QuickTiter FeLV Core Antigen ELISA Kit (FeLV p27)

Save this PDF as:

Size: px
Start display at page:

Download "QuickTiter FeLV Core Antigen ELISA Kit (FeLV p27)"


1 Product Manual QuickTiter FeLV Core Antigen ELISA Kit (FeLV p27) Catalog Numbers VPK wells FOR RESEARCH USE ONLY Not for use in diagnostic procedures

2 Introduction Feline leukemia virus (FeLV) is a retrovirus or oncornavirus which infects cats. Infected cats can transmit FeLV through saliva, respiratory secretions, close contact, biting, and mother-to-kitten (before birth or during nursing). Some commonly displayed symptoms are fevers, poor appetite, weight loss, lethargy, and skin infections. However, the infection can lead to chronic conditions (anemia, infections) and development of malignant cancers of the lymph nodes and internal organs. Many commercial labs offer testing for FeLV. The preferred serology screening test is by ELISA, while confirmational testing is performed by IFA. Assays for the quantitative measurement of FeLV DNA have been developed, such as PCR-based nucleic acid amplification assays. However, these methods are not commonly available. Cell Biolabs QuickTiter FeLV Core Antigen ELISA Kit is an enzyme immunoassay developed for detection and quantitation of the FeLV core protein (p27). A mouse monoclonal antibody to FeLV p27 is coated onto strip wells of microtiter plate. The quantity of FeLV core antigen in the sample is determined by comparing its absorbance with that of known recombinant FeLV p27 core antigen standard curve. The kit has a detection sensitivity limit of 100 pg/ml FeLV p27. Each kit provides sufficient reagents to perform up to 96 assays including standard curve and FeLV samples. Related Products 1. VPK-108-F: QuickTiter Lentivirus Quantitation Kit (FIV p24 ELISA) 2. VPK-150: QuickTiter HBV Core Antigen ELISA Kit 3. VPK-151: QuickTiter HCV Core Antigen ELISA Kit 4. VPK-107: QuickTiter Lentivirus Titer Kit (Lentivirus-Associated HIV p24) 5. VPK-108-H: QuickTiter Lentivirus Quantitation Kit (HIV p24 ELISA) 6. VPK-112: QuickTiter Lentivirus Quantitation Kit Assay Principle An anti-felv p27 monoclonal coating antibody is adsorbed onto a microtiter plate. FeLV core antigen (p27) present in the sample or standard binds to the antibodies adsorbed on the plate; a FITC-conjugated anti-felv p27 polyclonal antibody is added and binds to the antigen captured by the first antibody. Following incubation and wash steps, a HRP-conjugated mouse anti-fitc antibody is added and binds to the FITC conjugated anti-felv p27 polyclonal. Following unbound HRP-conjugated mouse anti- FITC antibody is removed during a wash step, and substrate solution reactive with HRP is added to the wells. A colored product is formed in proportion to the amount of FeLV core antigen present in the sample. The reaction is terminated by addition of acid and absorbance is measured at 450 nm. A standard curve is prepared from recombinant FeLV p27 core antigen and sample concentration is then determined. 2

3 Kit Components Anti-FeLV p27 Antibody Coated Plate (Part No ): One strip well 96-well plate. FITC-Conjugated Anti-FeLV p27 Polyclonal Antibody (Part No ): One 20 µl vial. HRP-Conjugated Anti-FITC Monoclonal Antibody (Part No ): One 20 µl vial. Assay Diluent (Part No ): One 50 ml bottle. Triton X-100 Solution (Part No ): One 15 ml bottle containing 5% Triton X-100 in TBS. 10X Wash Buffer (Part No ): One 100 ml bottle. Substrate Solution (Part No ): One 12 ml amber bottle. Stop Solution (Part. No ): One 12 ml bottle. Recombinant FeLV p27 Standard (Part No ): One 20 µl vial of 1 mg/ml recombinant, FeLV Core Antigen in 6M GuHCl/PBS. Materials Not Supplied 1. FeLV Sample: purified virus or unpurified viral supernatant 2. Cell Culture Centrifuge µm filter µl to 1000 µl adjustable single channel micropipettes with disposable tips µl to 300 µl adjustable multichannel micropipette with disposable tips 6. Multichannel micropipette reservoir 7. Microplate reader capable of reading at 450 nm (620 nm as optional reference wave length) Storage Store kit components at 4ºC until their expiration dates. Preparation of Reagents 1X Wash Buffer: Dilute the 10X Wash Buffer Concentrate to 1X with deionized water. Stir to homogeneity. FITC-Conjugated Anti-FeLV p27 Polyclonal Antibody and HRP-Conjugated Anti-FITC Monoclonal Antibody: Immediately before use dilute the FITC-conjugated antibody 1:1000 and HRP-conjugated antibody 1:1000 with Assay Diluent. Do not store diluted solutions. 3

4 Safety Considerations Remember that your retroviral samples contain infectious viruses before inactivation; you must follow the recommended NIH guidelines for all materials containing infectious organisms. Preparation of Samples I. FeLV p27 Standard Curve 1. Prepare a dilution series of Recombinant FeLV p27 Standard in the concentration range of 25 ng/ml to ng/ml by diluting the stock solution in Assay Diluent (Table 1). Note: For dilution accuracy, it is recommended to predilute the FeLV p27 Standard (see Predilution Tube below) 1:100 before adjusting to the starting standard curve concentration of 25 ng/ml (Standard Tube 1). Standard Tubes FeLV p27 Standard (µl) Assay Diluent (µl) FeLV p27 Concentration Predilution Tube 2 of Stock Standard (at 1 mg/ml) µg/ml 1 2 of Predilution Tube ng/ml of Tube # ng/ml of Tube # ng/ml of Tube # ng/ml of Tube # /mL of Tube # ng/ml of Tube # ng/ml Table 1. Preparation of FeLV p27 Standard 2. Transfer 225µL of each dilution (Standard Tubes 1-8 only) to a microcentrifuge tube containing 25 µl of Triton X-100 Solution. Perform the assay as described in Assay Instructions. II. FeLV Sample Dilution and Inactivation 1. (Optional) Dilute FeLV samples in culture medium or assay diluent. Include culture medium or assay diluent as a negative control. 2. Transfer 225 µl of each sample to a microcentrifuge tube containing 25 µl of Triton X-100 Solution, Vortex well. 3. Incubate 30 minutes at 37ºC. Note: For samples that contain anti-felv p27 antibody, samples should be incubated at 56ºC for 30 min. 4

