 Feb 6: Ex 39-40; Matt 23:23-39 Feb 7: Lev 1-3; Matt

More information

FY 2015 Schedule at a Glance

FY 2015 Schedule at a Glance Coaching and Mentoring for Excellence Oct 21 23, 2014 $2,950 Residential Coaching and Mentoring for Excellence Apr 7 9, 2015 $2,400 Non-residential Coaching and Mentoring for Excellence May 27 29, 2015

More information

Independent Accountants Report on Applying Agreed-Upon Procedures

Independent Accountants Report on Applying Agreed-Upon Procedures Independent Accountants Report on Applying Agreed-Upon Procedures Board of Trustees We have performed the procedures, as discussed below, with respect to the employer contributions remitted by to the in

More information

Media Planning. Marketing Communications 2002

Media Planning. Marketing Communications 2002 Media Planning Marketing Communications 2002 Media Terminology Media Planning - A series of decisions involving the delivery of messages to audiences. Media Objectives - Goals to be attained by the media

More information

Marsha Ingram, Head of Corporate Affairs

Marsha Ingram, Head of Corporate Affairs Date of Board meeting: 26 th November 2008 Subject: Annual Cycle of Board Business Trust Board lead: Marsha Ingram, Head of Corporate Affairs Presented by: Marsha Ingram, Head of Corporate Affairs Aim

More information

2015 Ohio MemberSource Newsletter Targeted Production Schedule (Laura Huff/Courtney Stewart)

2015 Ohio MemberSource Newsletter Targeted Production Schedule (Laura Huff/Courtney Stewart) 2015 Ohio MemberSource Newsletter (Laura Huff/Courtney Stewart) 2015 Newsletter Production Schedule 1st Quarter (Spring) Dec. 1, 2014 Dec. 5, 2014 Dec. 17, 2014 Dec. 26, 2014 Jan. 23 Jan. 30 Feb. 20 March

More information


FOR RELEASE: THURSDAY, SEPTEMBER 13 AT 4 PM Interviews with 1,022 adult Americans conducted by telephone by ORC International on September 7-9, 2012. The margin of sampling error for results based on the total sample is plus or minus 3 percentage

More information

Human Resources Management System Pay Entry Calendar

Human Resources Management System Pay Entry Calendar Human Resources Management System Pay Entry Calendar http://www1.umn.edu/ohr/payroll/calendars/index.html Important Information The system is unavailable for entry, due to maintenance, during the following

More information


COURSE INFORMATION TRAINING COSTS. OHS Timetable 2-Day Class Format INFORMATION Our basic OHS-Standard First Aid/CPR-A course runs a minimum of 16 hours in length, with one hour for lunch and two fifteen-minute breaks throughout the day. All St. John Ambulance courses

More information

Schedule of VET FEE-HELP Tuition Fees & Census Dates

Schedule of VET FEE-HELP Tuition Fees & Census Dates Delivery Location Diploma of Beauty Therapy SIB50110 Face to face 87 Bay Street Glebe NSW 2037 Qualification articulates to Bachelor of Applied Health Science (Clinical Aesthetics) delivered by MHM Higher

More information



More information

Insurance and Banking Subcommittee

Insurance and Banking Subcommittee Insurance and Banking Subcommittee Citizens Depopulation Update September 16, 2015 Christine Ashburn VP Communications, Legislative and External Affairs 2 3 Depopulation Customer Communications 1. 40 days

More information

The Impact of Medicare Part D on the Percent Gross Margin Earned by Texas Independent Pharmacies for Dual Eligible Beneficiary Claims

The Impact of Medicare Part D on the Percent Gross Margin Earned by Texas Independent Pharmacies for Dual Eligible Beneficiary Claims The Impact of Medicare Part D on the Percent Gross Margin Earned by Texas Independent Pharmacies for Dual Eligible Beneficiary Claims Angela Winegar, M.S., Marvin Shepherd, Ph.D., Ken Lawson, Ph.D., and

More information

End of Life Content Report November 2014. Produced By The NHS Choices Reporting Team CH.NHSChoices-Reporting@nhs.net

End of Life Content Report November 2014. Produced By The NHS Choices Reporting Team CH.NHSChoices-Reporting@nhs.net End of Life Content Report November 2014 Produced By The NHS Choices Reporting Team CH.NHSChoices-Reporting@nhs.net End of Life Dashboard Page 1 Overall Choices Site Visits Tag cloud showing end of life

More information

South Dakota Board of Regents. Web Time Entry. Student. Training Manual & User s Guide