5 Assay Protocol 1. Prepare and mix all reagents thoroughly before use. 2. Each FeLV sample, FeLV p27 standard, blank, and control medium should be assayed in duplicate. 3. Add 100 µl of inactivated sample or FeLV p27 standard to Anti-FeLV p27 Antibody Coated Plate. 4. Cover with a plate cover and incubate at room temperature for 2 hours on an orbital shaker. 5. Remove plate cover and empty wells. Wash microwell strips 5 times with 250 µl 1X Wash Buffer per well with thorough aspiration between each wash. After the last wash, empty wells and tap microwell strips on absorbent pad or paper towel to remove excess 1X Wash Buffer. 6. Add 100 µl of the diluted FITC-Conjugated Anti-FeLV p27 Polyclonal Antibody to each well. 7. Cover with a plate cover and incubate at room temperature for 1 hour on an orbital shaker. 8. Remove plate cover and empty wells. Wash the strip wells 5 times according to step 5 above. 9. Add 100 µl of the diluted HRP-Conjugated Anti-FITC Monoclonal Antibody to all wells. 10. Cover with a plate cover and incubate at room temperature for 1 hour on an orbital shaker. 11. Remove plate cover and empty wells. Wash microwell strips 5 times according to step 5 above. Proceed immediately to the next step. 12. Warm Substrate Solution to room temperature. Add 100 µl of Substrate Solution to each well, including the blank wells. Incubate at room temperature on an orbital shaker. Actual incubation time may vary from 5-20 minutes. Note: Watch plate carefully; if color changes rapidly, the reaction may need to be stopped sooner to prevent saturation. 13. Stop the enzyme reaction by adding 100 µl of Stop Solution into each well, including the blank wells. Results should be read immediately (color will fade over time). 14. Read absorbance of each microwell on a spectrophotometer using 450 nm as the primary wave length. 5

6 Example of Results The following figures demonstrate typical FeLV Core Antigen ELISA results. One should use the data below for reference only. This data should not be used to interpret actual results. Figure 1: FeLV Core Antigen ELISA Standard Curve Figure 2: Purification of Recombinant FeLV p27 Protein. Lane 1: MW STDs; Lane 2: E.Coli Whole Lysate (-IPTG); Lane 3: E.Coli Whole Lysate (+IPTG); Lane 4: Crude Lysate; Lane 5: Lysate after Ni-NTA beads; Lane 6-11: Elution Fractions. Fractions from Lane 9 and 10 were pooled as Recombinant FeLV p27 Standard. 6

7 Appendix Recombinant FeLV p27 Sequence: FeLV p27 is underlined. MASMTGGQQMGRGSPLREGPNNRPQYWPFSASDLYNWKSHNPPFSQDPVALTNLIESILVTH QPTWDDCQQLLQALLTGEERQRVLLEARKQVPGEDGRPTQLPNVIDETFPLTRPNWDFATPA GREHLRLYRQLLLAGLRGAARRPTNLAQVKQVVQGKEETPAAFLERLKEAYRMYTPYDPED PGQAASVILSFIYQSSPDIRNKLQRLEGLQGFTLSDLLKEAEKIYNKRETPEEREERLWQRQEER DKKRHKEMTKVLLEHHHHHH- References 1. Rezanka LJ, Rojko JL, Neil JC (1992). Cancer Investig.10: Rojko JL, Kociba GJ (1991) J. Am. Vet. Med. Assoc.199: Neil JC, Fulton R, Rigby M, Stewart M (1991). Curr Topics Microbiol Immunol 171: Weiss AT, Klopfleisch R, Gruber AD. (2010). J Feline Med Surg 12: Warranty These products are warranted to perform as described in their labeling and in Cell Biolabs literature when used in accordance with their instructions. THERE ARE NO WARRANTIES THAT EXTEND BEYOND THIS EXPRESSED WARRANTY AND CELL BIOLABS DISCLAIMS ANY IMPLIED WARRANTY OF MERCHANTABILITY OR WARRANTY OF FITNESS FOR PARTICULAR PURPOSE. CELL BIOLABS s sole obligation and purchaser s exclusive remedy for breach of this warranty shall be, at the option of CELL BIOLABS, to repair or replace the products. In no event shall CELL BIOLABS be liable for any proximate, incidental or consequential damages in connection with the products. Contact Information Cell Biolabs, Inc Arjons Drive San Diego, CA Worldwide: USA Toll-Free: CBL : Cell Biolabs, Inc. - All rights reserved. No part of these works may be reproduced in any form without permissions in writing. 7

QuickTiter Hepatitis B Surface Antigen (HBsAg) ELISA Kit

QuickTiter Hepatitis B Surface Antigen (HBsAg) ELISA Kit Product Manual QuickTiter Hepatitis B Surface Antigen (HBsAg) ELISA Kit Catalog Numbers VPK-5004 VPK-5004-5 96 assays 5 x 96 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction

More information

OxiSelect Advanced Glycation End Product (AGE) Competitive ELISA Kit

OxiSelect Advanced Glycation End Product (AGE) Competitive ELISA Kit Product Manual OxiSelect Advanced Glycation End Product (AGE) Competitive ELISA Kit Catalog Number STA-817 STA-817-5 96 assays 5 x 96 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction

More information

Pure-IP Western Blot Detection Kit

Pure-IP Western Blot Detection Kit Product Manual Pure-IP Western Blot Detection Kit Catalog Number PRB-5002 20 blots FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction The technique of immunoprecipitation (IP) is used

More information

Mouse Insulin ELISA. For the quantitative determination of insulin in mouse serum and plasma

Mouse Insulin ELISA. For the quantitative determination of insulin in mouse serum and plasma Mouse Insulin ELISA For the quantitative determination of insulin in mouse serum and plasma Please read carefully due to Critical Changes, e.g., Calculation of Results. For Research Use Only. Not For Use

More information

Rat Creatine Kinase MB isoenzyme,ck-mb ELISA Kit

Rat Creatine Kinase MB isoenzyme,ck-mb ELISA Kit Rat Creatine Kinase MB isoenzyme,ck-mb ELISA Kit Catalog No: E0479r 96 Tests Operating instructions www.eiaab.com FOR RESEARCH USE ONLY; NOT FOR THERAPEUTIC OR DIAGNOSTIC APPLICATIONS! PLEASE READ THROUGH

More information

Human Free Testosterone(F-TESTO) ELISA Kit

Human Free Testosterone(F-TESTO) ELISA Kit Human Free Testosterone(F-TESTO) ELISA Kit Catalog Number. MBS700040 For the quantitative determination of human free testosterone(f-testo) concentrations in serum, plasma. This package insert must be

More information

Phosphate Assay Kit (Colorimetric)

Phosphate Assay Kit (Colorimetric) Product Manual Phosphate Assay Kit (Colorimetric) Catalog Number STA-685 1000 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Phosphorus exists as a soluble free phosphate

More information

CytoSelect 48-Well Cell Adhesion Assay (Fibronectin-Coated, Colorimetric Format)

CytoSelect 48-Well Cell Adhesion Assay (Fibronectin-Coated, Colorimetric Format) Product Manual CytoSelect 48-Well Cell Adhesion Assay (Fibronectin-Coated, Colorimetric Format) Catalog Number CBA-050 48 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction

More information

Mouse Testosterone ELISA

Mouse Testosterone ELISA KAMIYA BIOMEDICAL COMPANY Mouse Testosterone ELISA For the quantitative determination of mouse Testosterone in biological samples. Cat. No. KT-52637 For Research Use Only. Not for use in diagnostic procedures.

More information

Mouse Keyhole Limpet Hemocyanin antibody(igm) ELISA Kit

Mouse Keyhole Limpet Hemocyanin antibody(igm) ELISA Kit Mouse Keyhole Limpet Hemocyanin antibody(igm) ELISA Kit Catalog No. MBS702810 (96 tests) This immunoassay kit allows for the in vitro semi-quantitative determination of mouse KLH(IgM)antibody concentrations

More information

Mouse Creatine Kinase MB isoenzyme (CKMB) ELISA

Mouse Creatine Kinase MB isoenzyme (CKMB) ELISA KAMIYA BIOMEDICAL COMPANY Mouse Creatine Kinase MB isoenzyme (CKMB) ELISA For the quantitative determination of mouse CKMB in serum, plasma, cell culture fluid and other biological fluids Cat. No. KT-57681

More information

Inc. Wuhan. Quantity Pre-coated, ready to use 96-well strip plate 1 Plate sealer for 96 wells 4 Standard (liquid) 2

Inc. Wuhan. Quantity Pre-coated, ready to use 96-well strip plate 1 Plate sealer for 96 wells 4 Standard (liquid) 2 Uscn Life Science Inc. Wuhan Website: www.uscnk.com Phone: +86 27 84259552 Fax: +86 27 84259551 E-mail: uscnk@uscnk.com ELISA Kit for Human Prostaglandin E1(PG-E1) Instruction manual Cat. No.: E0904Hu

More information



More information

OxiSelect N ε -(carboxymethyl) lysine (CML) Competitive ELISA Kit

OxiSelect N ε -(carboxymethyl) lysine (CML) Competitive ELISA Kit NOTE: Revisions to Preparation of Reagents Product Manual OxiSelect N ε -(carboxymethyl) lysine (CML) Competitive ELISA Kit Catalog Number STA-816 STA-816-5 96 assays 5 x 96 assays FOR RESEARCH USE ONLY

More information

Epinephrine/Norepinephrine ELISA Kit

Epinephrine/Norepinephrine ELISA Kit Epinephrine/Norepinephrine ELISA Kit Catalog Number KA3767 96 assays Version: 01 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Principle of the Assay...

More information

Canine creatine kinase MB isoenzyme (CK-MB)ELISA Kit

Canine creatine kinase MB isoenzyme (CK-MB)ELISA Kit Canine creatine kinase MB isoenzyme (CK-MB)ELISA Kit Catalog No. CSB-E15852c (96T) This immunoassay kit allows for the in vitro quantitative determination of canine CK-MB concentrations in serum and plasma.

More information

Rat creatine kinase MM isoenzyme (CK-MM) ELISA Kit

Rat creatine kinase MM isoenzyme (CK-MM) ELISA Kit Rat creatine kinase MM isoenzyme (CK-MM) ELISA Kit Catalog Number. CSB-E14405r For the quantitative determination of rat creatine kinase MM isoenzyme (CK-MM) concentrations in serum, plasma, tissue homogenates.

More information

RayBio Human Fibronectin ELISA Kit

RayBio Human Fibronectin ELISA Kit RayBio Human Fibronectin ELISA Kit Catalog #: ELH-FN1 User Manual Last revised April 15, 2016 Caution: Extraordinarily useful information enclosed ISO 13485 Certified 3607 Parkway Lane, Suite 100 Norcross,

More information

Rat creatine kinase MM isoenzyme (CK-MM) ELISA Kit

Rat creatine kinase MM isoenzyme (CK-MM) ELISA Kit Rat creatine kinase MM isoenzyme (CK-MM) ELISA Kit Catalog Number. CSB-E14405r For the quantitative determination of rat creatine kinase MM isoenzyme (CK-MM) concentrations in serum, plasma and tissue

More information

Rapid GST Inclusion Body Solubilization and Renaturation Kit

Rapid GST Inclusion Body Solubilization and Renaturation Kit Product Manual Rapid GST Inclusion Body Solubilization and Renaturation Kit Catalog Number AKR-110 FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Bacteria are widely used for His

More information

IgM ELISA. For the quantitative determination of IgM in human serum and plasma. For Research Use Only. Not For Use In Diagnostic Procedures.