South Dakota Board of Regents. Web Time Entry. Student. Training Manual & User s Guide South Dakota Board of Regents Web Time Entry Student Training Manual & User s Guide Web Time Entry Self Service Web Time Entry is a web-based time entry system designed to improve accuracy and eliminate

More information

School Improvement Plan Template for Advanc ED Goals Management

School Improvement Plan Template for Advanc ED Goals Management School: Principal: Date Plan Completed: School Improvement External Monitor(s): Alignment with 3 5 Year District Strategic Goals: Briefly describe how this student outcome aligns with specific strategic

More information


EMAIL ACCOUNT TAKEOVER TO IDENTITY TAKEOVER EMAIL ACCOUNT TAKEOVER TO IDENTITY TAKEOVER March 2013 Phishing attacks are notorious for their potential harm to online banking and credit card users who may fall prey to phishers looking to steal information

More information

DCF - CJTS WC Claim Count ACCT DCF CJTS - Restraints InjuryLocation (All)

DCF - CJTS WC Claim Count ACCT DCF CJTS - Restraints InjuryLocation (All) - CJTS WC Claim Count ACCT CJTS - Restraints InjuryLocation (All) Month Occur Mo Txt Loc Descr 2011 2012 2013 2014 2015 Grand Total 1 Jul CJTS Custody 8 12 5 8 11 44 2 CJTS Girls Unit 4 4 Jul Total 9 12

More information

Comparing share-price performance of a stock

Comparing share-price performance of a stock Comparing share-price performance of a stock A How-to write-up by Pamela Peterson Drake Analysis of relative stock performance is challenging because stocks trade at different prices, indices are calculated

More information

Interest Rates. Countrywide Building Society. Savings Growth Data Sheet. Gross (% per annum)

Interest Rates. Countrywide Building Society. Savings Growth Data Sheet. Gross (% per annum) Interest Rates (% per annum) Countrywide Building Society This is the rate of simple interest earned in a year (before deducting tax). Dividing by 12 gives the monthly rate of interest. Annual Equivalent

More information

Oxfam GB Digital Case Study - email

Oxfam GB Digital Case Study - email Oxfam GB Digital Case Study - email Friday 19 th July Lizzie Williams Email Marketing Manager Holly Bolter Senior Analyst Mark Lumby Selections & Analysis Manager Emergencies Get Together Campaigns Regular

More information

Impacts of Government Jobs in Lake County Oregon

Impacts of Government Jobs in Lake County Oregon Impacts of Government Jobs in Lake County Oregon April 2011 Prepared by Betty Riley, Executive Director South Central Oregon Economic Development District Annual Average Pay Based on Oregon Labor Market

More information


PROJECTS SCHEDULING AND COST CONTROLS Professional Development Day September 27th, 2014 PROJECTS SCHEDULING AND COST CONTROLS Why do we need to Control Time and Cost? Plans are nothing; Planning is everything. Dwight D. Eisenhower Back to

More information

Aug. 26 Aug. 27 Aug. 28 Aug. 29 Aug. 30 Sept. 2

Aug. 26 Aug. 27 Aug. 28 Aug. 29 Aug. 30 Sept. 2 Western Carolina University 2013-2014 Academic Calendar FALL 2013-Final Aug 19 All classes Aug 20 Aug 21 Aug 22 Aug. 23 Aug. 26 Aug. 27 Aug. 28 Aug. 29 Aug. 30 Sept. 2 Sept. 3 Sept. 4 Sept. 5 Sept. 6 Labor

More information

Executive Summary. McAfee Labs Threats Report: Third Quarter 2013

Executive Summary. McAfee Labs Threats Report: Third Quarter 2013 Executive Summary McAfee Labs Threats Report: Third Quarter Although summer can be a relatively slow season for cybercriminal activity (even the bad guys need a break occasionally), the third quarter of

More information

2015 Settlement Calendar for ASX Cash Market Products ¹ Published by ASX Settlement Pty Limited A.B.N 49 008 504 532

2015 Settlement Calendar for ASX Cash Market Products ¹ Published by ASX Settlement Pty Limited A.B.N 49 008 504 532 2015 Calendar for ASX Cash Market Products ¹ Published by ASX Pty Limited A.B.N 49 008 504 532 Calendar for ASX Cash Market Products¹ ASX Pty Limited (ASX ) operates a trade date plus three Business (T+3)

More information

What does it take to deliver the most technologically advanced Games ever?