IgM ELISA. For the quantitative determination of IgM in human serum and plasma. For Research Use Only. Not For Use In Diagnostic Procedures. IgM ELISA For the quantitative determination of IgM in human serum and plasma For Research Use Only. Not For Use In Diagnostic Procedures. Please read carefully due to Critical Changes, e.g., Calibrator

More information

Mouse krebs von den lungen 6 (KL-6) ELISA

Mouse krebs von den lungen 6 (KL-6) ELISA KAMIYA BIOMEDICAL COMPANY Mouse krebs von den lungen 6 (KL-6) ELISA For the quantitative determination of mouse KL-6 in serum, plasma, cell culture supernatants, body fluid and tissue homogenate Cat. No.

More information

Mouse C-Peptide I EIA

Mouse C-Peptide I EIA KAMIYA BIOMEDICAL COMPANY Mouse C-Peptide I EIA For the quantitative determination of C-Peptide I in mouse plasma, serum and urine. Cat. No. KT-367 For Research Use Only. 1 Rev. 091207 PRODUCT INFORMATION

More information

Mouse glycated hemoglobin A1c(GHbA1c) ELISA Kit

Mouse glycated hemoglobin A1c(GHbA1c) ELISA Kit Mouse glycated hemoglobin A1c(GHbA1c) ELISA Kit Catalog Number. CSB-E08141m For the quantitative determination of mouse glycated hemoglobin A1c(GHbA1c) concentrations in lysate for RBC. This package insert

More information

Creatine Kinase (CK) Enzymatic Assay Kit Manual Catalog #: 3460-07

Creatine Kinase (CK) Enzymatic Assay Kit Manual Catalog #: 3460-07 Creatine Kinase (CK) Enzymatic Assay Kit Manual Catalog #: 3460-07 TABLE OF CONTENTS GENERAL INFORMATION... 2 Product Description... 2 Procedure Overview... 2 Kit Contents, Storage and Shelf Life... 3

More information

RayBio Human IGF-1 ELISA Kit

RayBio Human IGF-1 ELISA Kit RayBio Human IGF-1 ELISA Kit Catalog #: ELH-IGF1 User Manual Last revised April 15, 2016 Caution: Extraordinarily useful information enclosed ISO 13485 Certified 3607 Parkway Lane, Suite 100 Norcross,

More information

Anti-Treponema Syphilis IgM Cat # 1464Z

Anti-Treponema Syphilis IgM Cat # 1464Z DIAGNOSTIC AUTOMATION, INC. 23961 Craftsman Road, Suite E/F, Calabasas, CA 91302 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com See external

More information

Glucose Assay Kit (Colorimetric)

Glucose Assay Kit (Colorimetric) Product Manual Glucose Assay Kit (Colorimetric) Catalog Number STA-680 500 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Glucose is a sugar used as an important source

More information

The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of PST in mouse tissue homogenates and other biological fluids.

The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of PST in mouse tissue homogenates and other biological fluids. FOR IN VITRO AND RESEARCH USE ONLY NOT FOR USE IN CLINICAL DIAGNOSTIC PROCEDURES SEB268Mu 96 Tests Enzyme-linked Immunosorbent Assay Kit For Phenol Sulfotransferase (PST) Organism Species: Mus musculus

More information

Malondialdehyde (MDA) ELISA

Malondialdehyde (MDA) ELISA Malondialdehyde (MDA) ELISA For the quantitative determination of MDA in serum, plasma and other biological fluids Cat. No. KT-21493 For Research Use Only. Not for use in diagnostic procedures. Page 1

More information

CytoSelect Cell Viability and Cytotoxicity Assay Kit

CytoSelect Cell Viability and Cytotoxicity Assay Kit Product Manual CytoSelect Cell Viability and Cytotoxicity Assay Kit Catalog Number CBA-240 96 assays (96-well plate) FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction The measurement

More information

Mouse IgM ELISA. Cat. No. KT-407 K-ASSAY. For the quantitative determination of IgM in mouse biological samples. For Research Use Only. 1 Rev.

Mouse IgM ELISA. Cat. No. KT-407 K-ASSAY. For the quantitative determination of IgM in mouse biological samples. For Research Use Only. 1 Rev. K-ASSAY Mouse IgM ELISA For the quantitative determination of IgM in mouse biological samples Cat. No. KT-407 For Research Use Only. 1 Rev. 072309 K-ASSAY PRODUCT INFORMATION Mouse IgM ELISA Cat. No. KT-407

More information

LDL/VLDL and HDL Purification Kit (Ultracentrifugation Free)

LDL/VLDL and HDL Purification Kit (Ultracentrifugation Free) Product Manual LDL/VLDL and HDL Purification Kit (Ultracentrifugation Free) Catalog Number STA-608 10 preps FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Lipoproteins are submicroscopic

More information

Human glycated hemoglobin A1c (GHbA1c)ELISA Kit

Human glycated hemoglobin A1c (GHbA1c)ELISA Kit Human glycated hemoglobin A1c (GHbA1c)ELISA Kit Catalog No. CSB-E08139h (96T) This immunoassay kit allows for the in vitro quantitative determination of human GHbA1c concentrations in serum, plasma and

More information

Rat Creatine Kinase MB Isoenzyme (CKMB) ELISA

Rat Creatine Kinase MB Isoenzyme (CKMB) ELISA Rat Creatine Kinase MB Isoenzyme (CKMB) ELISA For the quantitative determination of rat CKMB in serum, plasma, tissue homogenates and other biological fluids. Cat. No. KT-12247 For Research Use Only. Not

More information

ELISA. Enzyme immunoassay for the qualitative and quantitative detection of IgM antibodies against. Hepatitis A-Virus.

ELISA. Enzyme immunoassay for the qualitative and quantitative detection of IgM antibodies against. Hepatitis A-Virus. This version US RUO E11 070212 Version 2 of IFU is to be used only for reference purposes. Contents especially technical, methodical and regulations data, may not be amended. Anti-HAV-IgM ELISA Enzyme

More information

Human TNF- Product # 453310

Human TNF- Product # 453310 PRODUCT INFORMATION AND MANUAL Enzyme-linked immunosorbent assay for quantitative detection of human TNF- For Research Use Only Not for diagnostic or therapeutic procedures. 96 Wells Human TNF- Product

More information

Anti-Treponema Syphilis IgM. Cat # 1464Z

Anti-Treponema Syphilis IgM. Cat # 1464Z DIAGNOSTIC AUTOMATION, INC. 23961 Craftsman Road, Suite D/E/F, Calabasas, CA 91302 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com See external

More information

CytoSelect 48-Well Cell Adhesion Assay (ECM Array, Fluorometric Format)

CytoSelect 48-Well Cell Adhesion Assay (ECM Array, Fluorometric Format) Product Manual CytoSelect 48-Well Cell Adhesion Assay (ECM Array, Fluorometric Format) Catalog Number CBA-071 CBA-071-5 48 assays 5 x 48 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures

More information

Human Inositol 1,4,5,-Trisphosphate (IP 3 )ELISA Kit

Human Inositol 1,4,5,-Trisphosphate (IP 3 )ELISA Kit Human Inositol 1,4,5,-Trisphosphate (IP 3 )ELISA Kit Catalog No. CSB-E12636h (96T) This immunoassay kit allows for the in vitro quantitative determination of human IP 3 concentrations in serum, plasma

More information

Reagents Quantity Reagents Quantity. Pre-coated, ready to use 96-well strip plate 1 Plate sealer for 96 wells 4. Standard 2 Standard Diluent 1 20mL

Reagents Quantity Reagents Quantity. Pre-coated, ready to use 96-well strip plate 1 Plate sealer for 96 wells 4. Standard 2 Standard Diluent 1 20mL FOR IN VITRO AND RESEARCH USE ONLY NOT FOR USE IN CLINICAL DIAGNOSTIC PROCEDURES CEA458Ge 96 Tests Enzyme-linked Immunosorbent Assay Kit For Testosterone (Testo) Organism Species: General Instruction manual

More information

ViraBind Lentivirus Purification Kit

ViraBind Lentivirus Purification Kit Product Manual ViraBind Lentivirus Purification Kit Catalog Number VPK-104 10 preps FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Lentivirus vectors based on the human immunodeficiency

More information

TECHNICAL BULLETIN. Angiotensin II EIA Kit for serum, plasma, culture supernatant, and cell lysates. Catalog Number RAB0010 Storage Temperature 20 C

TECHNICAL BULLETIN. Angiotensin II EIA Kit for serum, plasma, culture supernatant, and cell lysates. Catalog Number RAB0010 Storage Temperature 20 C Angiotensin II EIA Kit for serum, plasma, culture supernatant, and cell lysates Catalog Number RAB0010 Storage Temperature 20 C TECHNICAL BULLETIN Product Description The Angiotensin II Enzyme Immunoassay

More information

ELISA BIO 110 Lab 1. Immunity and Disease

ELISA BIO 110 Lab 1. Immunity and Disease ELISA BIO 110 Lab 1 Immunity and Disease Introduction The principal role of the mammalian immune response is to contain infectious disease agents. This response is mediated by several cellular and molecular

More information

Dog Insulin Like Growth Factor 1 (IGF1) ELISA

Dog Insulin Like Growth Factor 1 (IGF1) ELISA KAMIYA BIOMEDICAL COMPANY Dog Insulin Like Growth Factor 1 (IGF1) ELISA For the quantitative determination of dog IGF1 in serum, plasma and other biological fluids Cat. No. KT-18280 For Research Use Only.

More information

Bovine Vitamin B12 (VB12) ELISA Kit

Bovine Vitamin B12 (VB12) ELISA Kit Bovine Vitamin B12 (VB12) ELISA Kit Catalog Number. CSB-E14089B For the quantitative determination of endogenic bovine vitamin B12 (VB12) concentrations in serum, plasma, tissue homogenates. This package

More information

TECHNICAL BULLETIN. Glucagon EIA Kit for serum, plasma, culture supernatant, and cell lysates. Catalog Number RAB0202 Storage Temperature 20 C

TECHNICAL BULLETIN. Glucagon EIA Kit for serum, plasma, culture supernatant, and cell lysates. Catalog Number RAB0202 Storage Temperature 20 C Glucagon EIA Kit for serum, plasma, culture supernatant, and cell lysates Catalog Number RAB0202 Storage Temperature 20 C TECHNICAL BULLETIN Product Description The Glucagon Enzyme Immunoassay (EIA) Kit

More information

Lipid Extraction Kit (Chloroform Free), Trial Size

Lipid Extraction Kit (Chloroform Free), Trial Size Product Manual Lipid Extraction Kit (Chloroform Free), Trial Size Catalog Number STA-612-T 10 preps FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Lipids are a diverse group of

More information

Herpes Simplex Virus 1 IgG ELISA

Herpes Simplex Virus 1 IgG ELISA Herpes Simplex Virus 1 IgG ELISA For the qualitative and semiquantitative determination of IgG-class antibodies to Herpes Simplex Virus Type 1 in serum. For Research Use Only. Not For Use In Diagnostic

More information

Human IP-10 ELISA Kit, pink-one

Human IP-10 ELISA Kit, pink-one 1. Catalog No. K0331210P 2. Quantity 96 tests 3. Storage 4 C Human IP-10 ELISA Kit, pink-one 4. Description Human IP-10 ELISA kit contains all the necessary reagents required for performing quantitative

More information

Uric Acid/Uricase Assay Kit

Uric Acid/Uricase Assay Kit Product Manual Uric Acid/Uricase Assay Kit Catalog Number STA-375 400 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction For humans and higher primates, uric acid is the final

More information

Canine Creatine Kinase MM isoenzyme(ck-mm) ELISA. kit

Canine Creatine Kinase MM isoenzyme(ck-mm) ELISA. kit BlueGene Biotech. Tel: 0086-21-61471242 Fax: 0086-21-61471242 ext 806 E-mail: sales@bluegene.cc tech@bluegene.cc www.elisakit.cc www.bluegene.cc Canine Creatine Kinase MM isoenzyme(ck-mm) ELISA kit 96