What does it take to deliver the most technologically advanced Games ever? What does it take to deliver the most technologically advanced Games ever? Enzo Sacco, Quang Tu October 20, 2015 Purpose of today s session To share our experiences and lessons learned in securing the

More information

Closing the Security Gaps: Baseline Configuration Management WHITEPAPER

Closing the Security Gaps: Baseline Configuration Management WHITEPAPER Closing the Security Gaps: Baseline Configuration Management WHITEPAPER Closing the Security Gaps: Baseline Configuration Management Introduction Baseline configuration management as a way to reduce or

More information

How Can Fleets Control Mounting Fuel Costs? Effective fuel management requires purchase controls and driver behavior modification.

How Can Fleets Control Mounting Fuel Costs? Effective fuel management requires purchase controls and driver behavior modification. How Can Fleets Control Mounting Fuel Costs? Effective fuel management requires purchase controls and driver behavior modification. How Can Fleets Control Mounting Fuel Costs? 2 Effective Fuel Management

More information



More information

Read the Bible in a Year

Read the Bible in a Year Read the Bible in a Year JANUARY Jan 1... Genesis 1-2... Psalms 1-2... Matthew 1-2 Jan 2... Genesis 3-4... Psalms 3-5... Matthew 3-4 Jan 3... Genesis 5-6... Psalms 6-8... Mtthew 5 Jan 4... Genesis 7-8...

More information


DNS POISONING, AKA PHARMING, MAKES THE HEADLINES IN NOVEMBER S NEWS DNS POISONING, AKA PHARMING, MAKES THE HEADLINES IN NOVEMBER S NEWS December 2011 November saw DNS Poisoning, aka Pharming, making the headlines on more than one occasion: To name a few, the online threat

More information

Easter Seals Central Texas Programs Outcome Profiles Monthly and Year to Date FY 2011 85% 87% 80% 80% 84% 84% 83%

Easter Seals Central Texas Programs Outcome Profiles Monthly and Year to Date FY 2011 85% 87% 80% 80% 84% 84% 83% I. Outcomes Indicators for individuals receiving services: (Service Delivery Effectiveness) 85% 87% 80% 80% 84% 84% 83% A. Access Sep 10 Oct 10 Nov 10 YTD Dec 10 Jan 11 Feb 11 YTD Mar 11 Apr 11 May 11

More information

Ratio(%) change 1 RELIANCE GROWTH FUND 31-Jan-13 Refer Note 1 Institutional. Equity

Ratio(%) change 1 RELIANCE GROWTH FUND 31-Jan-13 Refer Note 1 Institutional. Equity Sl. No. Scheme Name Plan Effective Type of Annual Recurring Expense Date of Scheme Ratio(%) change 1 RELIANCE GROWTH FUND 31-Jan-13 Refer Note 1 Institutional Institutional Plan Lower by RELIANCE GROWTH

More information

Sage ERP MAS 90, 200, 200 SQL, and Sage ERP MAS 500. Supported Versions

Sage ERP MAS 90, 200, 200 SQL, and Sage ERP MAS 500. Supported Versions Sage ERP MAS 90, 200, 200 SQL, and Sage ERP MAS 500 Supported Versions Current Document: 2012... Page 1 Earlier Documents: 2011... Page 2 2010... Page 3 2009... Page 4 2008... Page 5 Sage ERP MAS 90, 200,

More information

How to Construct a Seasonal Index

How to Construct a Seasonal Index How to Construct a Seasonal Index Methods of Constructing a Seasonal Index There are several ways to construct a seasonal index. The simplest is to produce a graph with the factor being studied (i.e.,

More information

Figure 24 Georgia s Children a Major Focus of Human Services. $20 M Georgia Vocational Rehab Agency $1.5 M Office of Residential Child Care

Figure 24 Georgia s Children a Major Focus of Human Services. $20 M Georgia Vocational Rehab Agency $1.5 M Office of Residential Child Care Human Services Overview Georgia s spending to help children, the poor and seniors is overseen by the state Department of Human Services. State funding for the agency is $486 million in 214, or about 3

More information

Resource Management Spreadsheet Capabilities. Stuart Dixon Resource Manager

Resource Management Spreadsheet Capabilities. Stuart Dixon Resource Manager Resource Management Spreadsheet Capabilities Stuart Dixon Resource Manager Purpose Single view of resource data Shows rolling demand vs supply for 14 months, 2 months back, current month, and 11 forward

More information

Business Plan Example. 31 July 2020

Business Plan Example. 31 July 2020 Business Plan Example 31 July Index 1. Business Overview 1.1Objectives 1.2Vision Mission and Values 1.3 Keys to Success 2. Business Management 3. Services 2.1 Company Summary 2.2 Company Ownership 2.3

More information