More information

WHO Prequalification of Diagnostics Programme PUBLIC REPORT. Product: Genscreen ULTRA HIV Ag-Ab Number: PQDx 0096-031-00. Abstract

WHO Prequalification of Diagnostics Programme PUBLIC REPORT. Product: Genscreen ULTRA HIV Ag-Ab Number: PQDx 0096-031-00. Abstract WHO Prequalification of Diagnostics Programme PUBLIC REPORT Product: Genscreen ULTRA HIV Ag-Ab Number: PQDx 0096-031-00 Abstract Genscreen ULTRA HIV Ag-Ab with product codes 72386 and 72388, manufactured

More information

Canine inositol 1,4,5,-trisphosphate,IP3 ELISA Kit

Canine inositol 1,4,5,-trisphosphate,IP3 ELISA Kit Canine inositol 1,4,5,-trisphosphate,IP3 ELISA Kit Catalog No: E2037c 96 Tests Operating instruction www.eiaab.com FOR RESEARCH USE ONLY; NOT FOR THERAPEUTIC OR DIAGNOSTIC APPLICATIONS! PLEASE READ THROUGH

More information

Uscn Life Science Inc. Wuhan

Uscn Life Science Inc. Wuhan Uscn Life Science Inc. Wuhan Website: www.uscnk.com Phone: +86 27 84259552 Fax: +86 27 84259551 E-mail: uscnk@uscnk.com ELISA Kit for Human Creatine Kinase,Mitochondrial 1A (CKMT1A) Instruction manual

More information

C-Type Natriuretic Peptide-22 (CNP-22) (Human, Rat, Mouse)

C-Type Natriuretic Peptide-22 (CNP-22) (Human, Rat, Mouse) C-Type Natriuretic Peptide-22 (CNP-22) (Human, Rat, Mouse) Extraction Free EIA Kit Protocol (Cat. No.:EKE-012-03) (Range: 0-100ng/ml) PHOENIX PHARMACEUTICALS, INC. INTRODUCTION This Enzyme Immunoassay

More information


INSTRUCTION Probemaker INSTRUCTION Probemaker Instructions for Duolink In Situ Probemaker PLUS (Art. no. 92009-0020) and Duolink In Situ Probemaker MINUS (Art. no. 92010-0020) Table of content 1. Introduction 4 2. Applications

More information

Helicobacter pylori IgG ELISA Kit

Helicobacter pylori IgG ELISA Kit Helicobacter pylori IgG ELISA Kit Catalog Number KA0219 96 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle

More information

Affinity Chromatography

Affinity Chromatography PR100-02 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Affinity Chromatography Teacher s Guidebook (Cat. # BE-417) think proteins! think

More information

For the development of sandwich ELISAs to measure phosphorylated Epidermal Growth Factor Receptor (EGF R) in cell lysates.

For the development of sandwich ELISAs to measure phosphorylated Epidermal Growth Factor Receptor (EGF R) in cell lysates. DuoSet IC Human Phospho-EGF R Catalog Number DYC1095-2 Catalog Number DYC1095-5 For the development of sandwich ELISAs to measure phosphorylated Epidermal Growth Factor Receptor (EGF R) in cell lysates.

More information

IgE (Human) ELISA Kit

IgE (Human) ELISA Kit IgE (Human) ELISA Kit Catalog Number KA0216 96 assays Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle of the Assay...

More information

竞 争 性 分 析 Epitope Mapping 实 验 方 法

竞 争 性 分 析 Epitope Mapping 实 验 方 法 竞 争 性 分 析 Epitope Mapping 实 验 方 法 ABSTRACT The simplest way to determine whether two monoclonal antibodies bind to distinct sites on a protein antigen is to carry out a competition assay. The assay can

More information

> IGF-1 (human) Table of Contents. Catalog # 900-150 96 Well Enzyme Immunoassay Kit For use with human serum and plasma

> IGF-1 (human) Table of Contents. Catalog # 900-150 96 Well Enzyme Immunoassay Kit For use with human serum and plasma Neutralizing Reagent 2 is now colorless. > IGF-1 (human) Catalog # 900-150 96 Well Enzyme Immunoassay Kit For use with human serum and plasma All reagents should be stored at 4 C. Check our website for

More information


LAB 14 ENZYME LINKED IMMUNOSORBENT ASSAY (ELISA) STUDENT GUIDE LAB 14 ENZYME LINKED IMMUNOSORBENT ASSAY (ELISA) GOAL The goal of this laboratory lesson is to explain the concepts and technique of enzyme linked immunosorbent assay (ELISA). OBJECTIVES

More information

Helicobacter pylori IgG ELISA Kit

Helicobacter pylori IgG ELISA Kit Helicobacter pylori IgG ELISA Kit Catalog Number KA0220 96 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle

More information

Reagents Quantity Reagents Quantity. Pre-coated, ready to use 96-well strip plate 1 Plate sealer for 96 wells 4. Standard 2 Standard Diluent 1 20mL

Reagents Quantity Reagents Quantity. Pre-coated, ready to use 96-well strip plate 1 Plate sealer for 96 wells 4. Standard 2 Standard Diluent 1 20mL FOR IN VITRO AND RESEARCH USE ONLY NOT FOR USE IN CLINICAL DIAGNOSTIC PROCEDURES SEA479Ra 96 Tests Enzyme-linked Immunosorbent Assay Kit For Creatine Kinase MB Isoenzyme (CKMB) Organism Species: Rattus

More information

Insulin Rodent (Mouse/Rat) Chemiluminescence ELISA

Insulin Rodent (Mouse/Rat) Chemiluminescence ELISA Insulin Rodent (Mouse/Rat) Chemiluminescence ELISA For the quantitative determination of insulin in rodent serum and plasma. For Research use Only. Not For Use In Diagnostic Procedures. Catalog Number:

More information

RayBio Human IL-8 ELISA Kit

RayBio Human IL-8 ELISA Kit RayBio Human IL-8 ELISA Kit User Manual (for Cell Lysate and Tissue Lysate) (Revised Mar 1, 2012) RayBio Human IL-8 ELISA Kit Protocol (Cat#: ELH-IL8-001C) RayBiotech, Inc. We Provide You With Excellent

More information

CatCombi Research ELISA Kit

CatCombi Research ELISA Kit CatCombi Research ELISA Kit Cat. No.:DEIA2078 Pkg.Size:192T Intended use Enzyme Immunoassay for detection of Adrenaline ( Epinephrine ) and Noradrenaline ( Norepinephrine ). Flexible test system for various

More information

RealLine HCV PCR Qualitative - Uni-Format

RealLine HCV PCR Qualitative - Uni-Format Instructions for use PCR KIT FOR EXTRACTION OF RNA AND REAL TIME PCR DETECTION KIT FOR HEPATITIS C VIRUS RNA Research Use Only Qualitative Uni Format VBD0798 48 tests valid from: December 2013 Rev11122013

More information

Herpes-simplex virus-1 and/or -2 IgM ELISA Kit

Herpes-simplex virus-1 and/or -2 IgM ELISA Kit Herpes-simplex virus-1 and/or -2 IgM ELISA Kit Qualitative assays for anti-herpes simplex IgM antibodies For Research Use Only. Not for use in diagnostic procedures. Changes from previous version 04/18/02

More information

Mix-N-Go Protein A Assays

Mix-N-Go Protein A Assays Mix-N-Go Protein A Assays Immunoenzymetric Assays for the Measurement of Protein A Catalog # F600 and Catalog # F610 Intended Use These kits are intended for use in quantitating natural recombinant Protein

More information


Genomic DNA Extraction Kit INSTRUCTION MANUAL Genomic DNA Extraction Kit INSTRUCTION MANUAL Table of Contents Introduction 3 Kit Components 3 Storage Conditions 4 Recommended Equipment and Reagents 4 Introduction to the Protocol 4 General Overview

More information


BIOO LIFE SCIENCE PRODUCTS BIOO LIFE SCIENCE PRODUCTS FOR REFERENCE PURPOSES This manual is for Reference Purposes Only. DO NOT use this protocol to run your assays. Periodically, optimizations and revisions are made to the kit

More information

Human IGFBP-3 ELISA Kit (higfbp-3-elisa)

Human IGFBP-3 ELISA Kit (higfbp-3-elisa) Human IGFBP-3 ELISA Kit (higfbp-3-elisa) Cat. No. EK0386 96 Tests in 8 x 12 divisible strips Background Insulin-like growth factor-binding protein-3 (IGFBP-3) is a major determinant of circulating levels

More information

THE His Tag Antibody, mab, Mouse

THE His Tag Antibody, mab, Mouse THE His Tag Antibody, mab, Mouse Cat. No. A00186 Technical Manual No. TM0243 Update date 01052011 I Description.... 1 II Key Features. 2 III Storage 2 IV Applications.... 2 V Examples - ELISA..... 2 VI

More information

CytoSelect Cell Proliferation Assay Reagent (Fluorometric)

CytoSelect Cell Proliferation Assay Reagent (Fluorometric) Product Manual CytoSelect Cell Proliferation Assay Reagent (Fluorometric) Catalog Number CBA-250 10 ml (960 assays in 96-well plate format) FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction

More information

Reagents Quantity Reagents Quantity. Pre-coated, ready to use 96-well strip plate 1 Plate sealer for 96 wells 4. Standard 2 Standard Diluent 1 20mL

Reagents Quantity Reagents Quantity. Pre-coated, ready to use 96-well strip plate 1 Plate sealer for 96 wells 4. Standard 2 Standard Diluent 1 20mL FOR IN VITRO AND RESEARCH USE ONLY NOT FOR USE IN CLINICAL DIAGNOSTIC PROCEDURES CEC037Ge 96 Tests Enzyme-linked Immunosorbent Assay Kit For Inositol Triphosphate (IP3) Organism Species: General Instruction

More information

Calprotectin ELISA. Package Insert

Calprotectin ELISA. Package Insert Package Insert Calprotectin ELISA Catalog Number: CAL35-K01 (1 x 96 wells) For Research Use Only. Not for use in diagnostic procedures. v. 1.0 Eagle Biosciences, Inc. 20A Northwest Blvd., Suite 112, Nashua,

More information

Dengue IgM ELISA. For the quantitative determination of IgM-class antibodies to Dengue Virus in serum.

Dengue IgM ELISA. For the quantitative determination of IgM-class antibodies to Dengue Virus in serum. Dengue IgM ELISA For the quantitative determination of IgM-class antibodies to Dengue Virus in serum. For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 20-DEMHU-E01 Size: 96

More information

See external label 2 C-8 C Σ=96 tests Cat # 1503Z. MICROWELL ELISA H.Pylori IgG. Cat # 1503Z

See external label 2 C-8 C Σ=96 tests Cat # 1503Z. MICROWELL ELISA H.Pylori IgG. Cat # 1503Z DIAGNOSTIC AUTOMATION, INC. 23961 Craftsman Road, Suite E/F, Calabasas, CA 91302 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com NAME AND

More information

HBV Quantitative Real Time PCR Kit

HBV Quantitative Real Time PCR Kit Revision No.: ZJ0002 Issue Date: Aug 7 th, 2008 HBV Quantitative Real Time PCR Kit Cat. No.: HD-0002-01 For Use with LightCycler 1.0/LightCycler2.0/LightCycler480 (Roche) Real Time PCR Systems (Pls ignore

More information

Human Luteinizing Hormone (LH) Custom Kit

Human Luteinizing Hormone (LH) Custom Kit Human Luteinizing Hormone (LH) Custom Kit 18089-v2-2015Jan 1 MSD Toxicology Assays Human Luteinizing Hormone (LH) Custom Kit This package insert must be read in its entirety before using this product.

More information

Classic Immunoprecipitation

Classic Immunoprecipitation 292PR 01 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Classic Immunoprecipitation Utilizes Protein A/G Agarose for Antibody Binding (Cat.

More information


510(k) SUBSTANTIAL EQUIVALENCE DETERMINATION DECISION SUMMARY A. 510(k) Number: K092353 510(k) SUBSTANTIAL EQUIVALENCE DETERMINATION DECISION SUMMARY B. Purpose for Submission: This is a new 510k application for a new indication for the MONOLISA Anti-HAV IgM EIA

More information

Mouse Typer Sub-Isotyping Kit Instruction Manual

Mouse Typer Sub-Isotyping Kit Instruction Manual Mouse Typer Sub-Isotyping Kit Instruction Manual Protocol for Mouse Typer Sub-Isotyping Kit (Catalog Number 172-2051) and Mouse Typer Sub Isotyping Panel (Catalog Number 172-2055) For Technical Service

More information

Toxoplasma IgA. Cat # 1103-11

Toxoplasma IgA. Cat # 1103-11 DIAGNOSTIC AUTOMATION, INC. 23961 Craftsman Road, Suite D/E/F, Calabasas, CA 91302 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com See external

More information

ab185915 Protein Sumoylation Assay Ultra Kit

ab185915 Protein Sumoylation Assay Ultra Kit ab185915 Protein Sumoylation Assay Ultra Kit Instructions for Use For the measuring in vivo protein sumoylation in various samples This product is for research use only and is not intended for diagnostic

More information

TECHNICAL BULLETIN. Brain Natriuretic Peptide EIA Kit for serum, plasma, culture supernatant, and cell lysates

TECHNICAL BULLETIN. Brain Natriuretic Peptide EIA Kit for serum, plasma, culture supernatant, and cell lysates Brain Natriuretic Peptide EIA Kit for serum, plasma, culture supernatant, and cell lysates Catalog Number RAB0386 Storage Temperature 20 C TECHNICAL BULLETIN Product Description The Brain Natriuretic Peptide

More information

Toxoplasma gondii IgM ELISA Kit Protocol

Toxoplasma gondii IgM ELISA Kit Protocol Toxoplasma gondii IgM ELISA Kit Protocol (Cat. No.:EK-310-87) 330 Beach Road, Burlingame CA Tel: 650-558-8898 Fax: 650-558-1686 E-Mail: info@phoenixpeptide.com www.phoenixpeptide.com Toxoplasma IgM ELISA

More information

How Does a Doctor Test for AIDS?

How Does a Doctor Test for AIDS? Edvo-Kit #S-70 How Does a Doctor Test for AIDS? S-70 Experiment Objective: The Human Immunodefi ciency Virus (HIV) is an infectious agent that causes Acquired Immunodefi ciency Syndrome (AIDS) in humans.

More information

Rat Fibronectin ELISA Kit

Rat Fibronectin ELISA Kit AssayMax TM Rat Fibronectin ELISA Kit Assaypro LLC 3400 Harry S Truman Blvd St. Charles, MO 63301 T (636) 447-9175 F (636) 395-7419 www.assaypro.com For any questions regarding troubleshooting or performing

More information

Genolution Pharmaceuticals, Inc. Life Science and Molecular Diagnostic Products

Genolution Pharmaceuticals, Inc. Life Science and Molecular Diagnostic Products Genolution Pharmaceuticals, Inc. Revolution through genes, And Solution through genes. Life Science and Molecular Diagnostic Products www.genolution1.com TEL; 02-3010-8670, 8672 Geno-Serum Hepatitis B

More information

Immunoglobulin E (IgE) concentrations in Human. Immunoglobulin E (IgE) Human ELISA Kit

Immunoglobulin E (IgE) concentrations in Human. Immunoglobulin E (IgE) Human ELISA Kit ab108650 Immunoglobulin E (IgE) Human ELISA Kit Instructions for Use For the quantitative measurement of Immunoglobulin E (IgE) concentrations in Human serum. This product is for research use only and

More information

Mouse GLP-2 ELISA. For quantitative determination of mouse GLP-2 in serum or plasma samples.

Mouse GLP-2 ELISA. For quantitative determination of mouse GLP-2 in serum or plasma samples. Mouse GLP-2 ELISA For quantitative determination of mouse GLP-2 in serum or plasma samples. For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 48-GP2MS-E01 Size: 96 Wells Version:

More information

Measles (Rubeola) IgM ELISA Catalog No. CB40-101-325099 (96 Tests)

Measles (Rubeola) IgM ELISA Catalog No. CB40-101-325099 (96 Tests) For Research Use Only. Not for use in Diagnostic Procedures. INTENDED USE Measles test is an enzyme linked immunosorbent assay (ELISA) for the detection of IgG class antibodies to Measles (Rubeola) in

More information

RayBio Human VEGF ELISA Kit

RayBio Human VEGF ELISA Kit RayBio Human VEGF ELISA Kit User Manual (Revised Mar 1, 2012) RayBio Human VEGF ELISA Kit Protocol (Cat#: ELH-VEGF-001) RayBiotech, Inc. We Provide You With Excellent Protein Array System And Service Tel:(Toll

More information

Protein A Assay. Immunoenzymetric Assay for the Measurement of Protein A Catalog # F400. Intended Use. Summary and Explanation

Protein A Assay. Immunoenzymetric Assay for the Measurement of Protein A Catalog # F400. Intended Use. Summary and Explanation Protein A Assay Immunoenzymetric Assay for the Measurement of Protein A Catalog # F400 Intended Use This kit is intended for use in quantitating Protein A. The kit is for Research and Manufacturing Use

More information

Rat (IP3) ELISA Kit Instruction

Rat (IP3) ELISA Kit Instruction Rat (IP3) ELISA Kit Instruction Catalogue No. 201-11-0003 Preface Please carefully read this instruction before using. This ELISA kit is based on the principle of double-antibody sandwich technique to

More information

CytoSelect LDH Cytotoxicity Assay Kit

CytoSelect LDH Cytotoxicity Assay Kit Product Manual CytoSelect LDH Cytotoxicity Assay Kit Catalog Number CBA-241 960 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction The measurement and monitoring of cell cytotoxicity

More information